NOTE: the Public Can Join This Meeting Via Zoom At: Wvgwxemx2c0xjqufmn2trzz09
NOTE: The public can join this meeting via Zoom at: https://zoom.us/j/97039660428?pwd=am5GaEx WVGwxemx2c0xjQUFmN2trZz09
Meeting ID: 970 3966 0428 Passcode: 522812 Call-in: 253 215 8782
If you have trouble accessing this, please email Judith White-Crow at [email protected]
The Agency will make reasonable accommodations for any person who needs assistance to participate in the Board of Directors’ meeting, or to access our services. Our meeting facilities are ADA accessible (although this meeting will be online only). Sign language services, language translation and interpretation, and communications materials in alternative formats can be made available given sufficient notice by contacting Judith White-Crow at 206-689-4079, or you may reach her by dialing 800-552-3565, ext. 4079.
Thursday March 25, 2021 8:45 a.m.
BOARD MEETING AGENDA
8:45-8:46 Call to order – Roll Call – Quorum Established 8:46-8:50 I. Approval of Minutes February 25, 2021 Regular Meeting* ACTION 8:50-8:55 II. Petitions from the Public III. Personnel and Finance Matters 8:55-9:00 A. Approval of Vouchers* ACTION IV. Executive Session 9:00-9:30 • Collective Bargaining V. Public Hearing 9:30-10:00 A. Amending Regulation I, Section 6.04 Notice of Construction (NOC) Fees* VI. New Business 10:00-10:10 A. Election of Board Chair and Vice-Chair* ACTION 10:10-10:25 B. Resolution No. 1430 – Adopting FY22 Financial ACTION Policies* 10:25-10:35 C. Resolution No. 1431 – Adding Labor Position to ACTION Advisory Council* 10:35-10:55 D. Northwest Ports Clean Air Strategy Update* 10:55-11:00 E. Briefing – FY20 Audit Results* VII. Unfinished Business 11:00-11:20 A. FY22 Budget Per Capita Discussion* 11:20-11:50 B. Discussion – Clean Transportation Projects* 11:50-12:05 C. Equity Work – Standing Update 12:05-12:35 D. Legislative Update* 12:35-12:45 VIII. Staff Reports A. Executive Director’s Report* B. Notice of Construction Reports* C. Contract List* *Document included in Board packet
Page 2 of 3
PHONE & E-MAIL ROSTER FOR REGULARLY ATTENDING BOARD MEMBERS & PUGET SOUND CLEAN AIR AGENCY MANAGEMENT
Regularly Attending Board Members Puget Sound Clean Air Agency Management Eric Baker Jennifer Dold, General Counsel Phone: (360) 337-4495 Phone: (206) 689-4015 Fax: (360) 337-4632 Fax: (206) 343-7522 E-mail: [email protected] E-mail: [email protected] Chris Beale Kathy Strange, Air Quality Programs Director Phone: (253) 591-5470 Phone: (206) 689-4095 Fax: None Fax: (206) 343-7522 E-mail: [email protected] E-mail: [email protected] Rachel Brombaugh Steve Van Slyke, Compliance Director Phone: (206) 263-9633 Phone: (206) 689-4052 Fax: None Fax: (206) 343-7522 E-mail: [email protected] E-mail: [email protected] Betty Capestany Heather Beckford, Human Resources Manager Phone: (253) 798-6926 Phone: (206) 689-4041 Fax: (253) 798-6389 Fax: (206) 689-4039 E-mail: [email protected] E-mail: [email protected] Michelle Caulfield John Dawson, Engineering Manager Phone: (206) 684-9261 Phone: (206) 689-4060 Fax: (206) 684-3013 Fax: (206) 343-7522 E-mail: [email protected] E-mail: [email protected] Stella Chao Amy Fowler, Clean Air Initiatives Manager Phone: (206) 784-8887 Phone: (206) 689-4017 Fax: None Fax: (206) 343-7522 E-mail: [email protected] E-mail: [email protected] Megan Dunn Rick Hess, Inspection Manager Phone: (425) 388-3494 Phone: (206) 689-4029 Fax: None Fax: (206) 343-7522 E-mail: [email protected] E-mail: [email protected] Katie Ketterer Karen Houser, Finance/Purchasing Manager Phone: (360) 473-5334 Phone: (206) 689-4036 Fax: None Fax: (206) 343-7522 E-mail: [email protected] E-mail: [email protected] Paul Roberts Tania Park, Equity and Community Engagement Manager Phone: (425) 257-8781 Phone: (206) 689-4086 Fax: (425) 257-8691 Fax: (206) 343-7522 E-mail: [email protected] E-mail: [email protected] Erik Saganić, Technical Analysis Manager Phone: (206) 689-4003 Fax: (206) 343-7522 Puget Sound Clean Air Agency Executive Director E-mail: [email protected] Craig Kenworthy, Executive Director Andy Tudhope, Technology Manager Phone: (206) 689-4004 Phone: (206) 689-4090 Fax: (206) 343-7522 Fax: (206) 343-7522 E-mail: [email protected] E-mail: [email protected] Judith White-Crow (Clerk to the Board) Kim Wells, Inspection Manager Phone: (206) 689-4079 Phone: (206) 689-4020 Fax: (206) 343-7522 Fax: (206) 343-7522 E-mail: [email protected] E-mail: [email protected]
Page 3 of 3
PUGET SOUND CLEAN AIR AGENCY BOARD OF DIRECTORS MEETING
REGULAR MEETING MINUTES
February 25, 2021
Puget Sound Clean Air Agency 1904 3rd Avenue, Suite 105 Seattle, WA 98101
Note: This was an online meeting and all Agency Board members and staff were present by computer or phone. Public attendance at the meeting was by computer through the Zoom platform or by telephone. The meeting access information was published on the Agency’s website as well as in the four major newspapers in the agency’s jurisdiction in order for the public to listen to and/or participate in today’s Board meeting.
Board Members Present: Eric Baker, representing Edward Wolfe, Kitsap County Commissioner Chris Beale, City Council Member, City of Tacoma Rachel Brombaugh, representing King County Executive Dow Constantine Betty Capestany, representing Bruce Dammeier, Pierce County Executive Stella Chao, representing the Public-at-Large Megan Dunn, Snohomish County Council Member Jessica Finn-Coven, representing Mayor Jenny Durkan, City of Seattle Katie Ketterer, representing Mayor Greg Wheeler, City of Bremerton Paul Roberts, City Council Member, City of Everett
Paul Roberts called the meeting to order at 8:47 a.m.
The roll was called; a quorum was present.
Jessica Finn-Coven’s contribution to the agency was celebrated and she was presented (virtually) with a plaque recognizing her service. Mr. Roberts introduced Michelle Caulfield, new Alternate Board member representing Mayor Durkan and the City of Seattle as of March 1st.
1
I. APPROVAL OF MINUTES
Mr. Roberts asked if there was any discussion regarding the minutes from the January 28, 2021 Board meeting. There was no Board discussion.
Betty Capestany made a motion that the minutes of the January 28, 2021 Board meeting be approved as presented to the Board. The motion was seconded and passed unanimously.
II. PETITIONS FROM THE PUBLIC
Mr. Roberts opened the Petitions from the Public portion of the meeting and asked if there was anyone present who wished to address the Board.
Maria Batayola, representing the Beacon Hill Council and El Centro de la Raza, asked for assistance from the agency in monitoring and reducing GHG emissions from aircraft.
Stella Chao requested a staff briefing to the Board on this topic.
Stella Valenzuela, representing herself, expressed concern regarding emissions from the Cadman Materials Plant in Kenmore. She expressed support for House Bills 1057, 1099, and 1091.
Mr. Roberts closed the public petitions portion of the meeting.
III. PERSONNEL AND FINANCE MATTERS
Approval of Vouchers
Mr. Roberts asked if there was any discussion regarding the vouchers. There was no Board discussion.
Eric Baker made a motion that the vouchers be approved as presented to the Board. The motion was seconded and passed unanimously.
IV. EXECUTIVE SESSION
There was no Executive Session.
2
V. PUBLIC HEARING
There was no Public Hearing.
VI. NEW BUSINESS
VI.A. Resolution No. 1428 – Amending the FY21 Budget to Include Emissions Inventory Funding
Erik Saganić said Resolution No. 1428 would amend the FY21 budget to add funding for a GHG emissions inventory. He provided details regarding the inventory for the Agency’s four county region.
Ms. Finn-Coven said Seattle has a fairly detailed greenhouse gas inventory at the city level; she questioned how that will be integrated into the county data. She asked how much information will the regional inventory be able to give to cities? She asked whether this will this look at consumption-based emissions.
Mr. Saganić said in terms of benefit for the cities, we are going to have lots of detailed data that we can openly share, and people can parse out if they want to get into the weeds of it. He said it will be possible to dig in to get airport emissions like we heard earlier, or other types of emission sources.
Megan Dunn said you propose to expand the inventory to include the other three counties. She said you have a timeline of $30,000 for this year and then another $30,000 in fiscal year 2022. She asked what is the timeline for expanding to the other three counties, or what would the expected cost be for that?
Mr. Saganić said it will be all encompassing within the budget amendment proposed today and all four counties will be done on the same timeline. He said by the end of this calendar year we should have some draft data. He said from there, we will try to finalize things in 2022. He said with the way some of this data works, the sizes are lagged from population data to other things, se we are looking at modeling 2019, which is pre-COVID and the last normal year. He said we will better to able project from there for other types of things like traffic volumes as we look forward to how things have adapted with COVID.
3
Mr. Roberts asked how does what we are anticipating here differ from what we have seen before? He asked how it might be coordinated with the Puget Sound Regional Council?
Mr. Saganić said with respect to Puget Sound Regional Council, we already coordinate to ensure we use the same basis for all the work that we are doing and the approaches that we are taking. He said the forecasting work PSRC is doing is similar to the work we do with the wedges. He said this GHG emissions inventory will provide a better, more accurate estimate for where we are. He said we have been projecting since 2015 with good estimates, but this inventory will ensure we have the right numbers and importantly we will have all the other source types. He said we have been focused on transportation so with this we will have a better idea of what contributes from which type of source.
Ms. Finn-Coven made a motion to approve Resolution No. 1428 as presented to the Board. The motion was seconded and passed unanimously.
There was no further Board discussion.
VI.B. Wood Smoke Programs Review
Graeme Carvlin spoke about wood smoke health risks, air quality burn bans, forecasting, monitoring, and enforcement.
Amy Warren spoke about the agency’s wood stove program.
Chris Beale asked about swap outs from old, non-conforming wood stoves to other heat sources. He said it appears there are options such as gas inserts or wood pellets. He asked whether we promote one over the other? He said obviously the use of fossil fuels like natural or fracked gas can have other implications for air quality and climate change. He said he doesn’t know what the implications are for pellet stoves, but there is a growing movement both at the local level and the state level around not using natural gas heat sources within buildings. He asked what we are doing to promote wood pellets, and is that a safer, more environmentally friendly option?
Ms. Warren said our grant funding is focused on reducing PM, so we have focused on which method provides the greatest reduction of PM. She said going to electricity is a 100% reduction, going to natural gas is almost a 100% reduction, using pellets is an 80%
4
reduction, and certified stoves provide a 60% reduction in PM over non-certified stoves. She said this program has not been focused on GHG emissions; it has been focused on PM.
Craig Kenworthy said we have discussed the health benefits of PM reduction versus the social cost of carbon; this is an ongoing dialogue. He said when people volunteer to remove their old, non-conforming devices we meet them where they are in terms of what they choose as a replacement. He said many homes don’t have natural gas available as an option. He said the legislative direction so far has been to avoid PM nonattainment.
Ms. Finn-Coven said she has the same question, especially with growing evidence of the negative health impacts of gas stoves.
Mr. Kenworthy said if the city had information that she would like to share regarding that, we would be interested.
Mr. Roberts said he had a question for Mr. Carvlin going back to the slide that he presented showing that the thresholds had changed in 2008 and in 2012. Mr. Roberts asked if the spikes that we see after that are primarily a reflection of those changes, or are we also seeing a change in meteorological conditions that warranted the burn ban?
Mr. Carvlin said he believes it is mainly due to the changes in standards; however, he believes the effects of climate change over time are also reflected in the data.
Kelly O’Callahan spoke about the agency’s wood smoke outreach, which was focused on the wood stove program, clean-burning options, and air quality burn bans.
Rachel Brombaugh asked how the agency partners with area utilities, and is there an opportunity to potentially pair rebates in coordination with those utilities?
Ms. O’Callahan said we have reached out to a few of our utilities to make that connection, and PSE now has a plug for our wood stove program on its web page around rebates. She said Snohomish County PUD has rebates for ductless heat pumps. She said we are working on what we can do to leverage both of those rebates and communicate that to people.
Ms. Dunn asked about tribal outreach.
5
Ms. O’Callahan said some Tulalip tribal members have participated in the wood stove program.
Ms. Warren said the wood stove program is open jurisdiction-wide, so tribal land is eligible. She said we have had some connection with tribal housing organizations that have learned about the program and referred residents to us, but there is definitely more that could be done there.
There was no further Board discussion.
VI.C. Briefing – Advisory Council Vacancies
Mr. Kenworthy said the individual currently holding the Large Industry Advisory Council position, Michael Verhaar, is relocating and will be leaving the Advisory Council. Mr. Kenworthy said this position has always been represented by someone from Boeing, and Boeing would be happy to put someone forward to represent the Large Industry position again. He asked Board members if we should discuss this with Boeing or seek other options.
Ms. Chao asked if we have looked at any large industry representatives in the Duwamish valley.
Mr. Kenworthy said we have 30 facilities requiring Air Operating permits (AOPs) that would be considered large industry. He said most of those only have one location in the area; Boeing is one of the only sources that has multiple locations in the area.
Mr. Roberts said while this is not a Boeing position, it has been represented by a Boeing representative for years. He said Boeing has significant issues we work with them on and this has worked well in the past. He acknowledged it does not have to always be a Boeing representative. He reminded everyone that the Advisory Council members function is to give the Board and agency input.
Ms. Chao said as we look at who represents these industries, it is important to add an equity lens. She said maybe there is room for another voice for large sources.
Mr. Roberts agreed with Ms. Chao that equity is important.
Mr. Kenworthy said we will come back in March with ideas on how to proceed.
6
Ms. Dunn asked about progress with adding a position representing labor on the Advisory Council.
Mr. Kenworthy said he had a conversation with an IBW leader who was very interested but ultimately because of the press of other things could not serve; however, he has asked me to talk to a different IBW member. He said we are working on scheduling that conversation and so I hope to have something to report soon.
Mr. Kenworthy said Sameer Ranade has accepted a position out of state and will also be stepping down from his Advisory Council position representing Environmental Justice regionally. Mr. Kenworthy said he will come back to the Board in March with ideas on filling that position.
There was no further Board discussion.
VI.D. FY21 Second Quarter Financial Performance
Karen Houser briefed the Board on FY21 second quarter financial performance.
There was no Board discussion.
VII. UNFINISHED BUSINESS
VII.A. Briefing: FY22 Key Budget Priorities; CY22 Per Capita discussion; FY22 Financial Policies Proposed Revisions
Karen Houser briefed the Board on the per capita rate and method and the proposed revisions to the financial policies.
Ms. Finn-Coven said if we re-allocate funds that were to have been used for the Clean Fuel Standard, could we move them back if something happened with the Legislature to make it possible to move forward with the Clean Fuel Standard after all?
Mr. Kenworthy said yes.
There was no further Board discussion.
7
VII.B. Equity Work – Standing Update
Mr. Kenworthy said BIPOC staff will be meeting with the management team on March 2nd and we will provide you with an update on that conversation at the March Board meeting.
Tania Park provided an update on ongoing agency equity work.
Ms. Finn-Coven asked when the open position on the Equity team is expected to be filled and the new person can start.
Ms. Park said she hopes for an April 1st start.
Mr. Roberts said he hopes the Board will be able to see the equity toolkit when the Agency’s pilot has been completed. He said he understands that we have borrowed ideas from other jurisdictions and said he hopes those jurisdictions’ work will be acknowledged.
Ms. Park said we have an intent to bring a presentation to you walking you through our process and our progress, which will include some of the highlights that we have heard from other jurisdictions. She said a number of municipalities and jurisdictions represented on our Board are part of the Government Alliance for Racial Equity (GARE), which has been another great resource for us.
There was no further Board discussion.
VII.C. Legislative Update
Mr. Kenworthy provided a legislative update.
Mr. Beale asked about House Bill 1168. He said he believes it is part of the Public Lands Commissioner's effort on wildfire smoke response and adaptation. He said his interest is in light of the discussion we had a few months ago that regionally and locally we are not yet in a planning phase for wildfire smoke season mitigation strategies. He said there is a $20 million outlay in the bill for community resiliency. He said he wonders if local jurisdictions are going to be able to tap into that funding for air quality centers and air quality filtration for people that are at risk.
8
Mr. Kenworthy said the bill is mostly about forestry management and is not directed towards mitigating impacts of wildfire smoke.
Ms. Dunn asked about House Bill 1204, the Clean Cars bill.
Mr. Kenworthy said this is a bill by an advocacy group that would prohibit registration of any new gas-powered or diesel-powered cars, or light duty trucks, starting in 2030. He said the bill was ultimately amended into a goal and not a requirement.
Mr. Kenworthy continued his legislative update.
There was no further Board discussion.
VIII. STAFF REPORTS
Mr. Kenworthy asked if Board members had any questions.
Mr. Roberts said Goal 2 of the agency’s strategic plans references reducing transportation emissions. He asked if there has been discussion about developing models to be used for EV infrastructure. He said providing some model ordinances to local jurisdictions for EV infrastructure would be useful to give to planners to put into their codes.
Mr. Kenworthy said we have been having conversations about this and that Amy Fowler and her team will be working on some ideas around this.
With no further business, the Board meeting adjourned at 11:14 a.m.
I hereby certify this to be a true and correct record of the Minutes of the February 25, 2021, meeting of the Board of Directors of the Puget Sound Clean Air Agency.
Attest:
______Craig T. Kenworthy Paul Roberts Executive Director Chair, Board of Directors jwc
9
DATE March 18, 2021
Board of Directors TO Puget Sound Clean Air Agency
SUBJECT Vouchers Submitted for Approval
Honorable Members:
The following vouchers were issued in the Blanket Voucher Approval document dated February 16, 2021: Vouchers 26059 through 26137 in the amount of $179,902.93 for Operating Expenses.
The following voucher was issued in the Blanket Voucher Approval document dated February 25, 2021: Voucher 26138 through 26195 in the amount of $229,518.44 for Operating Expenses.
The following voucher was issued in the Blanket Voucher Approval document dated March 12, 2021: Voucher 26196 through 26270 in the amount of $222,177.60 for Operating Expenses.
Copies of the above listed vouchers are attached for your review. We request that the Board review the vouchers listed above and approve such vouchers as submitted.
Respectfully submitted,
Craig T. Kenworthy Executive Director
Attachment
jwc
- 1 -
Puget Sound Clean Air Agency (Current) Check/Voucher Register - AP Check Register From 2/16/2021 Through 2/16/2022
Effective Date Warrant Nu... Vendor Name Transaction Description Check Amount Spoiled
2/16/2021 26059 Access Agency archives-storage & retrieval 1,001.85 No 2/16/2021 26060 Accountemps J McKenzie w/e 1/29/2021 38.75 Hrs 3,248.41 No 2/16/2021 26060 Accountemps J McKenzie w/e 12/25/2020 25.75 Hrs 2,137.25 No 2/16/2021 26061 Albertsons Safeway Refund duplicate payment of 2021 Registration Fees 3,250.00 No 20210295 2/16/2021 26061 Albertsons Safeway Refund- 2021 Registration Fees Safeway FC #2729 Shaw Rd 1,350.00 No 2/16/2021 26062 Alemayehu Alemu Participation in Clean Diesel Truck Training 60.00 No 2/16/2021 26063 Allegiance Benefit Plan Management Allegiance FSA PR Contributions 2,174.48 No 2/16/2021 26064 Amazon Capital Services Inc Purell dispenser 42.88 No 2/16/2021 26065 Anderson Fireplace & Spas (Marysville) Wood Stove Replacement Rebate-SR0283 Muniz 1,500.00 No 2/16/2021 26065 Anderson Fireplace & Spas (Marysville) Wood Stove Replacement Rebate-SR0299 Gustafson 1,500.00 No 2/16/2021 26066 Argus Pacific Inc AHERA Building Inspector Refresher-K Wells 195.00 No 2/16/2021 26067 Jami Armstrong Recycle Buy-Back Incentive KP0286 Armstrong 350.00 No 26068 0.00 Yes-overrun of 26070 26069 0.00 Yes-overrun of 26070 2/16/2021 26070 Business Card 2-Federal Grant webinars/OnDemand A Brickley 498.00 No 2/16/2021 26070 Business Card A&WMA New Source Review 1,099.00 No 2/16/2021 26070 Business Card Aatrix Software-electronic filing 1099-NEC/1099-MISC 2020 57.59 No 2/16/2021 26070 Business Card Adobe Stock-monthly subscription for digital images 33.02 No 2/16/2021 26070 Business Card Amazon Web Services-purple air 213.86 No 2/16/2021 26070 Business Card Archbright-HR consulting/information services 346.00 No 2/16/2021 26070 Business Card Bank of America Annual Card Fee 25.00 No 2/16/2021 26070 Business Card Constant Contact - email management for WW Clean Cities 55.05 No 2/16/2021 26070 Business Card ConstantContact - email management service 346.82 No 2/16/2021 26070 Business Card EZTexting - burn ban/wild fire smoke texting service 149.00 No 2/16/2021 26070 Business Card Flaticon-monthly subscription for digital images 10.29 No 2/16/2021 26070 Business Card Governmental Jobs.com - Recruitment ads 990.00 No 2/16/2021 26070 Business Card Imperial Parking-5 stalls at Securities Building 2,375.00 No 2/16/2021 26070 Business Card Language Line-on demand interpreter services 280.45 No 2/16/2021 26070 Business Card LogMeIn-audio conferencing services 347.34 No 2/16/2021 26070 Business Card MicroSoft Azure-DMS service 86.33 No 2/16/2021 26070 Business Card National Public Employer Relations Assoc-training M Sweeney 249.00 No 2/16/2021 26070 Business Card National Society of Black Engineers-recruitment ads 525.00 No 2/16/2021 26070 Business Card New York Times-digital subscription 17.00 No 2/16/2021 26070 Business Card News Tribune - digital subscription 12.99 No 2/16/2021 26070 Business Card Nimble-CRM Software WW Clean Cities 60.00 No 2/16/2021 26070 Business Card ORCA Business- 2 10-Ride Passes (REB/WV) 146.80 No 2/16/2021 26070 Business Card PayPal-Processing Fees Asbestos/Registration web receipts 48.30 No 2/16/2021 26070 Business Card Seattle Times-digital subscription 15.96 No 2/16/2021 26070 Business Card Spire Technologies-AirSafe.org website 24.95 No 2/16/2021 26070 Business Card TeamViewer - premium subscription 2,165.44 No
Date: 2/16/21 08:35:16 AM Page: 1 Puget Sound Clean Air Agency (Current) Check/Voucher Register - AP Check Register From 2/16/2021 Through 2/16/2022
Effective Date Warrant Nu... Vendor Name Transaction Description Check Amount Spoiled
2/16/2021 26070 Business Card Verizon-agency cell phones 12/8-01/7/2021 2,449.20 No 2/16/2021 26070 Business Card Your Member Careers - job recruitment ads 805.00 No 2/16/2021 26070 Business Card Zoom - additional licenses for web conferences 118.94 No 2/16/2021 26071 Richard Carrigan Recycle Buy-Back Incentive KP0279 Carrigan 350.00 No 2/16/2021 26072 CDW Government MS MBG Office 365 Plan 17,168.99 No 2/16/2021 26073 Zack Cissner Recycle Buy-Back Incentive KP0292 Cissner 350.00 No 2/16/2021 26074 Cogent Communications Inc dedicated internet service 1,648.87 No 2/16/2021 26075 Yonas Dekebo Participation in Clean Diesel Truck Training 60.00 No 2/16/2021 26076 Jennifer Dold Office parking 1/31/2021 68.78 No 2/16/2021 26076 Jennifer Dold Office parking 2/1 through 2/8/2021 59.00 No 2/16/2021 26077 Bill Erickson Recycle Buy-Back Incentive KP0296 Erickson 350.00 No 2/16/2021 26078 Federal Express Corporation delivery charges 9.37 No 2/16/2021 26078 Federal Express Corporation delivery charges (D425RM) 12.93 No 2/16/2021 26079 Ed Fisher Recycle Buy-Back Incentive KP0274 Fisher 350.00 No 2/16/2021 26080 Jeffrey Fleming Recycle Buy-Back Incentive KP0289 Fleming 350.00 No 2/16/2021 26081 Four Day Fireplace LLC Wood Stove Replacement Rebate-SR0312 Park 1,500.00 No 2/16/2021 26081 Four Day Fireplace LLC Wood Stove Replacement Rebate-SR0315 Dutro 1,500.00 No 2/16/2021 26082 Aaron Glorioso Recycle Buy-Back Incentive PC0433 Glorioso 350.00 No 2/16/2021 26083 Grist Public Affairs LLC Contract Lobbying January 2021 4,000.00 No 2/16/2021 26084 Robert Hancock Recycle Buy-Back Incentive KP0305 Hancock 350.00 No 2/16/2021 26085 Robin Harris Recycle Buy-Back Incentive SN0465 Harris 350.00 No 2/16/2021 26086 Washington State Health Care Authority PEBB Health Care Authority - Medical Dental Life LTD 83,868.95 No 2/16/2021 26087 Carl Hockemeyer Recycle Buy-Back Incentive KP0290 Hockemeyer 350.00 No 2/16/2021 26088 Reo Hornibrook Recycle Buy-Back Incentive KG0597 Hornibrook 350.00 No 2/16/2021 26089 David Jahnke Recycle Buy-Back Incentive KP0277 Jahnke 350.00 No 2/16/2021 26090 Rachael Joye Recycle Buy-Back Incentive KP0295 Joye 350.00 No 2/16/2021 26091 Barbara Kline Recycle Buy-Back Incentive PC0489 Kline 350.00 No 2/16/2021 26092 Larry Knudsen Recycle Buy-Back Incentive KP0281 Knudsen 350.00 No 2/16/2021 26093 Language Line Services Over the phone interpretation 8.80 No 2/16/2021 26094 Vanessa Lange Recycle Buy-Back Incentive KG0598 Lange 350.00 No 2/16/2021 26095 Lexitas Job 2020-766952 PCHB No. P19-087c 1,602.00 No 2/16/2021 26095 Lexitas Job 2020-766953 PCHB No. P19-087c 859.95 No 2/16/2021 26095 Lexitas Job 2021-774152 Case Number P19-087C 1,098.10 No 2/16/2021 26095 Lexitas Job#2021-774151 D F Layton PhD 1-12-2021 P19-087C 1,076.25 No 2/16/2021 26096 Life Cycle Associates Review deposition corrections 3,565.00 No 2/16/2021 26097 Herbert Martin Recycle Buy-Back Incentive KP0313 Martin 350.00 No 2/16/2021 26098 Matthew Bender & Co., Inc. WA Marijuana Laws & Regs 2021 ED 77.16 No 2/16/2021 26099 Ernalee Munday Recycle Buy-Back Incentive SN0467 Munday 350.00 No 2/16/2021 26100 Tacoma News Inc Board Meeting Notice published 1/26/2021 204.67 No 2/16/2021 26100 Tacoma News Inc Board Meeting Notice published 1/26/2021 177.87 No 2/16/2021 26101 Orion Environmental Service Bulk Asbestos Sample Analysis Case#202108007 50.00 No
Date: 2/16/21 08:35:16 AM Page: 2 Puget Sound Clean Air Agency (Current) Check/Voucher Register - AP Check Register From 2/16/2021 Through 2/16/2022
Effective Date Warrant Nu... Vendor Name Transaction Description Check Amount Spoiled
2/16/2021 26102 Gene Pinard Recycle Buy-Back Incentive KP0298 Pinard 350.00 No 2/16/2021 26103 John Pownall Jr Participation in Clean Diesel Truck Training 60.00 No 2/16/2021 26104 Printwest Inc Wood Stove Program Flyers 437.49 No 2/16/2021 26105 Puget Sound Energy (91269) Account No 200004905119 Bremerton site 60.04 No 2/16/2021 26106 Katie Pursey Recycle Buy-Back Incentive KP0287 Pursey 350.00 No 2/16/2021 26107 Quadient Leasing USA Inc Mailing Equipment Lease 2/21-05/20/21 984.30 No 2/16/2021 26108 Quadient Finance USA Inc PPLN02 001 Postage 1,000.00 No 2/16/2021 26109 Race Forward 2020-2021 Core Membership GARE 2,500.00 No 2/16/2021 26110 Irene Ratliff Recycle Buy-Back Incentive SN0466 Ratliff 350.00 No 2/16/2021 26111 Tom Redmond Recycle Buy-Back Incentive PC0480 Redmond 350.00 No 2/16/2021 26112 Dan Reid Recycle Buy-Back Incentive KG0608 Reid 350.00 No 2/16/2021 26113 Glenn Riddick Recycle Buy-Back Incentive KG0607 Riddick 350.00 No 2/16/2021 26114 The Seattle Times Board Meeting Notices published January 2021 1,188.76 No 2/16/2021 26115 Seattle, City of - City Light Account 445508000 Oct-Dec 2020 137.06 No 2/16/2021 26115 Seattle, City of - City Light Account 5532100000 Marginal Way site 277.89 No 2/16/2021 26116 Peter Shelley Recycle Buy-Back Incentive KG0603 Shelley 350.00 No 2/16/2021 26117 Snohomish County PUD (1100) Account 203814413 Marysville site 54.83 No 2/16/2021 26118 Sound Publishing Inc Board Meeting Notice published 1/26/2021 134.40 No 2/16/2021 26119 South Seattle Emerald Wood Burning Promo Ads 262.50 No 2/16/2021 26120 Staples Business Credit copy paper and bubble mailer envelopes 266.59 No 2/16/2021 26121 Sundance Energy Services Inc Wood Stove Replacement Rebate-SR0289 Calder 1,500.00 No 2/16/2021 26121 Sundance Energy Services Inc Wood Stove Replacement Rebate-SR0308 Rivera 1,500.00 No 2/16/2021 26122 Sun Life Financial Sun Life Short Term Disability 271.47 No 2/16/2021 26123 City of Tacoma (Utilities) Account 100229407 Alexander site 57.03 No 2/16/2021 26124 City of Tacoma (Utilities) Account 100122818 L Street site 94.38 No 2/16/2021 26125 Bethany Tate Recycle Buy-Back Incentive KG0595 Tate 350.00 No 2/16/2021 26126 Phil Terhune Recycle Buy-Back Incentive SN0470 Terhune 350.00 No 2/16/2021 26127 Thomson Reuters - West Library Plan February 2021 445.50 No 2/16/2021 26127 Thomson Reuters - West West Proflex January 2021 714.36 No 2/16/2021 26128 US Bank Equipment Finance Sharp Copiers 1/27-2/27/2021 2,731.64 No 2/16/2021 26129 U S Bank Bill Pierre Ford - Veh 81382 repair 1,014.12 No 2/16/2021 26129 U S Bank Brown Bear carwash Veh 20143 13.00 No 2/16/2021 26129 U S Bank Burien Toyota -Veh 71396 181.54 No 2/16/2021 26129 U S Bank Fuel Veh#51389 / Uber 28.95 No 2/16/2021 26129 U S Bank GoDaddy / Zoom licenses MSFT 442.19 No 2/16/2021 26129 U S Bank Office depot-notebooks 5.71 No 2/16/2021 26129 U S Bank Rev.com / NW Trophy-board plaque 350.66 No 2/16/2021 26129 U S Bank Tisch Intl / Toyota LCW veh 20141/Ace Hardware 645.98 No 2/16/2021 26129 U S Bank Veh 51383 car wash/paper towels 19.15 No 2/16/2021 26130 Verizon Wireless Account 770200447-00001 monitoring site broadband 505.45 No 2/16/2021 26131 US Bank Voyager Fleet Systems Fleet Vehicle Fuel & Maintenance-January 2021 611.22 No
Date: 2/16/21 08:35:16 AM Page: 3 Puget Sound Clean Air Agency (Current) Check/Voucher Register - AP Check Register From 2/16/2021 Through 2/16/2022
Effective Date Warrant Nu... Vendor Name Transaction Description Check Amount Spoiled
2/16/2021 26132 Washington State Dept of Ecology Agricultural Burn Permits - July through December 2020 32.00 No 2/16/2021 26133 Washington State Ferries WS Ferry travel to Kitsap County-January 2021 82.80 No 2/16/2021 26134 Washington Counties Insurance Fund WCIF January 2021 2,302.92 No 2/16/2021 26135 Department of Enterprise Services Business cards-L Shanahan 41.29 No 2/16/2021 26135 Department of Enterprise Services Outreach Fulfillment & Storage 9.91 No 2/16/2021 26135 Department of Enterprise Services Outreach Storage & Fulfillment January 2021 9.91 No 2/16/2021 26136 West Seattle Blog Clean Burning Ad Campaign 500.00 No 2/16/2021 26137 Christopher Wren Recycle Buy-Back Incentive KP0297 Wren 350.00 No
Report Total 179,902.93
2.16.21
Date: 2/16/21 08:35:16 AM Page: 4
Puget Sound Clean Air Agency (Current) Check/Voucher Register - AP Check Register From 2/25/2021 Through 2/25/2021
Effective Date Warrant Nu... Vendor Name Transaction Description Check Amount Spoiled
2/25/2021 26138 Alderwood Water District Refund for duplicate payment of invoice 20212500 140.00 No 2/25/2021 26139 ABC Legal Services LLC Legal Messenger Service (Court of Appeals, Tacoma) 55.00 No 2/25/2021 26139 ABC Legal Services LLC vs. Kansai Motorsports USA 59.50 No 2/25/2021 26139 ABC Legal Services LLC vs. Knowles Enterprises 59.50 No 2/25/2021 26139 ABC Legal Services LLC vs. Rainier Best Cleaners 59.50 No 2/25/2021 26140 Accountemps J McKenzie w/e 2/12/2021 31 Hours 2,598.73 No 2/25/2021 26140 Accountemps Jasmine McKenzie w/e 2/19/2021 31 Hours 2,598.73 No 2/25/2021 26141 ADP LLC ADP PR Services/Workforce Now 639.18 No 2/25/2021 26141 ADP LLC ADP PR/Workforce Jan 2021 1,503.67 No 2/25/2021 26142 Allegiance Benefit Plan Management Allegiance FSA Admin Fees December 2020 157.50 No 2/25/2021 26143 Allegiance Benefit Plan Management Allegiance FSA Admin Fees 512.75 No 2/25/2021 26144 Amazon Capital Services Inc 600GB 15K SAS HDD for Dell PowerEdge Servers 127.70 No 2/25/2021 26144 Amazon Capital Services Inc postage meter tapes 37.92 No 2/25/2021 26144 Amazon Capital Services Inc Screen protector for agency iPhone 27.44 No 2/25/2021 26145 Anderson Fireplace & Spas (Marysville) Wood Stove Replacement Rebate-SR0294 Stone 1,500.00 No 2/25/2021 26145 Anderson Fireplace & Spas (Marysville) Wood Stove Replacement Rebate-SR0325 Sheler 1,500.00 No 2/25/2021 26145 Anderson Fireplace & Spas (Marysville) Wood Stove Replacement Rebate-SR0330 Lemke 1,500.00 No 2/25/2021 26145 Anderson Fireplace & Spas (Marysville) Wood Stove Replacement Rebate-SR0331 Boehme 1,500.00 No 2/25/2021 26145 Anderson Fireplace & Spas (Marysville) Wood Stove Replacement Rebate-SR0332 Chappell 1,500.00 No 2/25/2021 26146 Argus Pacific Inc Hazardous Waste Refresher-C Kitchen 220.00 No 2/25/2021 26147 Association of WA Cities AWC Associate Member -Public Agency 500.00 No 2/25/2021 26148 Botanical Designs Inc Interior Horticulture Service 122.21 No 2/25/2021 26149 CDW Government Dell WD19 90W PD 130W AC (8) 7080 17-10700T (4) 6,694.08 No 2/25/2021 26150 Mukand Cheema Participation in Clean Diesel Truck Training 60.00 No 2/25/2021 26151 Clise Agency, Inc Cost of Services Escal-March 2021 2,553.94 No 2/25/2021 26151 Clise Agency, Inc Rent - Suite 105 March 2021 50,465.00 No 2/25/2021 26151 Clise Agency, Inc Rent-4K Storage March 2021 1,000.00 No 2/25/2021 26151 Clise Agency, Inc Rent-S13 Storage March 2021 292.00 No 2/25/2021 26151 Clise Agency, Inc Rent-S5 Storage March 2021 113.00 No 2/25/2021 26152 cloudPWR Box Enterprise Edition License (9) 1,387.26 No 2/25/2021 26153 Jerry Coulter Recycle Buy-Back Incentive KP0303 Coulter 350.00 No 2/25/2021 26154 Town of Darrington Wood Waste Reduction Program-CY2020 3,221.99 No 2/25/2021 26155 Darrington School District Monitoring site rent-March 2021 100.00 No 2/25/2021 26156 Darrington Fire Department #24 Support for Winter Mailing Letter 1,288.51 No 2/25/2021 26157 Greg Dea Recycle Buy-Back Incentive KG0600 Dea 350.00 No 2/25/2021 26158 Doug Dormaier Recycle Buy-Back Incentive KP0284 Dormaier 350.00 No 2/25/2021 26159 Foster Garvey PC Professional Services - January 2021 6,527.50 No 2/25/2021 26160 General Services Administration Rent-Building WA0953KC March 2021 465.50 No 2/25/2021 26161 Marianna & Kevin Hanefeld Recycle Buy-Back Incentive KG0426 Hanefeld 350.00 No 2/25/2021 26162 Ashley Hoge Recycle Buy-Back Incentive SN0472 Hoge 350.00 No 2/25/2021 26163 Eric Holm Recycle Buy-Back Incentive KP0308 Holm 350.00 No
Date: 2/25/21 11:03:39 AM Page: 1 Puget Sound Clean Air Agency (Current) Check/Voucher Register - AP Check Register From 2/25/2021 Through 2/25/2021
Effective Date Warrant Nu... Vendor Name Transaction Description Check Amount Spoiled
2/25/2021 26163 Eric Holm Recycle Buy-Back Incentive KP0318 Holm 350.00 No 2/25/2021 26164 Travis Hull Recycle Buy-Back Incentive KP0310 Hull 350.00 No 2/25/2021 26165 King County Superior Court Clerk Civil Filing/Extension of Judgment Vetter/Nelson 484.00 No 2/25/2021 26166 Kitsap Sun Board Meeting Notices published in January 2021 432.36 No 2/25/2021 26167 Jeff Knight Participation in Clean Diesel Truck Training 60.00 No 2/25/2021 26168 Department of Labor & Industries Labor and Industries Workers Compensation Q4 Oct-Dec 13,071.84 No 2020 2/25/2021 26169 Lexitas Job No 2020-767011 Keith Faretra Case TX140621 1,361.50 No 2/25/2021 26169 Lexitas Job No 2020-772691 Armando Levy, PhD Case TX140621 1,141.20 No 2/25/2021 26169 Lexitas Job No 2020-772692 Shari Libicki PhD Case TX140621 2,245.50 No 2/25/2021 26169 Lexitas Job No 2020-772704 Eri Ottersburg Case TX140621 2,834.75 No 2/25/2021 26169 Lexitas Job No 2020-772705 James Hogan Case TX140621 1,824.50 No 2/25/2021 26169 Lexitas Job No 2021-774307 Louis Kalani Case TX140621 567.60 No 2/25/2021 26169 Lexitas Job No 2021-775382 Jan Hagen Anderson Case P19-087C 1,080.50 No 2/25/2021 26169 Lexitas Job No 2021-775383 Patrick Couch Case P19-087C 631.45 No 2/25/2021 26169 Lexitas Job No 2021-775384 Filippo Gavelli PhD, PE Case P19-087C 1,053.65 No 2/25/2021 26169 Lexitas Job No 2021-776943 Joseph Pratt, Vol II Case P19-087c 683.10 No 2/25/2021 26169 Lexitas Job No. 2020-765854 Carole Cenci 1,450.50 No 2/25/2021 26170 Magee Scientific Corporation New AE33 Filter Tape 1,010.00 No 2/25/2021 26171 Marysville School District No. 25 Monitoring site rent-March 2021 250.00 No 2/25/2021 26172 Tim McMahon Recycle Buy-Back Incentive KP0304 McMahon 350.00 No 2/25/2021 26173 Jeff Medeiros Recycle Buy-Back Incentive KP0311 350.00 No 2/25/2021 26174 Tacoma News Inc Clean Burning Outreach Ad Campaign 2,250.00 No 2/25/2021 26175 Office Depot binder tabs 13.76 No 2/25/2021 26175 Office Depot Heavy Duty Staples 7.99 No 2/25/2021 26175 Office Depot notebooks/ tape 38.35 No 2/25/2021 26175 Office Depot Stapler / Copy Paper 44.66 No 2/25/2021 26175 Office Depot Staplers 36.24 No 2/25/2021 26176 Elliot Omernik Recycle Buy-Back Incentive SN0469 Omernik 350.00 No 2/25/2021 26177 Rick Perry Recycle Buy-Back Incentive SN0471 Perry 350.00 No 2/25/2021 26178 David Potter Participation in Clean Diesel Truck Training 60.00 No 2/25/2021 26179 Printwest Inc Drayage Truck Mesh Banners 661.59 No 2/25/2021 26180 Puget Sound Energy (91269) Account 200019845169 Kent site 51.44 No 2/25/2021 26181 Puyallup Tribe, The Air Monitoring Site Rent-March 2021 75.00 No 2/25/2021 26182 Seattle, City of - City Light Account 4455080000 42nd Ave South 78.43 No 2/25/2021 26183 Noel Smarr Recycle Buy-Back Incentive PC0490 Smarr 350.00 No 2/25/2021 26184 Devon Smith Participation in Clean Diesel Truck Training 60.00 No 2/25/2021 26185 Sound Publishing Inc Clean Burning Ad Campaign-Daily Herald/Auburn Re/Kitsap 5,928.00 No pub 2/25/2021 26186 South Park Area Redevelopment Com... Air Monitoring Site Rent-March 2021 50.00 No 2/25/2021 26187 Summit Law Group PLLC Professional Services-January 2021 2,124.00 No
Date: 2/25/21 11:03:39 AM Page: 2 Puget Sound Clean Air Agency (Current) Check/Voucher Register - AP Check Register From 2/25/2021 Through 2/25/2021
Effective Date Warrant Nu... Vendor Name Transaction Description Check Amount Spoiled
2/25/2021 26188 Robert W Switalski Agency Parking 9/2020-2/9/2021 112.00 No 2/25/2021 26189 Utopia Media & Entertainment LLC Revision of Clean Burning Checklist translations 140.00 No 2/25/2021 26190 Verizon Wireless Agency Cell Phones Account 771873428-00001 1,612.02 No 2/25/2021 26191 Carlos Villa Participation in Clean Diesel Truck Training 60.00 No 2/25/2021 26192 Washington State Auditor's Office Audit No. 53175 Audit Period 20-20 154.5 Hours 17,473.95 No 2/25/2021 26193 Washington State Dept of Ecology DOF-0004 Air Development & Oversight FY2021 36,800.00 No 2/25/2021 26194 Department of Enterprise Services agency window envelopes 72.35 No 2/25/2021 26194 Department of Enterprise Services NO. 9 Envelopes (Registration return) 300.27 No 2/25/2021 26195 West Hills Kia 2020 Kia Niro EV EX Stock No. KA7458 Snow White Pearl 35,647.83 No
Report Total 229,518.44
2.25.21
Date: 2/25/21 11:03:39 AM Page: 3
Puget Sound Clean Air Agency (Current) Check/Voucher Register - AP Check Register From 3/12/2021 Through 3/12/2021
Effective Date Warrant Nu... Vendor Name Transaction Description Check Amount Spoiled
3/12/2021 26196 ABC Legal Services LLC vs. RWoodsII LLC dba Optimum Extracts 59.50 No 3/12/2021 26197 Abila MIP Fund Accounting Maintenance & Support Plan 3,904.31 No 3/12/2021 26198 Andrew Abraham Recycle Buy-Back Incentive PC0488 Abraham 350.00 No 3/12/2021 26199 Access Agency archives-storage & retrieval 1,354.69 No 3/12/2021 26200 Accountemps Jasmine McKenzie w/e 3/5/2021 38.75 Hours 3,248.41 No 3/12/2021 26201 Michael Alazar Participation in Clean Diesel Truck Training 60.00 No 3/12/2021 26202 Allegiance Benefit Plan Management Allegiance FSA PR Contributions 2,174.48 No 3/12/2021 26203 Amazon Capital Services Inc Credit Memo for Invoice 1T6W-TRMK-MD3H (bubble mailers) (39.09) No 3/12/2021 26203 Amazon Capital Services Inc Logitech USB Headset/Microphone (6) 254.28 No 3/12/2021 26203 Amazon Capital Services Inc Rapid cartridge stapler cartridges/heavy duty staples 132.79 No 3/12/2021 26203 Amazon Capital Services Inc USB Hubs/USB Microphones 184.89 No 3/12/2021 26203 Amazon Capital Services Inc wireless doorbell/air horn (office security) 40.71 No 3/12/2021 26204 Anderson Fireplace & Spas (Marysville) Wood Stove Replacement Rebate-SR0282 Taylor 1,500.00 No 3/12/2021 26204 Anderson Fireplace & Spas (Marysville) Wood Stove Replacement Rebate-SR0301 1,500.00 No Davis-Wolfe/Thomson 3/12/2021 26204 Anderson Fireplace & Spas (Marysville) Wood Stove Replacement Rebate-SR0313 Deatherage 1,500.00 No 3/12/2021 26204 Anderson Fireplace & Spas (Marysville) Wood Stove Replacement Rebate-SR0335 Cawley 1,500.00 No 3/12/2021 26205 Argus Pacific Inc AHERA Building Inspector Refresher-J Zaldivar 195.00 No 3/12/2021 26205 Argus Pacific Inc Hazardous Waste Refresher-K Wells 235.00 No 3/12/2021 26206 Amjad Asghar Participation in Clean Diesel Truck Training 60.00 No 3/12/2021 26207 Anu Taranath BIPOC Affinity Group Facilitations Nov-March 2021 10,500.00 No 3/12/2021 26208 ATEC Air Toxic Samplers 52,175.00 No 3/12/2021 26209 Attorneys Eagle Eye Service AEES Bulletin March/April 2021 63.86 No 3/12/2021 26210 Ron Bishop Recycle Buy-Back Incentive KP0282 Bishop 350.00 No 3/12/2021 26211 Bjorn Bjorke Recycle Buy-Back Incentive KP0293 Bjorke 350.00 No 3/12/2021 26212 Botanical Designs Inc Interior Horticulture Service 122.21 No 3/12/2021 26213 Michael Bravin Recycle Buy-Back Incentive KP0300 Bravin 350.00 No 3/12/2021 26214 Chloe Brezsny Recycle Buy-Back Incentive KP0323 Brezsny 350.00 No 3/12/2021 26215 Ashley Christian Recycle Buy-Back Incentive PC0486 Christian 350.00 No 3/12/2021 26216 Mark Clark Recycle Buy-Back Incentive KG0613 Clark 350.00 No 3/12/2021 26217 Michael Clark Recycle Buy-Back Incentive KP0321 Clark 350.00 No 3/12/2021 26218 Cogent Communications Inc dedicated internet service 1,648.87 No 3/12/2021 26219 Daily Journal of Commerce Public Notice: Hearing Regulation I 186.20 No 3/12/2021 26220 Jennifer Dold Office parking w/o 2/22/21 and 3/1/21 122.78 No 3/12/2021 26221 EarthGen Breath Easier tasks 2 through 8 5,091.25 No 3/12/2021 26222 Federal Express Corporation delivery charges 23.83 No 3/12/2021 26222 Federal Express Corporation delivery charges (TSI) 7.88 No 3/12/2021 26222 Federal Express Corporation delivery services 7.00 No 3/12/2021 26223 Fuller Electric Electrical install-Auburn site (less $ 1405.09 prepay) 1,570.09 No 3/12/2021 26224 Joanna Gangi CID Focus Community-Filter Fan Survey gift cards 1,000.00 No 3/12/2021 26225 Matthew Harper EV Charging reimbursement Jan/Feb 2021 48.00 No
Date: 3/12/21 08:24:20 AM Page: 1 Puget Sound Clean Air Agency (Current) Check/Voucher Register - AP Check Register From 3/12/2021 Through 3/12/2021
Effective Date Warrant Nu... Vendor Name Transaction Description Check Amount Spoiled
3/12/2021 26226 Washington State Health Care Authority PEBB Health Care Authority - Medical Dental Life LTD 85,241.86 No 3/12/2021 26227 Lily Kay Recycle Buy-Back Incentive KG0557 Kay 350.00 No 3/12/2021 26228 Marian Khaytu Participation in Clean Diesel Truck Training 60.00 No 3/12/2021 26229 Chris Kitchen EV Charging April 2020 - March 1, 2021 18.18 No 3/12/2021 26230 Language Line Services Over the phone interpretation 116.89 No 3/12/2021 26231 Lexitas Job 2021-779265 Matthew Stobart Case TX140621 2,455.35 No 3/12/2021 26231 Lexitas Job 2021-779913 Matthew Stobbart Case TX140621 650.75 No 3/12/2021 26231 Lexitas Job 2021-779914 Pamela Berner Case TX140621 1,521.95 No 3/12/2021 26231 Lexitas Job 2021-781598 Matthew Stobart 1,260.00 No 3/12/2021 26232 Rob Mason Recycle Buy-Back Incentive KP0280 Mason 350.00 No 3/12/2021 26233 McClatchy Company LLC Board Meeting Notice published 2/23/2021 226.11 No 3/12/2021 26233 McClatchy Company LLC Clean Burning Ads-February 2021 2,250.00 No 3/12/2021 26234 Anthony Meysenburg Recycle Buy-Back Incentive PC0484 Meysenburg 350.00 No 3/12/2021 26235 Hank Myers Recycle Buy-Back Incentive KG0566 Myers 350.00 No 3/12/2021 26236 NEMA PFAS Transport, Fate & Remediation-McAfee 395.00 No 3/12/2021 26237 Beth Nichols Recycle Buy-Back Incentive KP0299 Nichols 350.00 No 3/12/2021 26238 Office Depot Binder clips, sticky notes,post-its 95.13 No 3/12/2021 26238 Office Depot Credit Memo for Invoice 154041860001 (0.54) No 3/12/2021 26238 Office Depot Dry Erase Board 10.65 No 3/12/2021 26238 Office Depot Dry Erase Markers 7.80 No 3/12/2021 26239 Aleksandr Ostapets Participation in Clean Diesel Truck Training 60.00 No 3/12/2021 26240 Joseph Ostheller Recycle Buy-Back Incentive KP0273 Ostheller 350.00 No 3/12/2021 26241 Adam Petrusky Windshield replacement for fleet vehicle #20141 355.95 No 3/12/2021 26242 John Pliska Recycle Buy-Back Incentive KG0540 Pliska 350.00 No 3/12/2021 26243 Jim Poulakis Recycle Buy-Back Incentive KP0306 Poulakis 350.00 No 3/12/2021 26244 Printwest Inc Drayage Truck Mesh Banners (2) 519.89 No 3/12/2021 26245 Puget Sound Energy (91269) Account 200004905119 Bremerton site 57.84 No 3/12/2021 26246 Quadient Finance USA Inc PPLN02 001 Postage 1,000.00 No 3/12/2021 26247 The Seattle Times Board Meeting Notice published 2/22/2021 473.40 No 3/12/2021 26248 Seattle, City of - City Light Account 5532100000 Marginal Way site 102.88 No 3/12/2021 26249 Warren Smith Recycle Buy-Back Incentive SN0477 Smith 350.00 No 3/12/2021 26250 Snohomish County PUD (1100) Account 202191474 Lynnwood site 35.28 No 3/12/2021 26251 Sound Publishing Inc Clean Burning ads-Daily Herald/Aub Reporter/Kitsap pub. 4,858.25 No 3/12/2021 26252 Daniil Stoyan Participation in Clean Diesel Truck Training 60.00 No 3/12/2021 26253 Sundance Energy Services Inc Wood Stove Replacement Rebate-SR0273 Atienza 1,500.00 No 3/12/2021 26254 City of Tacoma (Utilities) Account 100122818 L Street monitoring site 89.75 No 3/12/2021 26255 City of Tacoma (Utilities) Account 100229407 Alexander site 53.04 No 3/12/2021 26256 Teamsters Local Union 763 Dues - Local Union 763 4,645.00 No 3/12/2021 26257 Thomson Reuters - West Library Plan Charges March 2021 445.50 No 3/12/2021 26257 Thomson Reuters - West West Proflex February 2021 714.37 No 3/12/2021 26258 TSI Incorporated Calibration of Flowmeter 4140 256.03 No
Date: 3/12/21 08:24:20 AM Page: 2 Puget Sound Clean Air Agency (Current) Check/Voucher Register - AP Check Register From 3/12/2021 Through 3/12/2021
Effective Date Warrant Nu... Vendor Name Transaction Description Check Amount Spoiled
3/12/2021 26259 Linda Tsubaki Recycle Buy-Back Incentive KP0312 Tsubaki 350.00 No 3/12/2021 26260 Morgan Turner Recycle Buy-Back Incentive KG0606 Turner 350.00 No 3/12/2021 26261 US Bank Equipment Finance Sharp Copiers 2/27-3/27/2021 2,895.51 No 3/12/2021 26262 U S Bank Columbia Books-webinar Pref Treatment/Buy American 249.00 No Brickley 3/12/2021 26262 U S Bank DOT.GOV Registration-domain renewal 400.00 No 3/12/2021 26262 U S Bank Fuller Electronic-deposit for Auburn site electrical 1,405.09 No 3/12/2021 26262 U S Bank Luxe Mobile Auto Detail /O'Reilly Auto Parts fleet veh#20091 208.01 No 3/12/2021 26262 U S Bank Mouser Electronics-Sensors/Raspberry Pi sensor dev tools 270.46 No 3/12/2021 26262 U S Bank NEPELERA-NP Employer Labor Relations Association 225.00 No 3/12/2021 26262 U S Bank Rev.com-Board transcription NW Trophy-C True recognition 492.46 No 3/12/2021 26262 U S Bank SyreSoftWare-PierTrucker advertisements 600.00 No 3/12/2021 26263 Verizon Wireless Account 770200447-00001 monitoring site modems 505.59 No 3/12/2021 26264 Roger Vielbig Recycle Buy-Back Incentive KP0276 Vielbig 350.00 No 3/12/2021 26265 Washington State Auditor's Office Audit No. 53175 Period 20-20 46 Hrs 5,202.60 No 3/12/2021 26266 Washington State Ferries Ferry Travel-February 2021 32.80 No 3/12/2021 26267 Washington Counties Insurance Fund WCIF FEB 2021 2,302.92 No 3/12/2021 26268 Department of Enterprise Services Outreach Fulfillment/Storage-February 2021 9.91 No 3/12/2021 26269 Edward Yakimov Participation in Clean Diesel Truck Training 60.00 No 3/12/2021 26270 Case Zegstroo Recycle Buy-Back Incentive KP0333 Zegstroo 350.00 No
Report Total 222,177.60
3.12.21
Date: 3/12/21 08:24:20 AM Page: 3
DATE March 18, 2021
Board of Directors TO Puget Sound Clean Air Agency
SUBJECT Public Hearing on Amending Regulation I, Section 6.04 Notice of Construction (NOC) Fees
Honorable Members:
The public hearing regarding the Agency’s proposed changes to the Notice of Construction (NOC) fees in Regulation I, Section 6.04, will be conducted at the March Board meeting. The Board will see an action item on this proposal at the April Board meeting.
Agency staff provided the Board with an overview of the NOC program at the January Board meeting. On February 11th, the Board held a Study Session to learn more about this proposal, and Agency staff held a public fee workshop via Zoom on February 17th.
The public comment period for this rule change began on February 22nd, and comments will be accepted through March 29th. The proposed fee changes, as well as background materials, are on the Agency’s website at https://www.pscleanair.gov/221/Public-Hearings.
After the conclusion of the public comment period, Agency staff will prepare responses to all comments. A recommendation for Board action on the proposal will be presented at the April 22, 2021, Board meeting. If approved by the Board, the proposed fee changes would apply to NOC applications received on or after June 1, 2021.
Respectfully submitted,
Craig T. Kenworthy Executive Director jwc
- 1 -
DATE March 18, 2021
Board of Directors TO Puget Sound Clean Air Agency
SUBJECT Election of Board Chair and Vice-Chair
Honorable Members:
The Board of Directors elects officers in March each year and we recommend Board members elect a Chair and Vice-Chair by motion at the March Board meeting.
I have spoken with Councilmember Paul Roberts and he has agreed to continue to serve as Board Chair, should the Board wish him to do so. I also understand that Councilmember Chris Beale is willing to serve as Vice-Chair, should the Board wish him to do so.
Respectfully submitted,
Craig T. Kenworthy Executive Director jwc
DATE March 18, 2021
Board of Directors TO Puget Sound Clean Air Agency
SUBJECT Resolution No. 1430 – Adopting the FY22 Financial Policies
Honorable Members:
The purpose of this memo is to present for action the FY22 Financial Policies. In each budget cycle, management reviews the prior year’s financial policies and makes recommendations for changes, if needed. We review the types and levels of reserves, whether substantial risks are mitigated, and whether the stated uses of reserves are appropriate. We are recommending several minor revisions to the financial policies that reflect current conditions and provide flexibility in developing a balanced and sustainable budget for FY22.
In February, we reviewed with the Board the recommended changes to the FY22 Financial Policies, and Attachment A (FY22 Proposed Financial Policies) incorporates these recommended changes. The sections of the financial policies with recommended revisions are summarized below (changes are in italics and underlined):
Interest Income Reserve (see Attachment A – Section II.E. for current policy)
King County acts as the agency’s treasurer and our reserves are managed by the King County Investment Pool. We receive monthly interest earned, net of King County’s cash and investment management fees. In the past, we have used the net earnings for various purposes – to allocate back to all other reserves, to build our General Fund Reserve or “Rainy Day” Reserve, to add to our Unemployment Reserve (we are self-funded for unemployment), and to fund the Employer Retirement Reserve (reserve for post-budget adoption legislative changes to the required employer pension contributions). In the last several years, net interest earnings have accumulated in this reserve and, at the end of December 2020, the balance was $515K (excluding unrealized gains on investments).
For FY22, we propose removing the uses of this reserve for office relocation expenses and for implementing a possible Clean Fuel Standard. We propose adding other uses for this reserve - short-term bridge funding for a budget year, or for operational expenses related to Covid-19 impacts.
Civil Penalties (see Attachment A – Section III.B. for current policy)
We have historically taken a conservative approach to the use of reserves from previously collected civil penalties through constraining the uses to one-time non- ordinary, temporary bridge funding, and non-personnel expenses. In the past, we have used these reserves to fund outreach in non-attainment areas such as the Woodsmoke Reduction Zone in Tacoma/Pierce County, wood waste removal (without burning) in Snohomish County, reimbursements to rural fire districts for responding to outdoor burning events, outreach, and education about air pollution in our Hi-C communities, and unusual legal expenses. We don’t budget or set targets for the collection of civil penalties, but we do include expenditures from this reserve (previously collected penalties) in our budget year.
For FY22, we propose excluding the use of this reserve for office relocation expenses.
General Fund Reserve (see Attachment A – Section IV.B.4 for current policy)
This reserve is for non-fee program related items such as unanticipated budget items, emergency funding, insurance deductibles and bridge funding. Prior to FY16, the agency did not have a “rainy day” fund for these types of risks – this was established with a target of 10% of discretionary or non-fee revenues and we have reached its target of $495K. In FY21, this reserve was increased by $250,000 from expenditure reductions in FY20.
For FY22, we propose removing the use of this reserve for office relocation expenses and for implementing a possible Clean Fuel Standard.
Clean Cities Coalition
We also removed references, throughout the policies, to the Clean Cities Coalition since this program has been transferred to the Columbia Willamette Clean Cities Coalition.
- 2 -
Attached for your consideration are the FY22 Proposed Financial Policies and Resolution No. 1430. We recommend that the Board adopt this resolution for the FY22 Financial Policies.
Respectfully submitted,
Craig T. Kenworthy Executive Director
Attachment jwc
- 3 -
RESOLUTION NO. 1430
RESOLUTION OF THE BOARD OF DIRECTORS OF THE PUGET SOUND CLEAN AIR AGENCY APPROVING THE FISCAL YEAR 2022 FINANCIAL POLICIES OF THE PUGET SOUND CLEAN AIR AGENCY
WHEREAS, the Board of Directors of the Puget Sound Clean Air Agency (Agency) has previously adopted Financial Policies for the Agency and such policies cover financial planning, revenues, expenditures, use of funds, fund reserves, asset capitalization and inventory procedures, and capital equipment and IT reserve accounts; and
WHEREAS, the Board of Directors desires to update the Financial Policies to reflect changes in Agency circumstances and to reflect good financial management and practices; and
WHEREAS, the Board of Directors finds the attached Financial Policies reflect its direction to the Agency regarding financial management and practices, and desires the Agency to follow such policies; now, therefore:
BE IT RESOLVED BY THE BOARD OF DIRECTORS OF THE PUGET SOUND CLEAN AIR AGENCY:
Section 1: The Board of Directors of the Puget Sound Clean Air Agency hereby approves and adopts the attached FY22 Financial Policies of the Puget Sound Clean Air Agency.
PASSED AND APPROVED by the Board of Directors at a regular meeting of the Board on this 25th day of March, 2021.
PUGET SOUND CLEAN AIR AGENCY
By ______Paul Roberts Chair, Board of Directors
Attest:
By ______Craig T. Kenworthy Executive Director
Approved as to form:
By ______Jennifer Dold Agency Counsel
- 1 -
Attachment A – FY22 Proposed Financial Policies
Fiscal Year 2022 – Puget Sound Clean Air Agency Financial Policies
I. Planning Policies
A. Balanced Budget
As required by RCW 70.94.092, on or before the fourth Monday in June of each year, the Board of Directors adopts a budget for the following fiscal year (July 1 – June 30). The budget is a balanced budget and contains adequate funding and provides for staff sufficient to carry out the provisions of all applicable resolutions and regulations related to air pollution reduction, prevention and control.
The Board takes action to amend the budget when unanticipated funding is received such as grants, or in the event of other significant unforeseen events that may affect the budget.
B. Multi-Year Planning
Sound fiscal management and planning are important to the health of the agency. To this end, the agency engages in multi-year planning each year to assess and evaluate items such as the financial implications of current and proposed operating and capital budgets, the fund balance, financial policies, issues related to state and federal funding, the agency’s vision and strategic plans, and other foreseeable trends and issues that may affect the future of the agency. Strategic plans may include vision statements, multi-year strategies and annual work plans. The information developed during long-range planning is used in preparing the annual budget.
C. Asset Inventory
To safeguard agency assets purchased with public funds and to ensure adequate internal controls are maintained, the agency inventories and assesses the condition of all major capital assets. Agency assets are used only for agency business purposes. (See Appendix 1, Asset Capitalization and Inventory Procedures).
Asset inventory information is used to plan for the ongoing financial commitments and future needs of the agency.
- 1 -
Attachment A – FY22 Proposed Financial Policies
II. Revenue Policies
A. Revenue Diversification
To the extent feasible, the agency maintains a diversified and stable revenue system to improve its ability to handle fluctuations in any individual source of funding. The agency does not rely solely on state and federal funds and consistently seeks additional sources of revenue.
B. Per Capita and Fee Revenues
1. Per Capita (Proportion of Supplemental Income) - Cities, towns and counties are required by state law to contribute annually to the agency’s operations. RCW 70.94.093 stipulates various methods for determining the proportion of supplemental income of this per capita revenue. During the annual budget process, the Board determines which method to use. In addition, the Board annually reviews the amount of the per capita assessment, considering such factors as the rate of inflation compared with the rates of population growth and/or assessed valuation of property, the agency’s revenue needs for programs and/or equipment that cannot be fully supported by other funds, whether or not programs requiring funding are mandatory, and appropriate equitable factors. For each annual budget, the budget amount of Per Capita revenues (Supplemental Income) will be determined by combining 50% of the prior calendar year per capita assessment amount along with 50% of the budget calendar year amount.
2. Fee-Based Revenues - Revenues collected for a specific fee-based program are retained within that program in the fund balance. Fees collected for one fee- based program cannot be spent on a different program. Annual increases may be adopted to ensure that each program remains self-supporting in current and future years and that fee reserve fund balances are retained. Fees may also include temporary surcharges to reflect technological advances or mandated requirements for a specific program.
Fee-based programs are self-supporting and as required by law, the amount of the fees may only cover the cost of administering the program. See RCW 70.94.151
- 2 -
Attachment A – FY22 Proposed Financial Policies
(registration fees), 70.94.152 (notice of construction fees), and 70.94.162 (operating permit fees).
C. Use of Funds
1. Use of One-Time and Unpredictable Revenues - To the extent feasible, the agency uses one-time revenues for one-time expenditures and unpredictable revenues for a specific purpose and not to finance ongoing programs or operations.
2. Federal Section 103 Funds - These funds are provided by EPA to pay for a specific project. Currently, the Federal Section 103 grant pays for the costs contained in the agency’s annual contract with the Department of Ecology for PM2.5 monitoring.
3. Federal Section 105 Funds (Base Grant) - These funds support activities required by EPA through the grant agreement for the federal priorities that are not supported by fees. This includes protecting human health by reducing emissions of PM2.5, ozone, and other criteria and toxic air pollutants; and characterizing the health consequences of air pollution, collecting data that has the greatest benefit for public health, and increasing the public understanding of the health effects and costs of pollution.
4. Other Grants (Special Project or Sub-Recipient) - When the agency receives grant funds for specific projects, staff time and operational expenses necessary to administer the grants are normally charged against the grants.
5. State Wood Stove Account Funds - The state wood stove funds are required to be spent on wood stove education and enforcement. The education program may include raising awareness of impaired air quality burn bans, the effects of wood stove emissions on health and air quality, methods of achieving better efficiency and emission performance from wood stoves, which wood stoves are approved by Ecology, or the benefits of replacing inefficient wood stoves with new stoves. The enforcement program may include air quality monitoring, developing air quality forecast products, and enforcement of impaired air quality burn bans.
- 3 -
Attachment A – FY22 Proposed Financial Policies
6. State Grant (Core) - The highest priority for these funds is to implement state requirements not covered by fees, the federal Section 105 grant or the wood stove account funds. This includes managing indoor and outdoor burning regulations and burn bans and working with fire departments and other partners to help people understand outdoor burning restrictions, where applicable, and cleaner alternatives to yard debris disposal where burning is still allowed.
7. Local Supplemental Income (Per Capita) - The highest priority for these funds is to address local and state priorities not paid for by other sources of funds. This includes, but is not limited to, elements of the agency strategic plan not funded by other sources, for example environmental justice, climate protection, policy advocacy, and regional transportation planning.
D. Civil Penalty Revenues
As a result of its compliance activities, the agency receives civil penalty revenues. To ensure the agency is not perceived as assessing civil penalties to support its operations, revenue from civil penalties collected goes directly to a separate fund to be used in accordance with Section III B. of this policy. In preparing budgets, the agency does not include an amount of projected civil penalty revenue for the next fiscal year, but does include expenditures of civil penalty revenues, in accordance with this policy, previously received.
E. Interest Income Revenues
Unless otherwise provided in this section, the agency allocates earned interest income revenues to all fund cash accounts every month based on the cash in each fund at the end of the month, with the exception of certain grant funds due to audit restrictions.
For FY22 interest income and investment recaptures (from previous investment losses) during the year will be transferred to the Interest Income Fund. The Interest Income Fund balance of $7k is reserved for potential impaired investment write-offs from the King County Investment Pool. The excess balance above this amount, from interest income earned, can be used, with Board approval, for unforeseen one-time non-personnel expenditure needs that may arise in the fiscal year, for short-term
- 4 -
Attachment A – FY22 Proposed Financial Policies
bridge funding for a budget year, or for operational expenses related to Covid-19 impacts.
- 5 -
Attachment A – FY22 Proposed Financial Policies
III. Expenditure Policies
A. Operating/Capital Expenditures
The agency periodically compares actual expenditures to budget and decides upon any actions needed to bring the budget into balance. To this end, quarterly financial statements are prepared for and reviewed by agency management, and quarterly financial information is provided to the Board of Directors.
B. Civil Penalties
Revenue from civil penalties collected may be expended only for the purposes described in this policy. These purposes include support for: • establishing and maintaining strategic partnerships; • promotional and outreach activities (to include communication tools, services and materials) that support our vision; • efforts to address inequities in air pollution exposure; • community-focused air quality characterization or improvement projects; • voluntary and incentive-based programs that produce quantifiable climate, toxics or criteria pollutant benefits; and • atypical or unusual legal expenses.
Such projects are budgeted annually based on the agency's objectives and the availability of previously collected funds. The agency may also use a portion of a specific civil penalty to reimburse a fee-based program where there are extraordinary costs associated with a particular enforcement action. Also, the agency may negotiate non-financial civil penalty settlements, such as requiring in- kind support or direct education and outreach activities as Supplemental Environmental Projects.
C. Debt Issuance
As authorized by RCW 70.94.091, the agency may levy additional taxes in excess of the constitutional and/or statutory tax limitations for any authorized purpose.
- 6 -
Attachment A – FY22 Proposed Financial Policies
IV. Fund Balance Policies
A. Contingency Account
The agency maintains a contingency account that would be used in the event the agency was forced to close its doors permanently. The account includes funds to pay any agency obligations for employees at retirement and other legally required amounts. The agency maintains sufficient funds in this account to meet these obligations to the extent such obligations are reasonably foreseeable. The contingency accounts are reviewed each year as part of the budget process.
This account shall include funds sufficient to cover one hundred percent of the potential excess compensation owed to the Washington State Department of Retirement Systems for PERS 1 retirees, one hundred percent of the potential liability for accrued employee vacation and any potential liability for one-third of accrued employee sick leave.
B. Stabilization Accounts
The agency maintains a prudent level of financial resources to strive to protect against the need to reduce service levels or raise fees due to temporary revenue shortfalls, unforeseen one-time expenditures, or cash flow needs. Funds that have been set aside for future or special use are set aside in the designated funds balance. This includes the Clean Air Act Reserve Accounts, Capital Equipment, Software Applications, and IT Services Reserve, Department Reserve Accounts and General Fund Reserve. The stabilization accounts are reviewed each year as part of the budget process.
1. Clean Air Act Reserve Accounts - Each fee-based program has a separate reserve account and these fee reserve balances are reviewed on an annual basis. For the Asbestos and Notice of Construction programs, the reserve balance should be approximately 50% of the annual cost of the program. For the Registration and Operating Permit programs, the reserve balance should be approximately 25% of the annual cost of the program. A portion ($200,000) of the fee program fund balances is reserved as the Compliance Division Reserve for unanticipated expenses relating to fee program work that occurs during a fiscal year. This reserve will be replenished by appropriate fee funds each year.
- 7 -
Attachment A – FY22 Proposed Financial Policies
2. Capital Equipment, Software Applications, and IT Services Reserve
- To the extent practical, the agency budgets for routine capital equipment, software, and IT services needs each year through current revenues rather than use of funds in reserve accounts. However, the agency maintains a capital equipment, software applications and IT services reserve account (see Appendix 2) to minimize fluctuations due to large or unanticipated purchases and because the agency does not have the ability to borrow funds from other entities.
A plan for reimbursement of the funds must be submitted prior to withdrawal of the funds. The Board may adjust account balance limits during the Agency’s annual budget process. Surplus income from the sale of assets is transferred to the reserve unless the equipment was funded with grant or fee funds with certain restrictions.
3. Department/Division Reserves - The agency maintains a small reserve account for each department. These reserves are for unanticipated expenses relating to particular departmental work that occurs during the fiscal year. The presence or use of the reserve accounts does not in any way lessen or eliminate the need for appropriate planning by each department during the annual budget process. The amounts for each reserve will not exceed the amount originally established for the account and will be reviewed each year as part of the budget process. The accounts will be replenished each year by appropriate funding sources for each department.
4. General Fund Reserve – This reserve is established for non-fee program related items such as unanticipated items in the budget fiscal year, emergency funding for deferred maintenance, insurance deductibles in the event of a major loss, bridge funding for inter-grant periods, and as an additional offset for inter-month negative cash balances. The targeted balance for this reserve is 10% (reached in FY10) of the general fund revenues (composed of per capita revenues, the federal core grant and the state core grant). In FY21, this reserve was increased by $250,000 from expenditure reductions in FY20. If necessary, this reserve is funded or replenished from interest income, investment recaptures (from previous investment losses) and other discretionary (unrestricted) funds resulting from better-than-planned budget performance (see section II.E.). The Board must
- 8 -
Attachment A – FY22 Proposed Financial Policies
approve withdrawals from the general fund reserve, as part of the annual budget or through a budget amendment. The approval must include a plan for reimbursing the reserve.
5. Unemployment Reserve – The agency operates on a reimbursement basis with the Employment Securities Department (ESD) rather than paying quarterly unemployment taxes. The agency has minimal control over the timing, duration and amount of unemployment charges. The purpose of this reserve is to provide for unemployment expenditures. The amount of this reserve will be assessed as needed and funded accordingly.
C. Civil Penalty Account
The revenue collected from civil penalties goes directly to the Civil Penalty Account to be used in accordance with Section III B. of this policy. In preparing annual budgets, the agency only includes expenditures of civil penalty revenues previously received. The balances in this account may be used to offset periodic negative inter-month cash balances created by grant-related receivable balances.
- 9 -
Attachment A – FY22 Proposed Financial Policies
Appendix 1 – Asset capitalization and inventory procedures
Categories of Assets, Risk Ratings, Frequency of Physical Inventory, Capitalization Amount. Category Risk (loss) Rating Capitalization Frequency of Amount Physical Inventory
Transportation High $5,000 1 year Equipment
Computer High $5,000 1 year Equipment
Communication/ High $5,000 1 year Audio visual Equipment
Site/Shop Medium $5,000 2 years (Odd FY) Equipment
Lab Equipment Low $5,000 2 years (Odd FY)
Office Furniture Low $5,000 2 years (Even FY)
Leasehold Low $5,000 2 years (Even FY) Improvements
Capitalization of Assets
The Agency follows the Federal Common Rule of property management requirements for the acquisition, management and disposition of capitalized assets. At this time, the threshold amount is $5,000. Assets under this threshold will be tagged, inventoried and tracked but not listed on the Agency financial statements as capital assets.
- 10 -
Attachment A – FY22 Proposed Financial Policies
Inventory System
The Finance Department maintains an inventory system that includes tagging, inventorying and tracking agency equipment and capitalized assets. The system includes the asset purchase date, amount or current valuation, manufacturer description, asset identification number, department assignment, asset location, physical inventory date, and future surplus disposition.
Physical Inventory of Assets – Capitalized and Non-Capitalized
The Manager of Finance and Purchasing schedules a physical inventory of department assets with each department manager. This inventory is based on risk ratings, the value of the item and probability of theft and/or misuse. Each department completes a physical inventory of the department assets by the end of the fiscal year.
Tagging of Assets
Assets are identified with a permanent tag that provides accurate agency and category identification. Assets purchased with federal funding are also identified with a permanent tag and an additional reference in the Asset Tracking System to indicate title to the equipment. The Finance Department keeps asset tags and assigns a tag to each department after each purchase.
Sale or Surplus of Assets
The Board of Directors must approve by resolution a list of capitalized assets scheduled for sale, surplus and disposal.
- 11 -
Attachment A – FY22 Proposed Financial Policies
Appendix 2 – Capital Equipment, Software Applications, and IT Services Reserve
Purpose
We strive to meet our routine capital equipment needs each year from current revenues. To minimize fluctuations in the need for revenues due to large or unanticipated capital purchases, and because the Agency does not have the ability to borrow funds from other entities, a capital equipment reserve account is included in our finance management system. The purpose of this policy is to describe how this reserve account is derived and used.
The Agency maintains a reserve account that helps fund the following types of purchases: • Vehicles • Air Monitoring/Scientific Equipment and applications • Computer Systems and applications • Office Machines and Tenant Improvements • Specialized Information Technology Consulting Services
Principles
General • The reserve target should reflect a prudent amount of funds necessary to pay for the intended use. The target is $170,000 which includes amounts previously accumulated separately for air monitoring/scientific equipment and applications and for the Agency Telephone system replacements but no longer needed to be earmarked in the balance. • The Board may adjust account balance limits during the Agency’s annual budget process. • Expenditures from the Capital Equipment Reserve are normally made to: o Fund large non-routine capital or applications expenditures o Meet high priority needs not envisioned during the budget process • The reserve is not funded by federal or state grant dollars.
Withdrawals • The Board must approve withdrawals that exceed $50,000 from the reserve account, as part of the annual budget or through a budget amendment.
- 12 -
Attachment A – FY22 Proposed Financial Policies
• The Executive Director may approve withdrawals from the reserve account in the amount of $ 50,000 or less. • When funds are withdrawn from the reserve account in any amount the responsible manager must provide a written schedule for reimbursing the account and identify the source of the funds for the reimbursement.
- 13 -
DATE March 18, 2021
Board of Directors TO Puget Sound Clean Air Agency
SUBJECT Resolution No. 1431 – Adding Labor Position to the Advisory Council
Honorable Members:
As we have discussed at previous meetings, there is a desire to add a position representing Labor to the Advisory Council.
At the March Board meeting, we will present information for Keith Weir, Political Director for IBEW 46 in Kent, to fill the new Labor position for a 3-year term ending on June 30, 2024. I have spoken with Mr. Weir and believe he will be a strong addition to the Council.
Resolution No. 1431 reflects this recommendation and is provided for your consideration and action.
Additionally, I would like to discuss the current open positions on the Advisory Council and receive Board direction on how you would like us to proceed with filling the vacancies. Currently open positions are: Environmental Justice – Regional or State, Large Industry, Planning, and Wood Smoke Communities.
Respectfully submitted,
Craig Kenworthy Executive Director
Attachment
jwc
- 1 -
KEITH WEIR
Political Director, IBEW 46
PROFILE EDUCATION
Keith is a Seattle native, born and Rainier Beach High School raised right here!! Rainier Beach 1982 - 1986 High school Grad’, Class of ’86!! United States Navy 1986-1992, United States Navy Electronic Warfare Technician. 1986 - 1992 Came home and worked for 7 ½ Various assignments, USS Texas CGN-39-EW years for a Geotechnical operator/Technician. San Diego NAVSEA Command, Engineering company, before SIMA/NRMF Long Beach - Technical Representative for West finding the IBEW in 1999! This has Coast based platforms. afforded me the opportunity to support my lovely wife and three WORK EXPERIENCE children on a single income, with healthcare and benefits!! IBEW Local 46, Business Representative/Political Director 2014–Present Business Representative covering all Project Labor Agreements CONTACT and Community Workforce Agreements in Seattle and King County. Past Board Chair and current Board member of ANEW 253-867-7001 (the longest running and original pre-apprenticeship program in the nation). www.ibew46.com Seattle Building Trades, Assistant Executive Secretary [email protected] 2009–2014 Responsibilities included running weekly Pre-Job conferences for contractors for multiple jurisdiction projects, (Port of Seattle, City of Seattle, King County, etc.) HOBBIES Appointed to the Sound Transit Diversity Oversight Committee. Hiking Active member and Co-chair of Emerald Cities Seattle; Member Reading of Seattle’s High Road Agreement Task Force. Negotiated and Movies maintained relationships on multiple large regional projects. Music Trained in Mediations with the FMCS. Involvement with community though pre-apprenticeship agreements, and outreach to help diversify workforce.
IBEW Local 46 Intern/Registrar 2007–2009 Came onto staff from the field for a nine-month internship to be exposed to operations of the Local and wound up staying to be the Local Registrar for the 2008 Presidential election cycle. Great opportunity for me to learn and adapt leadership style and hone political acumen. Prior to this I completed a 5-year apprenticeship and became a licensed Journeyman electrician (EL-01), and worked in the field for many of our contractors.
ADVISORY COUNCIL ROSTER
1904 3rd Avenue, Suite 105, Seattle, WA 98101
Area Sources Construction Education Environment Term: 6/30/2020- Term: 6/30/2018- Term: 6/30/2019-6/30/2022 Term: 6/30/2019- 6/30/2022 6/30/2023 6/30/2021 Kathy Ross Jenna Leonard Debbie Hannig Allison Butcher Tacoma-Pierce County Health 104 Balmer St. SW 4810 Point Fosdick Drive NW, Master Builders Assoc. Dept Orting, WA 98360 #410 335 116th Ave. SE 3629 South D Street (301) 401-2034 Gig Harbor, WA 98335 Bellevue, WA 98004 Tacoma, WA 98418-6813 [email protected] (253) 312-2328 (425) 460-8223 (253) 798-7369 [email protected] [email protected] [email protected]
Environmental Justice: Environmental Justice: Fire Chiefs Association Health Local Regional or State Term: 6/30/2019-6/30/2022 Term: 6/30/2018-6/30/2021 Term: 6/30/2020- 6/30/2023 Term: 6/30/2020-6/30/2023 Brad Wiggins Dr. Darrell Rodgers Paulina Lopez Vacant South Kitsap Fire and Rescue King County Dept of Public Executive Director 1974 Fircrest Drive SE Health Duwamish River CleanUp Port Orchard, WA 98366 Environmental Health Svcs. Coalition (360) 895-6506 Div. PO Box 3885 [email protected] Chinook Building Seattle, WA 98124 401 5th Ave Ste 1100 (206) 251-2038 Seattle, WA 98104 paulina@duwamishcleanup. (206) 263-1412 org darrell.rodgers@kingcounty. gov Industry: Large Industry: Small-Medium Labor Planning Term: 6/30/2018-6/30/2021 Term: 6/30/2020- 6/30/2023 Term: 3/25/21-6/30/2024 Term: 6/30/2019-6/30/2022 Vacant Greg Tisdel Keith Weir Vacant PO Box 1078 Political Director Everett, WA 98206-1078 IBEW 46 (425) 231-7401 19802 62nd Ave S, Ste 105 [email protected] Kent, Washington, 98032 (253) 867-7001 [email protected]
- 1 -
ADVISORY COUNCIL ROSTER
1904 3rd Avenue, Suite 105, Seattle, WA 98101
Ports Public-at-Large: KING Public-at-Large: KITSAP Public-at-Large: Term: 6/30/2018-6/30/2021 Term: 6/30/2019-6/30/2022 Term: 6/30/2019-6/30/2022 PIERCE Steve Nicholas Tim Gould Ronn Griffin Term: 6/30/2018-6/30/2021 Senior Manager, Air Quality 4411 Woodland Park Ave. N., #1 PO Box 1953 Kristin Lynett & Sustainable Practices Seattle, WA 98103 Kingston, WA 98346 Sustainability Manager The Northwest Seaport (206) 543-8195 (360) 297-3101 Office of Sustainability Alliance [email protected] [email protected] City of Tacoma P.O. Box 2985 747 Market St. Tacoma, WA 98401-2985 Tacoma, WA 98402 (253) 888-4713 (253) 591-5571 snicholas@nwseaportalliance. [email protected] com
Public-at-Large: Suburban Cities: KING Suburban Cities: KITSAP Suburban Cities: PIERCE SNOHOMISH Term: 6/30/2020- 6/30/2023 Term: 6/30/2018-6/30/2021 Term: 6/30/2020- 6/30/2023 Term: 6/30/2020- 6/30/2023 Satwinder Kaur Michael Pollock Bonnie Meyer Suzy Oversvee Councilmember City of Bainbridge Island 6305 36th St W Mgr.-Customer Kent City Council 280 Madison Avenue North University Place WA 98466 Renewables Program 220 Fourth Avenue South Bainbridge Island, WA 98110 (253) 355-9985 Snohomish County PUD Kent, WA 98032 (206) 475-1814 [email protected] P.O. Box 1107 (253) 856-5712 [email protected] Everett, WA 98206-1107 [email protected] (425) 783-8291 [email protected]
Suburban Cities: Transportation Tribal Nations Wood Smoke SNOHOMISH Term: 6/30/2018-6/30/2021 Term: 6/30/2019-6/30/2022 Communities Term: 6/30/2020- 6/30/2023 Kelly McGourty Charles Adkins Term: 6/30/17-6/30/2020 Bill Franz Puget Sound Regional 4807 Vesper Dr., Apt. 11 Vacant Public Works Director Council Everett, WA 98203 City of Lynnwood 1011 Western Ave., Suite 500 (425) 876-4516 PO Box 5008 Seattle WA 98104 [email protected] Lynnwood, WA 98046 (206) 971-3601 (425) 670-5204 [email protected] [email protected]
- 2 -
RESOLUTION NO. 1431
A RESOLUTION OF THE BOARD OF DIRECTORS OF THE PUGET SOUND CLEAN AIR AGENCY ADDING A POSITION TO THE ADVISORY COUNCIL REPRESENTING LABOR
WHEREAS, the Board of Directors of the Puget Sound Clean Air Agency has previously adopted resolutions establishing the composition and membership of the Advisory Council, including Resolution No. 857 which acted to stagger the terms of the Advisory Council members; and
WHEREAS, to better meet the needs of the Agency, the Board of Directors desires to add a new position to the Advisory Council representing Labor; and
WHEREAS, Keith Weir has expressed interest in serving on the Advisory Council and is willing and available to serve in the new Labor position; and
WHEREAS, the Board of Directors believes that Keith Weir has the skill, experience, and knowledge necessary to serve on the Advisory Council; therefore
BE IT RESOLVED BY THE BOARD OF DIRECTORS OF THE PUGET SOUND CLEAN AIR AGENCY:
Section 1. This Resolution is adopted pursuant to RCW 70.94.240 and the provisions of this Resolution shall supplement the provisions of Resolution No. 857.
Section 2. The Board of Directors makes the following appointment to the Advisory Council:
APPOINTEE POSITION TERM EXPIRATION Keith Weir Labor June 30, 2024
1
PASSED AND APPROVED by the Board of Directors at a regular meeting of the Board this 25th day of March, 2021.
PUGET SOUND CLEAN AIR AGENCY
By______Paul Roberts Chair, Board of Directors
Attest:
By ______Craig T. Kenworthy Executive Director
Approved as to form:
By ______Jennifer Dold Agency Counsel
2
DATE March 18, 2021
Board of Directors TO Puget Sound Clean Air Agency
SUBJECT Northwest Ports Clean Air Strategy Update
Honorable Members:
At your March meeting, we would like to discuss the next iteration of the Northwest Ports Clean Air Strategy (NWPCAS) with you. We worked with the ports of Seattle, Tacoma, and Vancouver, BC, along with environmental agencies on both sides of the border, to develop a strategy that would align the three ports’ efforts to reduce maritime and port-related pollution, especially diesel particulate pollution and greenhouse gases. First adopted in 2008, it was one of the first multi-port strategies adopted in the nation and the first international strategy. The 2008 strategy was updated in 2013 and is now being updated for a second time.
The 2020 NWPCAS update was presented for discussion and a first reading of a resolution for adoption by Port of Seattle Commission, Port of Tacoma Commission, and Northwest Seaport Alliance (NWSA) Managing Members at the monthly NWSA Managing Members meeting on February 2. The second reading and vote to adopt the NWPCAS is scheduled for Tuesday, April 6. This NWPCAS update continues the work we have partnered on to reduce harmful diesel particle pollution, and more recently greenhouse gases, from port operations. The 2020 NWPCAS update includes updated timelines for reduction across several port source categories. The Agency has provided comment on draft versions, with an interest in accelerating these timelines and maximizing emissions reductions. We look forward to discussing timelines along with other major elements of the next NWPCAS with you.
I look forward to our discussion.
Respectfully submitted,
Craig T. Kenworthy Executive Director jwc
- 1 -
DATE March 18, 2021
Board of Directors TO Puget Sound Clean Air Agency
SUBJECT Briefing – FY20 Audit
Honorable Members:
The Washington State Auditor’s office recently concluded the annual audit of the agency’s financial reporting and performance. We have attached the final FY20 audit report including accompanying schedules – the audit addressed several areas:
• Financial statements – the auditor reviewed whether financial statements were presented fairly in all material respects • Federal compliance – the auditor tested compliance with federal regulations for grants (selected the Federal Core Grant for testing) • Accountability – the auditor tested our compliance with federal/state regulations, grant guidance, and internal policies • Air Operating Program (AOP) – the auditor reviewed our compliance with Agreed Upon Procedures (AOP) as issued by the WA State Department of Ecology
We are pleased to report that the state auditor’s office issued clean audit reports for each of the areas above and there was no management letter. We reviewed with the auditor some exit items including some classification changes, which we have recently resolved with the Government Accounting Standards Board, and minor corrections for future financial statements (see the attached exit conference report).
The cost of the FY20 audit was $34k (compared to $22k in the prior year). This is due to increased reporting compliance requirements issued by the Government Accounting Standards Board (GASB) in recent years, additional accountability auditing (each year rather than every other year), and the biennial AOP audit.
If you have any questions, please contact me at 206-689-4004 or [email protected].
Respectfully submitted,
Craig T. Kenworthy Executive Director
Attachment jwc
- 2 -
Office of the Washington State Auditor Pat McCarthy
March 16, 2021
Board of Directors Puget Sound Clean Air Agency 1904 Third Avenue, Suite 105 Seattle, WA 98101
Dear Members of the Board:
We are pleased to notify you regarding the conclusion of our audit of Puget Sound Clean Air Agency for fiscal year 2020.
An exit conference was held on March 16, 2021 to discuss the results of our audit. The attached items were discussed in detail with those in attendance, which included Executive Director, Finance Manager, Senior Accountant, Grants Analyst and Title V staff. We also took the opportunity to extend our appreciation to your staff for their cooperation and assistance during the course of the audit.
We are always available to discuss the results of our audit in further detail at your convenience. If you have any questions, feel free to contact me by email at [email protected].
Sincerely,
Carmen La, Audit Lead Enclosure
Insurance Building, P.O. Box 40021 Olympia, Washington 98504-0021 (564) 999-0950 [email protected]
Exit Conference: Puget Sound Clean Air Agency The Office of the Washington State Auditor’s vision is increased trust in government. Our mission is to provide citizens with independent and transparent examinations of how state and local governments use public funds, and develop strategies that make government more efficient and effective.
The purpose of this meeting is to share the results of your audit and our draft reporting. We value and appreciate your participation.
Audit Reports We will publish the following reports: Accountability audit for July 1, 2018 through June 30, 2020 - see draft report. Financial statement and federal grant compliance audits for July 1, 2019 through June 30, 2020 – see draft report. Attestation for July 1, 2018 through June 30, 2020 – see draft report.
Audit Highlights We greatly appreciate Karen Houser, Nilda Rublica, John Dawson, and staff for their assistance throughout the audit. We are pleased to report no findings for the fiscal year 2020 audit.
Recommendations not included in the Audit Reports Exit Items We have provided exit recommendations for management’s consideration. Exit items address control deficiencies or non-compliance with laws or regulation that have an insignificant or immaterial effect on the entity, or errors with an immaterial effect on the financial statements. Exit items are not referenced in the audit report.
Communications required by audit standards In relation to our financial statement audit report, we would like to bring to your attention: Uncorrected misstatements in the audited financial statements are summarized on the attached schedule. We agree with management’s representation that these misstatements are immaterial to the fair presentation of the financial statements. There were no material misstatements in the financial statements corrected by management during the audit.
Finalizing Your Audit Report Publication Page 1 of 85 Audit reports are published on our website and distributed via e-mail in an electronic .pdf file. We also offer a subscription service that allows you to be notified by email when audit reports are released or posted to our website. You can sign up for this convenient service at: https://portal.sao.wa.gov/SAOPortal/
Management Representation Letter We have included a copy of representations requested of management.
Audit Cost At the entrance conference, we estimated the cost of the audit to be $33,930 and actual audit costs will approximate that amount.
Your Next Scheduled Audit Your next audit is scheduled to be conducted in December 2021 and will cover the following general areas: Accountability for Public Resources Financial Statement Federal Programs
The estimated cost for the next audit based on current rates is $30,600 plus travel expenses. This preliminary estimate is provided as a budgeting tool and not a guarantee of final cost.
Working Together to Improve Government Audit Survey When your report is released you will receive an audit survey from us. We value your opinions on our audit services and hope you provide feedback.
Local Government Support Team This team provides support services to local governments through technical assistance, comparative statistics, training, and tools to help prevent and detect a loss of public funds. Our website and client portal offers many resources, including a client Help Desk that answers auditing and accounting questions. Additionally this team assists with the online filing of your financial statements.
The Center for Government Innovation The Center for Government Innovation of the Office of the Washington State Auditor is designed to offer services specifically to help you help the residents you serve at no additional cost to your government. What does this mean? We provide expert advice in areas like Lean, peer-to-peer networking and culture-building to help local governments find ways to be more efficient, effective and transparent. The Center can help you by providing assistance in financial management, cybersecurity and more. Check out our best practices and other resources that help local governments act on accounting standard changes, comply with regulations, and respond to recommendations in your audit. The Center understands that time is your most precious commodity as a public servant, and we are here to help you do more with the limited hours you have. If you are interested in learning how we can help you maximize your effect in government, call us at (564) 999-0818 or email us at [email protected] .
Page 2 of 85 Questions? Please contact us with any questions about information in this document or related audit reports. Kelly Collins, CPA, Director of Local Audit, (564) 999-0807, [email protected]
Mark Rapozo, CPA, Assistant Director of Local Audit, (564) 999-0794 [email protected]
Joe Simmons, CPA, Audit Manager, [email protected]
Madeleine Frost-Shaffer, Assistant Audit Manager, [email protected]
Carmen La, Audit Lead, [email protected]
Page 3 of 85
Accountability Audit Report
Puget Sound Clean Air
Agency
For the period July 1, 2018 through June 30, 2020
Published (Inserted by OS) Find out what’s new at SAO by scanning this code with Report No. 1027907 your smartphone’s camera
Page 4 of 85
Office of the Washington State Auditor Pat McCarthy
Issue Date – (Inserted by OS)
Board of Directors Puget Sound Clean Air Agency Seattle, Washington
Report on Accountability Thank you for the opportunity to work with you to promote accountability, integrity and openness in government. The Office of the Washington State Auditor takes seriously our role of providing state and local governments with assurance and accountability as the independent auditor of public accounts. In this way, we strive to help government work better, cost less, deliver higher value and earn greater public trust.
Independent audits provide essential accountability and transparency for Agency operations. This information is valuable to management, the governing body and public stakeholders when assessing the government’s stewardship of public resources.
Attached is our independent audit report on the Agency’s compliance with applicable requirements and safeguarding of public resources for the areas we examined. We appreciate the opportunity to work with your staff and value your cooperation during the audit.
Sincerely,
Pat McCarthy State Auditor Olympia, WA Americans with Disabilities In accordance with the Americans with Disabilities Act, we will make this document available in alternative formats. For more information, please contact our Office at (564) 999-0950, TDD Relay at (800) 833-6388, or email our webmaster at [email protected] .
Insurance Building, P.O. Box 40021 Olympia, Washington 98504-0021 (564) 999-0950 [email protected] Page 5 of 85
TABLE OF CONTENTS
Audit Results ...... 4
Related Reports ...... 5
Information about the Agency ...... 6
About the State Auditor's Office ...... 7
Office of the Washington State Auditor sao.wa.gov Page 3 Page 6 of 85
AUDIT RESULTS Results in brief This report describes the overall results and conclusions for the areas we examined. In those selected areas, Agency operations complied, in all material respects, with applicable state laws, regulations, and its own policies, and provided adequate controls over the safeguarding of public resources.
In keeping with general auditing practices, we do not examine every transaction, activity, policy, internal control, or area. As a result, no information is provided on the areas that were not examined.
About the audit This report contains the results of our independent accountability audit of the Puget Sound Clean Air Agency from July 1, 2018 through June 30, 2020.
Management is responsible for ensuring compliance and adequate safeguarding of public resources from fraud, loss or abuse. This includes the design, implementation and maintenance of internal controls relevant to these objectives.
This audit was conducted under the authority of RCW 43.09.260, which requires the Office of the Washington State Auditor to examine the financial affairs of all local governments. Our audit involved obtaining evidence about the Agency’s use of public resources, compliance with state laws and regulations and its own policies and procedures, and internal controls over such matters. The procedures performed were based on our assessment of risks in the areas we examined.
Based on our risk assessment for the years ended June 30, 2020 and 2019, the areas examined were those representing the highest risk of fraud, loss, abuse, or noncompliance. We examined the following areas during this audit period:
Financial condition Self-Insurance for unemployment compensation
Office of the Washington State Auditor sao.wa.gov Page 4 Page 7 of 85
RELATED REPORTS Financial Our opinion on the Agency’s financial statements and compliance with federal grant program requirements is provided in a separate report, which includes the Agency’s financial statements. That report is available on our website, http://portal.sao.wa.gov/ReportSearch .
Federal grant programs We evaluated internal controls and tested compliance with the federal program requirements, as applicable, for the Agency’s major federal program, which is listed in the Schedule of Findings and Questioned Costs section of the separate financial statement and single audit report. That report is available on our website, http://portal.sao.wa.gov/ReportSearch .
Other reports The State Auditor’s Office issued a report on agreed-upon procedures performed at the Agency. That report is available on our website, http://portal.sao.wa.gov/ReportSearch .
Office of the Washington State Auditor sao.wa.gov Page 5 Page 8 of 85
INFORMATION ABOUT THE AGENCY
The Puget Sound Clean Air Agency was chartered by state law (Chapter 70.94 RCW) in 1967 to enforce federal, state and local air pollution laws. Its jurisdiction covers King, Kitsap, Pierce and Snohomish counties.
The Agency is governed by a nine-member Board of Directors composed of elected officials from each of the four counties, a representative from the largest city in each county and one member representing the public-at-large. King County acts as the Agency’s treasurer for investments and warrants. The Agency has approximately $13 million in annual revenue, which include federal and state grants, local government assessments, mandated fees and civil penalties.
Contact information related to this report
Puget Sound Clean Air Agency Address: 1904 Third Avenue, Suite 105 Seattle, WA 98101
Contact: Karen Houser, Finance Manager
Telephone: 206-689-4036
Website: www.pscleanair.org
Information current as of report publish date.
Audit history You can find current and past audit reports for the Puget Sound Clean Air Agency at http://portal.sao.wa.gov/ReportSearch .
Office of the Washington State Auditor sao.wa.gov Page 6 Page 9 of 85
ABOUT THE STATE AUDITOR’S OFFICE The State Auditor’s Office is established in the Washington State Constitution and is part of the executive branch of state government. The State Auditor is elected by the people of Washington and serves four-year terms. We work with state agencies, local governments and the public to achieve our vision of increasing trust in government by helping governments work better and deliver higher value. In fulfilling our mission to provide citizens with independent and transparent examinations of how state and local governments use public funds, we hold ourselves to those same standards by continually improving our audit quality and operational efficiency, and by developing highly engaged and committed employees. As an agency, the State Auditor’s Office has the independence necessary to objectively perform audits, attestation engagements and investigations. Our work is designed to comply with professional standards as well as to satisfy the requirements of federal, state and local laws. The Office also has an extensive quality control program and undergoes regular external peer review to ensure our work meets the highest possible standards of accuracy, objectivity and clarity. Our audits look at financial information and compliance with federal, state and local laws for all local governments, including schools, and all state agencies, including institutions of higher education. In addition, we conduct performance audits and cybersecurity audits of state agencies and local governments, as well as state whistleblower, fraud and citizen hotline investigations. The results of our work are available to everyone through the more than 2,000 reports we publish each year on our website, www.sao.wa.gov . Additionally, we share regular news and other information via an email subscription service and social media channels. We take our role as partners in accountability seriously. The Office provides training and technical assistance to governments both directly and through partnerships with other governmental support organizations.
Stay connected at sao.wa.gov Other ways to stay in touch Find your audit team Main telephone: Request public records (564) 999-0950 Search BARS manuals ( GAAP and cash ), and find reporting templates Toll-free Citizen Hotline: Learn about our training workshops (866) 902-3900 and on-demand videos Email: Discover which governments serve you [email protected] — enter an address on our map Explore public financial data with the Financial Intelligence Tool
Office of the Washington State Auditor sao.wa.gov Page 7 Page 10 of 85
Financial Statements and Federal Single
Audit Report
Puget Sound Clean Air
Agency
For the period July 1, 2019 through June 30, 2020
Published (Inserted by OS) Find out what’s new at SAO Report No. 1027965 by scanning this code with your smartphone’s camera
Page 11 of 85
Office of the Washington State Auditor Pat McCarthy
Issue Date – (Inserted by OS)
Board of Directors Puget Sound Clean Air Agency Seattle, Washington
Report on Financial Statements and Federal Single Audit Please find attached our report on the Puget Sound Clean Air Agency’s financial statements and compliance with federal laws and regulations.
We are issuing this report in order to provide information on the Agency’s financial condition.
Sincerely,
Pat McCarthy State Auditor Olympia, WA
Americans with Disabilities In accordance with the Americans with Disabilities Act, we will make this document available in alternative formats. For more information, please contact our Office at (564) 999-0950, TDD Relay at (800) 833-6388, or email our webmaster at [email protected].
Insurance Building, P.O. Box 40021 Olympia, Washington 98504-0021 (564) 999-0950 [email protected] Page 12 of 85 TABLE OF CONTENTS
Schedule of Findings and Questioned Costs ...... 4
Independent Auditor's Report on Internal Control Over Financial Reporting and on Compliance and Other Matters Based on an Audit of Financial Statements Performed in Accordance with Government Auditing Standards...... 6
Independent Auditor's Report on Compliance for Each Major Federal Program and Report on Internal Control Over Compliance in Accordance With the Uniform Guidance ...... 8
Independent Auditor's Report on the Financial Statements ...... 11
Financial Section ...... 15
About the State Auditor's Office ...... 61
Office of the Washington State Auditor sao.wa.gov Page 13 of 85
SCHEDULE OF FINDINGS AND QUESTIONED COSTS
Puget Sound Clean Air Agency July 1, 2019 through June 30, 2020
SECTION I – SUMMARY OF AUDITOR’S RESULTS The results of our audit of the Puget Sound Clean Air Agency are summarized below in accordance with Title 2 U.S. Code of Federal Regulations (CFR) Part 200, Uniform Administrative Requirements, Cost Principles, and Audit Requirements for Federal Awards (Uniform Guidance).
Financial Statements We issued an unmodified opinion on the fair presentation of the basic financial statements in accordance with accounting principles generally accepted in the United States of America (GAAP).
Internal Control over Financial Reporting:
Significant Deficiencies: We reported no deficiencies in the design or operation of internal control over financial reporting that we consider to be significant deficiencies.
Material Weaknesses: We identified no deficiencies that we consider to be material weaknesses.
We noted no instances of noncompliance that were material to the financial statements of the Agency.
Federal Awards Internal Control over Major Programs:
Significant Deficiencies: We reported no deficiencies in the design or operation of internal control over major federal programs that we consider to be significant deficiencies.
Material Weaknesses: We identified no deficiencies that we consider to be material weaknesses.
Office of the Washington State Auditor sao.wa.gov Page 14 of 85
We issued an unmodified opinion on the Agency’s compliance with requirements applicable to its major federal program.
We reported no findings that are required to be disclosed in accordance with 2 CFR 200.516(a).
Identification of Major Federal Programs The following program was selected as a major program in our audit of compliance in accordance with the Uniform Guidance.
CFDA No. Program or Cluster Title
66.605 Performance Partnership Grants The dollar threshold used to distinguish between Type A and Type B programs, as prescribed by the Uniform Guidance, was $750,000.
The Agency qualified as a low-risk auditee under the Uniform Guidance.
SECTION II – FINANCIAL STATEMENT FINDINGS None reported.
SECTION III – FEDERAL AWARD FINDINGS AND QUESTIONED COSTS None reported.
Office of the Washington State Auditor sao.wa.gov Page 15 of 85
INDEPENDENT AUDITOR’S REPORT Report on Internal Control over Financial Reporting and on Compliance and Other Matters Based on an Audit of Financial Statements Performed in Accordance with Government Auditing Standards
Puget Sound Clean Air Agency July 1, 2019 through June 30, 2020
Board of Directors Puget Sound Clean Air Agency Seattle, Washington
We have audited, in accordance with auditing standards generally accepted in the United States of America and the standards applicable to financial audits contained in Government Auditing Standards, issued by the Comptroller General of the United States, the financial statements of the Puget Sound Clean Air Agency, as of and for the year ended June 30, 2020, and the related notes to the financial statements, which collectively comprise the Agency’s basic financial statements, and have issued our report thereon dated March 16, 2021.
As discussed in Note 14 to the 2020 financial statements, the full extent of the COVID-19 pandemic’s direct or indirect financial impact on the Agency is unknown. Management’s plans in response to this matter are also described in Note 14.
INTERNAL CONTROL OVER FINANCIAL REPORTING In planning and performing our audit of the financial statements, we considered the Agency’s internal control over financial reporting (internal control) to determine the audit procedures that are appropriate in the circumstances for the purpose of expressing our opinion on the financial statements, but not for the purpose of expressing an opinion on the effectiveness of the Agency’s internal control. Accordingly, we do not express an opinion on the effectiveness of the Agency’s internal control.
A deficiency in internal control exists when the design or operation of a control does not allow management or employees, in the normal course of performing their assigned functions, to prevent, or detect and correct, misstatements on a timely basis. A material weakness is a deficiency, or a combination of deficiencies, in internal control such that there is a reasonable possibility that a material misstatement of the Agency’s financial statements will not be prevented, or detected and corrected on a timely basis. A significant deficiency is a deficiency, or a combination of
Office of the Washington State Auditor sao.wa.gov Page 16 of 85
deficiencies, in internal control that is less severe than a material weakness, yet important enough to merit attention by those charged with governance.
Our consideration of internal control was for the limited purpose described in the first paragraph of this section and was not designed to identify all deficiencies in internal control that might be material weaknesses or significant deficiencies. Given these limitations, during our audit we did not identify any deficiencies in internal control that we consider to be material weaknesses. However, material weaknesses may exist that have not been identified.
COMPLIANCE AND OTHER MATTERS As part of obtaining reasonable assurance about whether the Agency’s financial statements are free from material misstatement, we performed tests of the Agency’s compliance with certain provisions of laws, regulations, contracts and grant agreements, noncompliance with which could have a direct and material effect on the determination of financial statement amounts. However, providing an opinion on compliance with those provisions was not an objective of our audit, and accordingly, we do not express such an opinion.
The results of our tests disclosed no instances of noncompliance or other matters that are required to be reported under Government Auditing Standards.
PURPOSE OF THIS REPORT The purpose of this report is solely to describe the scope of our testing of internal control and compliance and the results of that testing, and not to provide an opinion on the effectiveness of the Agency’s internal control or on compliance. This report is an integral part of an audit performed in accordance with Government Auditing Standards in considering the Agency’s internal control and compliance. Accordingly, this communication is not suitable for any other purpose. However, this report is a matter of public record and its distribution is not limited. It also serves to disseminate information to the public as a reporting tool to help citizens assess government operations.
Pat McCarthy State Auditor Olympia, WA
March 16, 2021
Office of the Washington State Auditor sao.wa.gov Page 17 of 85
INDEPENDENT AUDITOR’S REPORT Report on Compliance for Each Major Federal Program and Report on Internal Control over Compliance in Accordance with the Uniform Guidance
Puget Sound Clean Air Agency July 1, 2019 through June 30, 2020
Board of Directors Puget Sound Clean Air Agency Seattle, Washington
REPORT ON COMPLIANCE FOR EACH MAJOR FEDERAL PROGRAM We have audited the compliance of the Puget Sound Clean Air Agency, with the types of compliance requirements described in the U.S. Office of Management and Budget (OMB) Compliance Supplement that could have a direct and material effect on each of the Agency’s major federal programs for the year ended June 30, 2020. The Agency’s major federal programs are identified in the accompanying Schedule of Findings and Questioned Costs.
Management’s Responsibility Management is responsible for compliance with federal statutes, regulations, and the terms and conditions of its federal awards applicable to its federal programs.
Auditor’s Responsibility Our responsibility is to express an opinion on compliance for each of the Agency’s major federal programs based on our audit of the types of compliance requirements referred to above. We conducted our audit of compliance in accordance with auditing standards generally accepted in the United States of America; the standards applicable to financial audits contained in Government Auditing Standards, issued by the Comptroller General of the United States; and the audit requirements of Title 2 U.S. Code of Federal Regulations Part 200, Uniform Administrative Requirements, Cost Principles, and Audit Requirements for Federal Awards (Uniform Guidance). Those standards and the Uniform Guidance require that we plan and perform the audit to obtain reasonable assurance about whether noncompliance with the types of compliance requirements referred to above that could have a direct and material effect on a major federal program occurred.
Office of the Washington State Auditor sao.wa.gov Page 18 of 85
An audit includes examining, on a test basis, evidence about the Agency’s compliance with those requirements and performing such other procedures as we considered necessary in the circumstances.
We believe that our audit provides a reasonable basis for our opinion on compliance for each major federal program. Our audit does not provide a legal determination on the Agency’s compliance.
Opinion on Each Major Federal Program In our opinion, the Agency complied, in all material respects, with the types of compliance requirements referred to above that could have a direct and material effect on each of its major federal programs for the year ended June 30, 2020.
REPORT ON INTERNAL CONTROL OVER COMPLIANCE Management of the Agency is responsible for establishing and maintaining effective internal control over compliance with the types of compliance requirements referred to above. In planning and performing our audit of compliance, we considered the Agency’s internal control over compliance with the types of requirements that could have a direct and material effect on each major federal program in order to determine the auditing procedures that are appropriate in the circumstances for the purpose of expressing an opinion on compliance for each major federal program and to test and report on internal control over compliance in accordance with the Uniform Guidance, but not for the purpose of expressing an opinion on the effectiveness of internal control over compliance. Accordingly, we do not express an opinion on the effectiveness of the Agency’s internal control over compliance.
A deficiency in internal control over compliance exists when the design or operation of a control over compliance does not allow management or employees, in the normal course of performing their assigned functions, to prevent, or detect and correct, noncompliance with a type of compliance requirement of a federal program on a timely basis. A material weakness in internal control over compliance is a deficiency, or combination of deficiencies, in internal control over compliance, such that there is a reasonable possibility that material noncompliance with a type of compliance requirement of a federal program will not be prevented, or detected and corrected, on a timely basis. A significant deficiency in internal control over compliance is a deficiency, or a combination of deficiencies, in internal control over compliance with a type of compliance requirement of a federal program that is less severe than a material weakness in internal control over compliance, yet important enough to merit attention by those charged with governance.
Our consideration of internal control over compliance was for the limited purpose described in the first paragraph of this section and was not designed to identify all deficiencies in internal control
Office of the Washington State Auditor sao.wa.gov Page 19 of 85
that might be material weaknesses or significant deficiencies. We did not identify any deficiencies in internal control over compliance that we consider to be material weaknesses. However, material weaknesses may exist that have not been identified.
Purpose of this Report The purpose of this report on internal control over compliance is solely to describe the scope of our testing of internal control over compliance and the results of that testing based on the requirements of the Uniform Guidance. Accordingly, this report is not suitable for any other purpose. However, this report is a matter of public record and its distribution is not limited. It also serves to disseminate information to the public as a reporting tool to help citizens assess government operations.
Pat McCarthy State Auditor Olympia, WA
March 16, 2021
Office of the Washington State Auditor sao.wa.gov Page 20 of 85
INDEPENDENT AUDITOR’S REPORT Report on the Financial Statements
Puget Sound Clean Air Agency July 1, 2019 through June 30, 2020
Board of Directors Puget Sound Clean Air Agency Seattle, Washington
REPORT ON THE FINANCIAL STATEMENTS We have audited the accompanying financial statements of the Puget Sound Clean Air Agency, as of and for the year ended June 30, 2020, and the related notes to the financial statements, which collectively comprise the Agency’s basic financial statements as listed on page 15.
Management’s Responsibility for the Financial Statements Management is responsible for the preparation and fair presentation of these financial statements in accordance with accounting principles generally accepted in the United States of America; this includes the design, implementation, and maintenance of internal control relevant to the preparation and fair presentation of financial statements that are free from material misstatement, whether due to fraud or error.
Auditor’s Responsibility Our responsibility is to express an opinion on these financial statements based on our audit. We conducted our audit in accordance with auditing standards generally accepted in the United States of America and the standards applicable to financial audits contained in Government Auditing Standards, issued by the Comptroller General of the United States. Those standards require that we plan and perform the audit to obtain reasonable assurance about whether the financial statements are free from material misstatement.
An audit involves performing procedures to obtain audit evidence about the amounts and disclosures in the financial statements. The procedures selected depend on the auditor’s judgment, including the assessment of the risks of material misstatement of the financial statements, whether due to fraud or error. In making those risk assessments, the auditor considers internal control
Office of the Washington State Auditor sao.wa.gov Page 21 of 85
relevant to the Agency’s preparation and fair presentation of the financial statements in order to design audit procedures that are appropriate in the circumstances, but not for the purpose of expressing an opinion on the effectiveness of the Agency’s internal control. Accordingly, we express no such opinion. An audit also includes evaluating the appropriateness of accounting policies used and the reasonableness of significant accounting estimates made by management, as well as evaluating the overall presentation of the financial statements.
We believe that the audit evidence we have obtained is sufficient and appropriate to provide a basis for our audit opinion.
Opinion In our opinion, the financial statements referred to above present fairly, in all material respects, the financial position of the Puget Sound Clean Air Agency, as of June 30, 2020, and the changes in financial position and cash flows thereof for the year then ended in accordance with accounting principles generally accepted in the United States of America.
Matters of Emphasis As discussed in Note 14 to the 2020 financial statements, the full extent of the COVID-19 pandemic’s direct or indirect financial impact on the Agency is unknown. Management’s plans in response to this matter are also described in Note 14. Our opinion is not modified with respect to this matter.
Other Matters Required Supplementary Information Accounting principles generally accepted in the United States of America require that the management’s discussion and analysis and required supplementary information listed on page 15 be presented to supplement the basic financial statements. Such information, although not a part of the basic financial statements, is required by the Governmental Accounting Standards Board who considers it to be an essential part of financial reporting for placing the basic financial statements in an appropriate operational, economic or historical context. We have applied certain limited procedures to the required supplementary information in accordance with auditing standards generally accepted in the United States of America, which consisted of inquiries of management about the methods of preparing the information and comparing the information for consistency with management’s responses to our inquiries, the basic financial statements, and other knowledge we obtained during our audit of the basic financial statements. We do not express
Office of the Washington State Auditor sao.wa.gov Page 22 of 85
an opinion or provide any assurance on the information because the limited procedures do not provide us with sufficient evidence to express an opinion or provide any assurance.
Supplementary and Other Information Our audit was conducted for the purpose of forming an opinion on the financial statements that collectively comprise the Agency’s basic financial statements as a whole. The accompanying Schedule of Expenditures of Federal Awards is presented for purposes of additional analysis as required by Title 2 U.S. Code of Federal Regulations (CFR) Part 200, Uniform Administrative Requirements, Cost Principles, and Audit Requirements for Federal Awards (Uniform Guidance).This schedule is not a required part of the basic financial statements. Such information is the responsibility of management and was derived from and relates directly to the underlying accounting and other records used to prepare the basic financial statements. The information has been subjected to the auditing procedures applied in the audit of the basic financial statements and certain additional procedures, including comparing and reconciling such information directly to the underlying accounting and other records used to prepare the basic financial statements or to the basic financial statements themselves, and other additional procedures in accordance with auditing standards generally accepted in the United States of America. In our opinion, the information is fairly stated, in all material respects, in relation to the basic financial statements taken as a whole.
OTHER REPORTING REQUIRED BY GOVERNMENT AUDITING STANDARDS In accordance with Government Auditing Standards, we have also issued our report dated March 16, 2021 on our consideration of the Agency’s internal control over financial reporting and on our tests of its compliance with certain provisions of laws, regulations, contracts and grant agreements and other matters. The purpose of that report is to describe the scope of our testing of internal control over financial reporting and compliance and the results of that testing, and not to provide an opinion on internal control over financial reporting or on compliance. That report is an
Office of the Washington State Auditor sao.wa.gov Page 23 of 85
integral part of an audit performed in accordance with Government Auditing Standards in considering the Agency’s internal control over financial reporting and compliance.
Pat McCarthy State Auditor Olympia, WA
March 16, 2021
Office of the Washington State Auditor sao.wa.gov Page 24 of 85
FINANCIAL SECTION
Puget Sound Clean Air Agency July 1, 2019 through June 30, 2020
REQUIRED SUPPLEMENTARY INFORMATION Management’s Discussion and Analysis – 2020
BASIC FINANCIAL STATEMENTS Statement of Net Position – 2020 Statement of Revenues, Expenses and Changes in Net Position – 2020 Statement of Cash Flows – 2020 Notes to Financial Statements – 2020
REQUIRED SUPPLEMENTARY INFORMATION Schedule of Proportionate Share of Net Pension Liability – PERS 1, PERS 2/3 – 2020 Schedule of Employer Contributions – PERS 1, PERS 2/3 – 2020 Schedule of Changes in Total OPEB Liability and Related Ratios – 2020
SUPPLEMENTARY AND OTHER INFORMATION Schedule of Expenditures of Federal Awards – 2020 Notes to the Schedule of Expenditures of Federal Awards – 2020
Office of the Washington State Auditor sao.wa.gov Page 25 of 85 3XJHW6RXQG&OHDQ$LU$JHQF\ )LVFDO Page 26 of 85 UHSRUWHGIRUVRPHLWHPVWKDWZLOOUHVXOWLQFDVKIORZVLQIXWXUHILVFDOSHULRGV5HYHQXHVDUHFODVVLILHGDVHLWKHU ³RSHUDWLQJ´WKRVHUHYHQXHVZKLFKVXSSRUWVSHFLILFSURJUDPVDQGDUHIHHIRUVHUYLFHRUDV³QRQRSHUDWLQJ´ WKRVHUHYHQXHVWKDWDUHJUDQWVJUDQWUHODWHGFRQWUDFWVRUPLVFHOODQHRXVPLQRUUHYHQXHVWKDWGRQRWVSHFLILFDOO\ VXSSRUWDSURJUDP 7KH6WDWHPHQWRI&DVK)ORZVSURYLGHVLQIRUPDWLRQRQWKHVRXUFHVDQGXVHVRIFDVKIORZVLQWKHFDWHJRULHV VKRZQEHORZ x &DVK)ORZVIURP2SHUDWLQJ$FWLYLWLHV x &DVK)ORZVIURP1RQFDSLWDO)LQDQFLQJ$FWLYLWLHV x &DVK)ORZVIURP&DSLWDODQG5HODWHG)LQDQFLQJ$FWLYLWLHV x &DVK)ORZVIURP,QYHVWLQJ$FWLYLWLHV )LQDQFLDO+LJKOLJKWV x $VRI-XQHWKH$JHQF\¶VWRWDODVVHWVRIPLOOLRQH[FHHGHGOLDELOLWLHVRIPLOOLRQE\ PLOOLRQ,QFRPELQDWLRQZLWKWKHQHWDPRXQWRI'HIHUUHG2XWIORZVRI5HVRXUFHV PLOOLRQ DQG 'HIHUUHG,QIORZRI5HVRXUFHV PLOOLRQ WKLVUHVXOWHGLQDQHWSRVLWLRQRIPLOOLRQ2IWKHQHW SRVLWLRQDPRXQWPLOOLRQZDVUHVWULFWHGIRUVSHFLILFSXUSRVHVUHODWHGWRJUDQWFRQWUDFWRUOHJLVODWLYH UHTXLUHPHQWVPLOOLRQUHSUHVHQWHGWKHQHWLQYHVWPHQWLQFDSLWDODVVHWVDQGPLOOLRQZDVWKH XQUHVWULFWHGSRUWLRQ x 7KH$JHQF\¶VQHWSRVLWLRQLQFUHDVHGE\PLOOLRQIURPWKHSULRU\HDU7KHLQFUHDVHZDVGXHSULPDULO\ WRWKHGHFUHDVHLQORQJWHUPOLDELOLWLHVPDLQO\DVWKHUHVXOWRIWKHGHFUHDVHLQWKHQHWSHQVLRQOLDELOLW\ GHFUHDVHGVWDWH¶V3(56SHQVLRQOLDELOLW\DORQJZLWKDGHFUHDVHLQWKHDJHQF\¶VSURSRUWLRQDWHSURMHFWHG VKDUH x 7RWDORSHUDWLQJUHYHQXHVZHUH PLOOLRQDLQFUHDVHIURPWKHSULRU\HDUSULPDULO\GXHWRD WUDQVIHURIFLYLOSHQDOW\UHYHQXHVWRWKH5HJLVWUDWLRQIHHSURJUDPWRRIIVHWKLJKHUWKDQXVXDOVWDIIFRVWV UHODWHGWRVHYHUDOHQIRUFHPHQWFDVHV,QDGGLWLRQZKLOHWKHVXSSOHPHQWDOLQFRPH SHUFDSLWD UDWH UHPDLQHGWKHVDPHDVWKHSULRU\HDUDVVHVVPHQWVLQFUHDVHGLQGXHWRSRSXODWLRQJURZWKLQRXU IRXUFRXQW\MXULVGLFWLRQ7KHVHUHYHQXHVFRQVLVWRI&KDUJHVIRU6HUYLFHV IHHSURJUDPV 6XSSOHPHQWDO ,QFRPH 3HU&DSLWD DQGRWKHURSHUDWLQJUHYHQXHV x 7RWDORSHUDWLQJH[SHQVHVIRUWKH$JHQF\ZHUH PLOOLRQDLQFUHDVHIURP GXHWRLQFUHDVHG SHUVRQQHOH[SHQVHV ILOOLQJRSHQSRVLWLRQVLQ LQFUHDVHGOHDYHOLDELOLW\DQGLQFUHDVHGH[SHQVHV UHODWHGWRSRVWHPSOR\PHQWEHQHILWOLDELOLWLHV x 1HWQRQRSHUDWLQJUHYHQXHVLQFUHDVHGIURPPLOOLRQWRPLOOLRQGXHPDLQO\WRLQFUHDVHGIHGHUDO JUDQWVDQGKLJKHUFLYLOSHQDOW\FROOHFWLRQV x 7KH$JHQF\HQGHGWKHILVFDO\HDUZLWKDVXUSOXVRIPLOOLRQDQGDWRWDOQHWSRVLWLRQRIPLOOLRQ Page 27 of 85 'LVFXVVLRQRIWKH)LQDQFLDO6WDWHPHQWV &RPSDUDWLYH6WDWHPHQWRI1HW3RVLWLRQ $QDQDO\VLVRIQHWSRVLWLRQWKHH[FHVVRIDVVHWVRYHUOLDELOLWLHVPD\VHUYHDVDXVHIXOLQGLFDWRURIDQ$JHQF\¶V ILQDQFLDOSRVLWLRQ7DEOHVXPPDUL]HVDVVHWVOLDELOLWLHVDQGWKHFRPSRQHQWVRIQHWSRVLWLRQQHWLQYHVWPHQWLQ FDSLWDODVVHWV WRWDOFDSLWDODVVHWVOHVVDFFXPXODWHGGHSUHFLDWLRQ UHVWULFWHG UHVWULFWHGE\H[WHUQDO UHTXLUHPHQWV DQGXQUHVWULFWHG 7$%/( &203$5$7,9(67$7(0(172)1(7326,7,21 $VRI-XQHDQG ,QZKROHGROODUV &KDQJH $66(76 &XUUHQW$VVHWV 1RQFXUUHQW$VVHWV 7RWDO$VVHWV '()(55('287)/2:62)5(6285&(6 /,$%,/,7,(6 &XUUHQW/LDELOLWLHV 1RQFXUUHQW/LDELOLWLHV 7RWDO/LDELOLWLHV '()(55(',1)/2:62)5(6285&(6 1(7326,7,21 1HW,QYHVWPHQWLQ&DSLWDO$VVHWV 5HVWULFWHG *UDQW/HJLVODWLYHRU&RQWUDFWUHVWULFWLRQV 8QUHVWULFWHG 7RWDO1HW3RVLWLRQ $PRXQWVPD\QRWDGGGXHWRURXQGLQJ Page 28 of 85 7$%/( &203$5$7,9(67$7(0(172)1(7326,7,21 $VRI-XQHDQG ,QZKROHGROODUV &KDQJH $66(76 &XUUHQW$VVHWV 1RQFXUUHQW$VVHWV 7RWDO$VVHWV '()(55('287)/2:62)5(6285&(6 /,$%,/,7,(6 &XUUHQW/LDELOLWLHV 1RQFXUUHQW/LDELOLWLHV 7RWDO/LDELOLWLHV '()(55(',1)/2:62)5(6285&(6 1(7326,7,21 1HW,QYHVWPHQWLQ&DSLWDO$VVHWV 5HVWULFWHG *UDQW/HJLVODWLYHRU&RQWUDFWUHVWULFWLRQV 8QUHVWULFWHG 7RWDO1HW3RVLWLRQ $PRXQWVPD\QRWDGGGXHWRURXQGLQJ 3ULRU\HDUUHVWDWHGIRUFXUUHQWYORQJWHUPSRUWLRQVRI23(%OLDELOLWL\ $VVHWV $WILVFDO\HDUHQGWRWDODVVHWVZHUHPLOOLRQ7RWDODVVHWVJUHZ IURPWKHSULRU\HDUGXH PDLQO\WRWKHLQFUHDVHLQFDVKUHVHUYHV LQFXUUHQWDVVHWV $VVKRZQLQ7DEOHEHORZFXUUHQWDVVHWV FRPSULVHGRIFDVKDQGLQYHVWPHQWVDFFRXQWVUHFHLYDEOHDQGSUHSDLGDVVHWV ZHUHPLOOLRQDWWKHHQGRI 7KLVZDVDQLQFUHDVH IURPWKHSULRU\HDUDQGWKHFKDQJHZDVGXHWRDFRPELQDWLRQRIIDFWRUV 7KHDJHQF\WRRNVWHSVLQWKHVHFRQGKDOIRIWKHILVFDO\HDUWRUHGXFHFRVWVLQOLJKWRIWKHHFRQRPLFGRZQWXUQ DGGLWLRQDOO\WKHDJHQF\FROOHFWHGKLJKHUFLYLOSHQDOWLHVGXHWRVHYHUDOHQIRUFHPHQWFDVHVDQGHDUQHGPLOOLRQ LQLQWHUHVWRQUHVHUYHVLQYHVWHGLQWKH.LQJ&RXQW\,QYHVWPHQW3RRO±WKHVHDOOFRQWULEXWHGWRKLJKHUFDVK UHVHUYHV7RWDOUHFHLYDEOHVGHFUHDVHGGXHSULPDULO\WRLQFUHDVHGSD\PHQWVRIGXHVDVVHVVHGIRUFDOHQGDU\HDU MXULVGLFWLRQVFDQHOHFWWRSD\TXDUWHUO\ 3UHSDLGVGHFUHDVHGGXHWRORZHUSUHSDLGIHUU\WUDQVLWSDVVHVDW WKHHQGRIWKHILVFDO\HDU LQFUHDVHGWHOHZRUNLQJE\VWDII 7$%/( &855(17$66(76 $VRI-XQHDQG ,QZKROHGROODUV &KDQJH &855(17$66(76 &DVKDQG,QYHVWPHQWV $FFRXQWV5HFHLYDEOH 1HW 3UHSDLGV 7RWDO&XUUHQW$VVHWV $PRXQWVPD\QRWDGGGXHWRURXQGLQJ 1RQ&XUUHQW$VVHWV 1RQFXUUHQWDVVHWV 7DEOH FRQVLVWRI'HSRVLWV VHFXULW\GHSRVLWIRUWKHRIILFHOHDVH DQG1HW&DSLWDO$VVHWV WRWDOFDSLWDODVVHWVOHVVDFFXPXODWHGGHSUHFLDWLRQ $WILVFDO\HDUHQGQRQFXUUHQWDVVHWVZHUH PLOOLRQDVPDOOLQFUHDVHIURPWKHSULRU\HDU7KHLQFUHDVHZDVSULPDULO\GXHWRWKHSXUFKDVHRIYHKLFOHVDLU Page 29 of 85 TXDOLW\PRQLWRULQJHTXLSPHQWDQGFRPSXWHUHTXLSPHQWRIIVHWE\WKHZULWHRIIRIGLVSRVHGDVVHWV VHHQRWH± &DSLWDO$VVHWV /LDELOLWLHV 7DEOHVKRZVWKHNH\FRPSRQHQWVRIOLDELOLWLHVDQGWKHLUFKDQJHVIURPWKHSULRU\HDU7RWDOOLDELOLWLHVDW-XQH ZHUHPLOOLRQDGHFUHDVHRIPLOOLRQIURP PDLQO\DVWKHUHVXOWRIWKHGHFUHDVHLQWKH DJHQF\¶VSURSRUWLRQDWHVKDUHRIWKHVWDWH3(56SHQVLRQOLDELOLW\DQGDUHGXFWLRQLQWKHWRWDOVWDWH3(56SHQVLRQ OLDELOLW\ VHH1RWH±3HQVLRQ3ODQV 7KLVGHFUHDVHZDVRIIVHWE\LQFUHDVHVLQRWKHUSRVWHPSOR\PHQW OLDELOLWLHV GXHWRFKDQJHVLQDVVXPSWLRQV DQGLQFUHDVHVLQERWKWKHFXUUHQWDQGQRQFXUUHQWSRUWLRQVRI FRPSHQVDWHGDEVHQFHV HPSOR\HHVXVHGOHVVRIWKHLUSDLGOHDYHEDODQFHVLQGXHWR&RYLG 6HH1RWH ±&KDQJHVLQ/RQJ7HUP/LDELOLWLHVDQG1RWH±2WKHU3RVWHPSOR\PHQW%HQHILW3ODQVIRUIXUWKHULQIRUPDWLRQ 7$%/( /,$%,/,7,(6 $VRI-XQHDQG ,QZKROHGROODUV &KDQJH /,$%,/,7,(6 $FFRXQWV3D\DEOH $FFUXHG3D\UROO/LDELOLWLHV &RPSHQVDWHG$EVHQFHVDQG([FHVV&RPSHQVDWLRQ&XUUHQW 2WKHU&XUUHQW/LDELOLWLHV 6XEWRWDO&XUUHQW/LDELOLWLHV &RPSHQVDWHG$EVHQFHV1RQFXUUHQW 2WKHU3RVW(PSOR\PHQW%HQHILWV/LDELOLW\ 1HW3HQVLRQ/LDELOLW\ 6XEWRWDO1RQ&XUUHQW/LDELOLWLHV 7RWDO/LDELOLWLHV $PRXQWVPD\QRWDGGGXHWRURXQGLQJ 7$%/( /,$%,/,7,(6 $VRI-XQHDQG ,QZKROHGROODUV &KDQJH /,$%,/,7,(6 $FFRXQWV3D\DEOH $FFUXHG3D\UROO/LDELOLWLHV &RPSHQVDWHG$EVHQFHVDQG([FHVV&RPSHQVDWLRQ&XUUHQW &XUUHQW3RUWLRQ23(%/LDELOLW\ 2WKHU&XUUHQW/LDELOLWLHV 6XEWRWDO&XUUHQW/LDELOLWLHV &RPSHQVDWHG$EVHQFHV1RQFXUUHQW 2WKHU3RVW(PSOR\PHQW%HQHILWV/LDELOLW\ 1HW3HQVLRQ/LDELOLW\ 6XEWRWDO1RQ&XUUHQW/LDELOLWLHV 7RWDO/LDELOLWLHV $PRXQWVPD\QRWDGGGXHWRURXQGLQJ 3ULRU\HDUUHVWDWHGIRUFXUUHQWYORQJWHUPSRUWLRQVRI23(%OLDELOLWL\ 'HIHUUHG2XWIORZVDQG,QIORZVRI5HVRXUFHV Page 30 of 85 7KHGHIHUUHGRXWIORZVDQGLQIORZVVKRZQRQWKH&RPSDUDWLYH6WDWHPHQWRI1HW3RVLWLRQLQ7DEOHDUHWKHUHVXOW RILPSOHPHQWLQJ*$6% $FFRXQWLQJDQG)LQDQFLDO5HSRUWLQJIRU3HQVLRQV WRUHIOHFWWKH$JHQF\¶VSRUWLRQRI WKHVWDWH¶VQHWSHQVLRQOLDELOLW\DQGIURPLPSOHPHQWLQJ*$6%IRUUHFRJQL]LQJOLDELOLWLHVIRURWKHUSRVW HPSOR\PHQWEHQHILWV 23(% 'HIHUUHGRXWIORZVKDYHDSRVLWLYHHIIHFWRQQHWSRVLWLRQDQGGHIHUUHGLQIORZV KDYHDQHJDWLYHHIIHFWRQQHWSRVLWLRQ,Q)<GHIHUUHGRXWIORZVLQFUHDVHGE\PDLQO\DVDUHVXOWRIWKH FKDQJHLQWKHQHWGLIIHUHQFHEHWZHHQH[SHFWHGDQGDFWXDOH[SHULHQFHIRU3(563ODQDQGSHQVLRQSODQV,Q )<GHIHUUHGLQIORZVGHFUHDVHGE\PLOOLRQGXHSULPDULO\WRWKHHOLPLQDWLRQRIGHIHUUHGLQIORZVIRU23(% VHH1RWHVDQG 7$%/( '()(55('287)/2:6$1',1)/2:6 $VRI-XQHDQG ,QZKROHGROODUV &KDQJH '()(55('287)/2:6 'HIHUUHG2XWIORZV3HQVLRQV 'HIHUUHG2XWIORZV2WKHU3RVW(PSOR\PHQW%HQHILWV 7RWDO'HIHUUHG2XWIORZV '()(55(',1)/2:6 'HIHUUHG,QIORZV3HQVLRQV 'HIHUUHG,QIORZV2WKHU3RVW(PSOR\PHQW%HQHILWV 7RWDO'HIHUUHG,QIORZV $PRXQWVPD\QRWDGGGXHWRURXQGLQJ 1HW3RVLWLRQ 7KHNH\HOHPHQWVRIWKH$JHQF\¶VQHWSRVLWLRQDUHVKRZQLQ7DEOHDWWKHHQGRIWKLVVHFWLRQ1HWSRVLWLRQLV WKHRYHUDOOH[FHVVRIDVVHWVRYHUOLDELOLWLHV,QWKH$JHQF\µVRYHUDOOQHWSRVLWLRQRIPLOOLRQLQFUHDVHG E\PLOOLRQIURPWKHSULRU\HDU7KHPDLQIDFWRUVFRQWULEXWLQJWRWKHQHWLQFUHDVHZHUH 7KHUHVWULFWHGSRUWLRQRIQHWSRVLWLRQLQFOXGHVUHVHUYHVZKLFKDUHUHVWULFWHGE\H[WHUQDOSDUWLHV HJ JUDQWRUV RUE\VWDWHRUIHGHUDOODZ7KLVLQFOXGHVJUDQWVDQGFRQWUDFWVIURPIHGHUDOVWDWHDQGORFDO JRYHUQPHQWVFRPSOLDQFHIHHSURJUDPUHVHUYHVJRYHUQHGE\VWDWHVWDWXWHVDQGFRQWUDFWVWKDWSURYLGH UHVWULFWHGIXQGVWRWKH$JHQF\7KHUHVWULFWHGSRUWLRQRIQHWSRVLWLRQGHFUHDVHGGXHIRUWKH PRVWSDUWWRVSHQGLQJIURPWKHVWDWHGLHVHOJUDQW VWDIIZRUNLQJRQSROOXWLRQUHGXFWLRQSURJUDPV DQG UHGXFWLRQVLQRWKHUUHVWULFWHGUHVHUYHV7KHVHZHUHRIIVHWE\DQLQFUHDVHLQWKH5HJLVWUDWLRQIHH SURJUDPUHVHUYHV WUDQVIHUVRIFLYLOSHQDOWLHVWRIXQGDGGLWLRQDOFRVWVRIHQIRUFHPHQWFDVHV 7KHXQUHVWULFWHGSRUWLRQRIQHWSRVLWLRQFRPSULVHVUHVHUYHVZKRVHXVHLVQRWH[WHUQDOO\UHVWULFWHGEXW ZKLFKPD\EHUHVHUYHGIRUVSHFLILFXVHVWKURXJKWKH$JHQF\¶VILQDQFLDOSROLFLHVDQGEXGJHW ERWK DSSURYHGWKH$JHQF\¶V%RDUG 8QUHVWULFWHGQHWDVVHWVLPSURYHGE\PLOOLRQPDLQO\GXHWRWKH UHGXFWLRQLQWKHSHQVLRQOLDELOLW\WKHFROOHFWLRQRIFLYLOSHQDOWLHV DSRUWLRQRIWKLVZDVWUDQVIHUUHGWRWKH OHJDOUHVHUYH DQGFRVWVDYLQJVVWHSVWDNHQWKDWLQFUHDVHGWKHVXSSOHPHQWDOLQFRPH SHUFDSLWD UHVHUYH Page 31 of 85 7$%/( 1(7326,7,215(675,&7('$1'815(675,&7(' $VRI-XQHDQG ,QZKROHGROODUV &KDQJH 1HW,QYHVWPHQWLQ&DSLWDO$VVHWV )HH3URJUDP5HVHUYHV 6WDWH'LHVHO*UDQW 2WKHU5HVWULFWHG5HVHUYHV 5HVWULFWHG 6XSSOHPHQWDO,QFRPH5HVHUYH &LYLO3HQDOW\5HVHUYH (TXLSPHQW5HVHUYH (PSOR\HU5HWLUHPHQW5HVHUYH *HQHUDO5HVHUYH *HQHUDO/HJDO5HVHUYH 8QHPSOR\PHQW5HVHUYH 2WKHU3RVW(PSOR\PHQW%HQHILWV5HVHUYH 3HQVLRQ5HVHUYH 2WKHU8QUHVWULFWHG 8QUHVWULFWHG 1HW3RVLWLRQ $PRXQWVPD\QRWDGGGXHWRURXQGLQJ 6WDWHPHQWRI5HYHQXHV([SHQVHVDQG&KDQJHVLQ)XQG1HW3RVLWLRQ *UDSKEHORZVKRZVWKH$JHQF\¶VWRWDOUHYHQXHVRIPLOOLRQIURPDOOVRXUFHVRIIXQGLQJ PLOOLRQLQ RSHUDWLQJUHYHQXHVDQGPLOOLRQLQFOXGHGLQQHWQRQRSHUDWLQJUHYHQXHV &KDUJHVIRU6HUYLFHVDUHWKH ODUJHVWVRXUFHRIIXQGLQJ DQGLQFOXGHSHUPLWWLQJIHHVFKDUJHGWRSROOXWLRQVRXUFHV6XSSOHPHQWDO LQFRPH SHUFDSLWD LVRIWKHDJHQF\¶VIXQGLQJDQGLVIURPDQQXDODVVHVVPHQWVFKDUJHGWRWKHIRXU FRXQW\MXULVGLFWLRQVWRVXSSRUWSROOXWLRQUHGXFWLRQSURJUDPV1RQRSHUDWLQJUHYHQXHV JUDQWVFRQWUDFWVFLYLO SHQDOW\FROOHFWLRQVDQGLQWHUHVWLQFRPH FRPSULVHDERXWRIWRWDOIXQGLQJ:KLOHWKH$JHQF\KDVELDQQXDOO\ UHQHZLQJIHGHUDODQGVWDWHJUDQWVRIDERXWPLOOLRQQRQUHFXUULQJVWDWHDQGIHGHUDOJUDQWVWKDWVXSSRUW VSHFLILFSROOXWLRQUHGXFWLRQSURMHFWVFDQYDU\IURP\HDUWR\HDU Page 32 of 85 ,Q7DEOHZHFRPSDUHWKHRSHUDWLQJDQGQRQRSHUDWLQJUHYHQXHVDQGH[SHQVHVWRWKHSULRU\HDU2QDQ RYHUDOOEDVLVWKHQHWSRVLWLRQRIWKH$JHQF\LQFUHDVHGE\PLOOLRQ7RWDORSHUDWLQJUHYHQXHVLQFUHDVHG PLOOLRQPDLQO\GXHWKHWUDQVIHURIFLYLOSHQDOW\UHYHQXHVWRWKH5HJLVWUDWLRQIHHSURJUDPWRRIIVHWKLJKHUWKDQ XVXDOVWDIIFRVWVUHODWHGWRVHYHUDOHQIRUFHPHQWFDVHV7RWDORSHUDWLQJH[SHQVHVLQFUHDVHGPLOOLRQGXHWR LQFUHDVHGSHUVRQQHOH[SHQVHV ILOOLQJRSHQSRVLWLRQVLQ LQFUHDVHGOHDYHOLDELOLW\DQGLQFUHDVHGH[SHQVHV UHODWHGWRSRVWHPSOR\PHQWEHQHILWOLDELOLWLHV1RQRSHUDWLQJUHYHQXHV QHWRIQRQRSHUDWLQJH[SHQVHV LQFUHDVHGE\PLOOLRQDVWKHUHVXOWRIKLJKHUIHGHUDOJUDQWVDQGFLYLOSHQDOW\FROOHFWLRQV IURPVHYHUDO HQIRUFHPHQWFDVHV VHH7DEOHIRUPRUHLQIRUPDWLRQ Page 33 of 85 7$%/( &203$5$7,9(67$7(0(172)5(9(18(6(;3(16(6$1'&+$1*(6,1)81'1(7326,7,21 $VRI-XQHDQG ,QZKROHGROODUV &KDQJH 23(5$7,1*5(9(18(6 &KDUJHVIRU6HUYLFHV 6XSSOHPHQWDO,QFRPH 3HU&DSLWD 2WKHU2SHUDWLQJ5HYHQXHV 0LVFHOODQHRXV2SHUDWLQJ5HYHQXHV 7RWDO2SHUDWLQJ5HYHQXHV 23(5$7,1*(;3(16(6 3HUVRQQHO([SHQVHV 2WKHU2SHUDWLQJ([SHQVHV 7RWDO2SHUDWLQJ([SHQVHV 12123(5$7,1*5(9(18(6 (;3(16(6 6XUSOXV 'HILFLW (IIHFWRI23(%DQG3HQVLRQ/LDELOLWLHV &+$1*(,11(7326,7,21 1(7326,7,21 727$/1(7326,7,21%HJLQQLQJ 727$/1(7326,7,21(QGLQJ $PRXQWVPD\QRWDGGGXHWRURXQGLQJ &KDUJHVIRU6HUYLFHV 2SHUDWLQJ5HYHQXHV &KDUJHVIRUVHUYLFHVLQFOXGHFRPSOLDQFHIHHSURJUDPVIRUUHJXODWHGSROOXWLRQVRXUFHV:LWKWKHH[FHSWLRQRIWKH DVEHVWRVSURJUDPWKHVHDUHUHJXODWHGE\WKH5HYLVHG&RGHRI:DVKLQJWRQ 5&: DQGWKHLUIHHVDUHUHVWULFWHG IRUXVHLQIXQGLQJWKHFRVWVRIWKHLUUHVSHFWLYHSURJUDPV7KH$JHQF\¶VILQDQFLDOSROLFLHVUHVHUYHWKHXVHRI HDFKRIWKHVHIHHSURJUDPV¶UHYHQXHVIRUWKHFRVWVRIWKDWSURJUDP,Q7DEOHZHFRPSDUHFKDUJHVIRU VHUYLFHVIRUDQG :KLOHWKHUHZHUHQRFKDQJHVLQWKHIHHVWUXFWXUHVIRUWKHVHSURJUDPVRYHUDOO FKDUJHVIRUVHUYLFHVGHFUHDVHGGXULQJGXHWRORZHUDVEHVWRVUHPRYDODQGQRWLFHRIFRQVWUXFWLRQ SHUPLWWLQJLQWKHVHFRQGKDOIRIWKH\HDU,QDGGLWLRQEDGGHEWH[SHQVHUHODWHGWRWKHFXUUHQW\HDUELOOLQJV LQFUHDVHGGXHWRVOLJKWO\ORZHUFROOHFWLRQVRISDVWGXHIHHVLQ 7$%/( &+$5*(6)256(59,&(6 $VRI-XQHDQG ,QZKROHGROODUV &KDQJH &+$5*(6)256(59,&(6 5HJLVWUDWLRQ)HHV %DG'HEW5HJLVWUDWLRQ)HHV 2SHUDWLQJ3HUPLW)HHV 1RWLFHRI&RQVWUXFWLRQ)HHV $VEHVWRV)HHV 7RWDO&KDUJHVIRU6HUYLFHV $PRXQWVPD\QRWDGGGXHWRURXQGLQJ 6XSSOHPHQWDO,QFRPH 2SHUDWLQJ5HYHQXHV 7KURXJKWKH:DVKLQJWRQ6WDWH&OHDQ$LU$FWWKH$JHQF\FDQFKDUJHWKHIRXUFRXQW\MXULVGLFWLRQVDSHUFDSLWD IHHZKLFKVXSSOHPHQWVIXQGLQJIURPWKH(QYLURQPHQWDO3URWHFWLRQ$JHQF\ (3$ DQGWKH6WDWH'HSDUWPHQWRI (FRORJ\ WKHELHQQLDOVWDWHDQGIHGHUDOFRUHJUDQWV IRUPRQLWRULQJSXEOLFHGXFDWLRQSURJUDPVXSSRUWWHFKQLFDO DQGEXVLQHVVDVVLVWDQFHDQGDGPLQLVWUDWLRQ,QWKHSHUFDSLWDIHHZDV QRFKDQJHIURPWKHSULRU \HDU DQGWKHIRXUFRXQW\SRSXODWLRQLQFUHDVHG7KLVUHVXOWHGLQWRWDOVXSSOHPHQWDOLQFRPH SHUFDSLWD RI PLOOLRQDLQFUHDVHIURPWKHSULRU\HDU 7DEOH $VDSSURYHGE\WKH$JHQF\¶V%RDUGRI'LUHFWRUVWKH Page 34 of 85 WRWDODVVHVVPHQWZDVDSSRUWLRQHGWRWKHIRXUFRXQW\MXULVGLFWLRQVEDVHGRQSRSXODWLRQDQGRQ SURSHUW\WD[YDOXDWLRQV 0LVFHOODQHRXV 2SHUDWLQJ5HYHQXHV 0LVFHOODQHRXV2SHUDWLQJ5HYHQXHV 7DEOH RILQLQFOXGHGUHLPEXUVHPHQWVSXEOLFGLVFORVXUH IHHVDQGMXU\GXW\IHHV7KLVZDVVOLJKWO\ORZHUWKDQ 2SHUDWLQJ([SHQVHV *UDSKGLVSOD\VWKHH[SHQVHFRPSRQHQWVRIRSHUDWLQJH[SHQVHVLQUHODWLYHWR 7RWDO RSHUDWLQJH[SHQVHVLQZHUH PLOOLRQDPLOOLRQLQFUHDVHIURPWKHSULRU\HDU 3HUVRQQHOH[SHQVHVFRQVLVWLQJRIZDJHVDQGEHQHILWVLQFUHDVHGPLOOLRQ:DJHVH[SHQVHVLQFUHDVHG PLOOLRQDVWKHUHVXOWRIILOOLQJRSHQSRVLWLRQV RSHUDWLQJH[SHQVHV DQGFRVWRIOLYLQJDGMXVWPHQWVLQWKHUDQJHRI WR%HQHILWVH[SHQVH WKDWLQFOXGHDGMXVWPHQWVWRSHQVLRQH[SHQVHDQGOHDYHOLDELOLW\ LQFUHDVHG PLOOLRQGXHWRLQFUHDVHG23(%H[SHQVHDQGLQFUHDVHGOHDYHOLDELOLW\ HPSOR\HHVXVHGOHVVRIWKHLUDFFUXHGSDLG OHDYHWKDQLQWKHSULRU\HDUPDLQO\GXHWR&RYLG 3URIHVVLRQDOVHUYLFHVDQGZRUNSODQV SULPDULO\JUDQWSDVVWKURXJKH[SHQGLWXUHV GHFUHDVHGPLOOLRQWKLV ZDVGXHPDLQO\WRDPLOOLRQGHFUHDVHLQWHPSRUDU\KHOSVHUYLFHVDQGDPLOOLRQGHFUHDVHLQFRQVXOWLQJ VHUYLFHV7KLVZDVRIIVHWE\DPLOOLRQLQFUHDVHLQOHJDOSURIHVVLRQDOIHHV WRDGGUHVVVHYHUDOOLWLJDWLRQ FDVHV 7KHUHQWIDFLOLWLHVDQGLQVXUDQFHH[SHQVHVGHFUHDVHGPLOOLRQGXHWRIHZHUSXUFKDVHVRIQRQFDSLWDO HTXLSPHQWLQWKHODVWWZRTXDUWHUVRI 2WKHURSHUDWLQJH[SHQVHVGHFUHDVHGPDLQO\GXHWRUHGXFHGWUDYHOWUDLQLQJDQGPHHWLQJVLQWKHODWWHU KDOIRI Page 35 of 85 1RQ2SHUDWLQJ5HYHQXHV ([SHQVHV ,Q7DEOHZHFRPSDUHQRQRSHUDWLQJUHYHQXHV H[SHQVHV ±WKHVHDUHFRPSULVHGRIVWDWHDQGIHGHUDOJUDQWV FRQWUDFWUHYHQXHVFLYLOSHQDOW\FROOHFWLRQVDQGLQYHVWPHQWUHYHQXHVDORQJZLWKWKHLUUHODWHGH[SHQVHV 7$%/( 12123(5$7,1*5(9(18(6 (;3(16(6 $VRI-XQHDQG ,QZKROHGROODUV &KDQJH 12123(5$7,1*5(9(18(6 (;3(16(6 )HGHUDODQG6WDWH*UDQW5HYHQXHV &RQWUDFW5HYHQXHV &LYLO3HQDOW\&ROOHFWLRQV ,QYHVWPHQW5HYHQXHVQHWRIXQUHDOL]HGUHDOL]HGJDLQVORVVHV 6XEWRWDO1RQ2SHUDWLQJ5HYHQXHV 3HUVRQQHO([SHQVHV :RUNSODQ([SHQVHV 2WKHU1RQ2SHUDWLQJ([SHQVHV 6XEWRWDO1RQ2SHUDWLQJ([SHQVHV 7RWDO1RQ2SHUDWLQJ5HYHQXHV ([SHQVHV $PRXQWVPD\QRWDGGGXHWRURXQGLQJ 7RWDOQRQRSHUDWLQJUHYHQXHVLQFUHDVHGE\PLOOLRQGXHPDLQO\WRWKHLQFUHDVHLQRQHWLPHIHGHUDOJUDQW IXQGLQJIRUVSHFLILFHPLVVLRQVUHGXFWLRQVSURMHFWVDQGWRWKHLQFUHDVHGFLYLOSHQDOW\FROOHFWLRQV $VPDOODPRXQWRIFRQWUDFWUHYHQXHVFDUULHGRYHUIURP KRZHYHUZHGLGQRWDGGDQ\QHZUHYHQXH FRQWUDFWVLQ &LYLOSHQDOW\FROOHFWLRQVLQFUHDVHGPLOOLRQLQGXHWRVHYHUDOHQIRUFHPHQWFDVHVZLWKLQWZREXVLQHVV VHFWRUV7KHVHFROOHFWLRQVDUHQRWSODQQHGRUEXGJHWHGDQGWKH$JHQF\¶VILQDQFLDOSROLFLHVJRYHUQKRZWKHVH IXQGVDUHVSHQW$VSHURXUILQDQFLDOSROLFLHVFLYLOSHQDOW\H[SHQGLWXUHVDUHIXQGHGE\FROOHFWLRQVIURPSULRU ILVFDO\HDUV 1HWLQYHVWPHQWUHYHQXHVGHFUHDVHGVOLJKWO\IURP PRVWO\GXHWRDGHFUHDVHLQWKHXQUHDOL]HGPDUNHWYDOXH RIUHVHUYHVPDQDJHGLQWKH.LQJ&RXQW\,QYHVWPHQW3RROWKHLQYHVWPHQW\LHOGIRUWKH.LQJ&RXQW\,QYHVWPHQW 3RRODVZHOODVWKHEDODQFHVLQYHVWHGLQWKHSRROLQFUHDVHGUHVXOWLQJLQLQFUHDVHGLQWHUHVWLQFRPH 7RWDOQRQRSHUDWLQJH[SHQVHVLQFUHDVHGPLOOLRQDVDUHVXOWRIWKHLQFUHDVHLQIHGHUDOJUDQWVDQGWKHLUUHODWHG ZRUNSODQSDVVWKURXJKH[SHQGLWXUHV )LQDQFLDO&RQWDFW 7KH$JHQF\¶VILQDQFLDOVWDWHPHQWVDUHGHVLJQHGWRSURYLGHXVHUVZLWKDJHQHUDORYHUYLHZRIWKH$JHQF\¶V ILQDQFLDOSHUIRUPDQFHDVZHOODVWREHDFFRXQWDEOHWRWKHSXEOLFIXQGHUVDQGSDUWQHUV,I\RXKDYHDTXHVWLRQ DERXWWKHUHSRUWSOHDVHFRQWDFWWKH3XJHW6RXQG&OHDQ$LU$JHQF\$WWHQWLRQ )LQDQFH 7KLUG$YHQXH 6XLWH6HDWWOH:$ RUHPDLO ILQDQFH#SVFOHDQDLURUJ Page 36 of 85 D'EŽ͘ϭϬϮϰ 38*(76281'&/($1$,5$*(1&< 67$7(0(172)1(7326,7,21 $VRI-XQH ,QZKROHGROODUV $66(76 &XUUHQW$VVHWV &DVKDQG&DVK(TXLYDOHQWV $FFRXQWV5HFHLYDEOH QHWRIDOORZDQFHIRU GRXEWIXODFFRXQWV 3UHSDLGV 7RWDO&XUUHQW$VVHWV 1RQ&XUUHQW$VVHWV 'HSRVLWV 2IILFH/HDVH &DSLWDO$VVHWVEHLQJ'HSUHFLDWHG (TXLSPHQW /HDVHKROG,PSURYHPHQWV /HVV$FFXPXODWHG'HSUHFLDWLRQ 7RWDO&DSLWDO$VVHWV 1HW 7RWDO1RQ&XUUHQW$VVHWV 727$/$66(76 '()(55('287)/2:62)5(6285&(6 'HIHUUHG2XWIORZVUHODWHGWR3HQVLRQV 727$/'()(55('287)/2:62)5(6285&(6 /,$%,/,7,(6 &XUUHQW/LDELOLWLHV $FFRXQWV3D\DEOH $FFUXHG3D\UROO/LDELOLWLHV &RPSHQVDWHG$EVHQFHVDQG([FHVV&RPSHQVDWLRQ 7RWDO23(%/LDELOLW\ 2WKHU&XUUHQW/LDELOLWLHV 7RWDO&XUUHQW/LDELOLWLHV 1RQ&XUUHQW/LDELOLWLHV &RPSHQVDWHG$EVHQFHV 7RWDO23(%/LDELOLW\ 1HW3HQVLRQ/LDELOLW\ 7RWDO1RQ&XUUHQW/LDELOLWLHV 727$//,$%,/,7,(6 '()(55(',1)/2:62)5(6285&(6 'HIHUUHG,QIORZVUHODWHGWR3HQVLRQV 727$/'()(55(',1)/2:62)5(6285&(6 1(7326,7,21 ,QYHVWPHQWLQ&DSLWDO$VVHWV 5HVWULFWHG JUDQWOHJDODQGFRQWUDFWUHTXLUHPHQWV 8QUHVWULFWHG 727$/1(7326,7,21 7RWDOVPD\QRWDGGGXHWRURXQGLQJ 7KHQRWHVWRWKHILQDQFLDOVWDWHPHQWVDUHDQLQWHJUDOSDUWRIWKLVVWDWHPHQW Page 37 of 85 D'EŽ͘ϭϬϮϰ 38*(76281'&/($1$,5$*(1&< 67$7(0(172)5(9(18(6(;3(16(6$1'&+$1*(6,11(7326,7,21 )RUWKHSHULRG-XO\ -XQH ,QZKROHGROODUV 23(5$7,1*5(9(18( &KDUJHVIRU6HUYLFHVQHWRIEDGGHEWH[SHQVH 6XSSOHPHQWDO,QFRPH 3HU&DSLWD 2WKHU2SHUDWLQJ5HYHQXHV 0LVFHOODQHRXV5HYHQXHV 7RWDO2SHUDWLQJ5HYHQXHV 23(5$7,1*(;3(16(6 6DODULHVDQG:DJHV (PSOR\HH%HQHILWV :RUN3ODQV 3URIHVVLRQDO6HUYLFHV 6RIWZDUH3XUFKDVHV 0DLQWHQDQFH 5HSDLUVDQG0DLQWHQDQFH 2SHUDWLQJ([SHQVHV6XSSOLHVDQG3ULQWLQJ 5HQW8WLOLWLHVDQG,QVXUDQFH 7UDYHO7UDLQLQJDQG0HHWLQJ([SHQVHV 7HOHSKRQHDQG3RVWDJH /HJDO([SHQVHV 7D[HVDQG%DQN&KDUJHV 1RQ&DSLWDOL]HG$VVHWV XQGHU *DLQ /RVVRQ$VVHW'LVSRVDO 'HSUHFLDWLRQ 7RWDO2SHUDWLQJ([SHQVHV 2SHUDWLQJ6XUSOXV 'HILFLW 12123(5$7,1*5(9(18(6 (;3(16(6 )HGHUDODQG6WDWH*UDQW5HYHQXHV &RQWUDFW5HYHQXHV &LYLO3HQDOW\&ROOHFWLRQV ,QYHVWPHQW5HYHQXHVQHWRI8QUHDOL]HGDQG5HDOL]HG *DLQV/RVVHV 6DODULHVDQG:DJHV (PSOR\HH%HQHILWV :RUNSODQ([SHQVHV 2WKHU1RQ2SHUDWLQJ([SHQVHV 7RWDO1RQ2SHUDWLQJ5HYHQXHV ([SHQVHV Page 38 of 85 7RWDO6XUSOXV 'HILFLW &KDQJHLQWKHDSSOLFDWLRQRIDQDFFRXQWLQJSULQFLSOHLQWKH UHSRUWLQJRI23(% &KDQJHLQ1HW3RVLWLRQ 7RWDO1HW3RVLWLRQ%HJLQQLQJ 7RWDO1HW3RVLWLRQ(QGLQJ 7RWDOVPD\QRWDGGGXHWRURXQGLQJ 7KHQRWHVWRWKHILQDQFLDOVWDWHPHQWVDUHDQLQWHJUDOSDUWRIWKLVVWDWHPHQW Page 39 of 85 MCAG No. 1024 PUGET SOUND CLEAN AIR AGENCY STATEMENT OF CASH FLOWS - PROPRIETARY FUNDS For the period July 1, 2019 through June 30, 2020 (In whole dollars) CASH FLOW FROM OPERATING ACTIVITIES Receipts from customers 9,524,891 Payment to suppliers (1,927,076) Payment to employees (7,441,784) Net cash provided (used) by operating activities 156,031 CASH FLOWS FROM NONCAPITAL FINANCING ACTIVITIES Non-operating revenues (expenses), net of non-cash adjustments 971,159 Net cash provided (used) by noncapital financing activities 971,159 CASH FLOWS FROM CAPITAL AND RELATED FINANCING ACTIVITIES Purchases of capital assets 142,546 Net cash provided (used) by capital and related financing activities 142,546 CASH FLOWS FROM INVESTING ACTIVITIES Proceeds from sales and maturities of investments Interest and dividends 210,604 Net cash provided by investing activities 210,604 Net Increase (Decrease) in cash and cash equivalents 1,480,340 Balances - beginning of the year 10,150,855 Balances - end of year 11,631,195 The notes to the financials are an integral part of this statement Page 40 of 85 3XJHW6RXQG&OHDQ$LU$JHQF\ )LVFDO Page 41 of 85 FKDUJHGDQGWKHDSSRUWLRQPHQWRIVXSSOHPHQWDOLQFRPHDVVHVVPHQWVWRWKHIRXUFRXQW\MXULVGLFWLRQV %XGJHWDPHQGPHQWVWKURXJKRXWWKHILVFDO\HDUDUHDSSURYHGE\WKH%RDUGDVGHHPHGDSSURSULDWHDQG DUHHQDFWHGWKURXJKD%RDUGUHVROXWLRQ ' $VVHWV/LDELOLWLHVDQG(TXLW\ &DVKDQG&DVK(TXLYDOHQWV $JHQF\SROLF\LVWRLQYHVWDOOWHPSRUDU\FDVKVXUSOXVHVDQGUHVHUYHV&DVKDQG&DVK(TXLYDOHQWV FRQVLVWRIWKH$JHQF\¶VFDVKDQGLQYHVWPHQWVKHOGLQWKH.LQJ&RXQW\,QYHVWPHQW3RRO 3RRO DQGD VPDOODPRXQWRISHWW\FDVK.LQJ&RXQW\DFWVDVWKH$JHQF\¶VWUHDVXUHUDQGLQYHVWVDOOWHPSRUDU\ FDVKVXUSOXVHV$W-XQHWKHWUHDVXUHUZDVKROGLQJDIDLUYDOXHDPRXQWRILQ LQYHVWPHQWVRIUHVHUYHV7KHDPRXQWLQFOXGHGDV&DVKDQG&DVK(TXLYDOHQWVRQWKH6WDWHPHQWRI 1HW3RVLWLRQDQGDV1HW&DVKRQWKH6WDWHPHQWRI&DVK)ORZVLVWKHERRNHGDPRXQWRI ±WKHGLIIHUHQFHLVGXHPDLQO\WRRXWVWDQGLQJXQFOHDUHGFKHFNVDQGWKHWLPLQJRILQWHUHVW HDUQHGUHFHLYHG6HH1RWHIRUWKHGHWDLORILQYHVWPHQWVDQGWKHUHFRQFLOLDWLRQEHWZHHQWKHIDLU YDOXHRILQYHVWPHQWVKHOGDQGWKHERRNHGDPRXQWV ,QLQWHUHVWHDUQLQJVDQGLQYHVWPHQWORVVUHFDSWXUHVZHUHDOORFDWHGWRWKHLQWHUHVWLQFRPH UHVHUYH±WKHH[FHVVRYHUDEDODQFHRIN UHVHUYHGIRULQYHVWPHQWORVVHV FDQEHXVHGZLWK %RDUGDSSURYDOIRUXQIRUHVHHQRQHWLPHQRQSHUVRQQHOH[SHQGLWXUHQHHGV 5HFHLYDEOHV $FFRXQWVUHFHLYDEOHFRQVLVWRIDPRXQWVRZHGIURPSULYDWHLQGLYLGXDOVFRPSDQLHVJRYHUQPHQWVRU RWKHURUJDQL]DWLRQVIRUJRRGVRUVHUYLFHVLQFOXGLQJDPRXQWVRZHGIRUZKLFKELOOLQJVKDYHEHHQ SUHSDUHGEXWWKHFDVKKDVQRWEHHQUHFHLYHG5HFHLYDEOHVUHODWHGWRWKH5HJLVWUDWLRQ)HHSURJUDP DUHUHSRUWHGQHWRIDQDOORZDQFHIRUXQFROOHFWLEOHDFFRXQWVWKDWLVDGMXVWHGDWHDFKILVFDO\HDUHQG EDVHGRQFROOHFWLRQWUHQGV 6HH1RWH &DSLWDO$VVHWV 7KH$JHQF\XVHV*$$3DFFRXQWLQJDQGFDSLWDOL]HVDOOORQJOLYHGDVVHWVYDOXHGDWJUHDWHUWKDQ ZLWKDXVHIXOOLIHJUHDWHUWKDQRQH\HDU&DSLWDODVVHWVDUHGHSUHFLDWHGRQDVWUDLJKWOLQHEDVLV RYHUWKHLUDSSOLFDEOHXVHIXOOLYHV 6HH1RWH 'HIHUUHG2XWIORZV,QIORZVRI5HVRXUFHV 7KH$JHQF\UHSRUWHGGHIHUUHGRXWIORZVDQGLQIORZVUHODWHGWRWKHLPSOHPHQWDWLRQRI*$6%IRU SHQVLRQOLDELOLWLHV7KHVHDUHUHSRUWHGVHSDUDWHO\RQWKHILQDQFLDOVWDWHPHQWV VHH1RWHVDQGIRU DGGLWLRQDOLQIRUPDWLRQ $FFRXQWV3D\DEOH $FFRXQWV3D\DEOHUHSUHVHQWVJRRGVDQGVHUYLFHVUHFHLYHGDVRI-XQHIRUZKLFKSD\PHQWV KDYHQRW\HWEHHQPDGH 6HH1RWH &RPSHQVDWHG$EVHQFHVDQG([FHVV&RPSHQVDWLRQ/LDELOLWLHV &RPSHQVDWHGDEVHQFHVDUHHDUQHGDQGXQWDNHQDEVHQFHVIRUZKLFKHPSOR\HHVPD\EHSDLGVXFK DVYDFDWLRQFRPSHQVDWRU\OHDYHDQGVLFNOHDYH ([FHVVFRPSHQVDWLRQIRUPHPEHUVRIWKH3XEOLF(PSOR\HHV5HWLUHPHQW6\VWHP 3(56 3ODQLVD SRUWLRQRIFRPSHQVDWLRQXVHGIRUSHQVLRQEHQHILWFDOFXODWLRQIRUZKLFKWKHH[WUDEHQHILWGHULYHGPXVW EHSDLGE\WKH$JHQF\UDWKHUWKDQE\WKHUHWLUHPHQWV\VWHP 9DFDWLRQOHDYHPD\EHDFFXPXODWHGXSWRWZLFHWKHHPSOR\HH¶VDQQXDODFFUXDOGD\V9DFDWLRQ DFFUXDOLQH[FHVVRIWZLFHWKHHPSOR\HH¶VDQQXDODFFUXDOLVSDLGRXWLQFDVKDIWHUWKHHQGRIHDFK ILVFDO\HDU8SRQVHSDUDWLRQIURPHPSOR\PHQWWKHHPSOR\HHUHFHLYHVSD\PHQWIRUDQ\XQXVHG YDFDWLRQ6LFNOHDYHPD\EHDFFXPXODWHGLQGHILQLWHO\$QHPSOR\HHVHSDUDWHGIURPVHUYLFHZLWKWKH $JHQF\GXHWRGHDWKUHWLUHPHQWRUGLVDELOLW\LVFRPSHQVDWHGLQDQDPRXQWHTXDOWRWKLUW\WKUHHDQG RQHWKLUGSHUFHQWRIDQ\XQXVHGVLFNOHDYHEXWQRWWRH[FHHGIRXUKXQGUHGKRXUV 9DFDWLRQVLFNOHDYHDQGFRPSHQVDWRU\WLPHDUHDFFUXHGDWRIWKHWRWDOHVWLPDWHGOLDELOLW\DVRI WKHILVFDO\HDUHQG7KHDFFUXHGOLDELOLW\LVUHYLHZHGDQGDGMXVWHGPRQWKO\$WWKHHQGRIILVFDO\HDU Page 42 of 85 WKHWRWDOFXUUHQWDQGQRQFXUUHQW&RPSHQVDWHG$EVHQFHVDQG([FHVV&RPSHQVDWLRQ/LDELOLW\ ZDV VHH1RWHIRUDGGLWLRQDOLQIRUPDWLRQ 2WKHU$FFUXHG/LDELOLWLHV 7KHVHDFFRXQWVFRQVLVWRIDFFUXHGZDJHVDQGDFFUXHGHPSOR\HHEHQHILWV 6KRUWDQG/RQJ7HUP'HEW 7KH$JHQF\KDVQRJHQHUDOUHYHQXHRUDVVHVVPHQWVKRUWRUORQJWHUPGHEW 3HQVLRQV )RUSXUSRVHVRIPHDVXULQJWKHQHWSHQVLRQOLDELOLW\GHIHUUHGRXWIORZVRIUHVRXUFHVDQGGHIHUUHG LQIORZVRIUHVRXUFHVUHODWHGWRSHQVLRQVDQGSHQVLRQH[SHQVHLQIRUPDWLRQDERXWWKHILGXFLDU\QHW SRVLWLRQRIDOOVWDWHVSRQVRUHGSHQVLRQSODQVDQGDGGLWLRQVWRGHGXFWLRQVIURPWKRVHSODQV¶ILGXFLDU\ QHWSRVLWLRQVKDYHEHHQGHWHUPLQHGRQWKHVDPHEDVLVDVWKH\DUHUHSRUWHGE\WKH:DVKLQJWRQ6WDWH 'HSDUWPHQWRI5HWLUHPHQW6\VWHPV)RUWKLVSXUSRVHEHQHILWSD\PHQWV LQFOXGLQJUHIXQGVRI HPSOR\HHFRQWULEXWLRQV DUHUHFRJQL]HGZKHQGXHDQGSD\DEOHLQDFFRUGDQFHZLWKWKHEHQHILWWHUPV ,QYHVWPHQWVDUHUHSRUWHGDWIDLUYDOXH VHH1RWH 2WKHU3RVWHPSOR\PHQW%HQHILW 23(% 3ODQV 7KH*RYHUQPHQWDO$FFRXQWLQJ6WDQGDUGV%RDUG *$6% UHOHDVHGDFFRXQWLQJVWDQGDUGVIRUSXEOLF SRVWHPSOR\PHQWEHQHILWSODQVRWKHUWKDQSHQVLRQ 23(% XQGHU*$6%7KH23(%OLDELOLW\DQG WKH23(%H[SHQVHDUHUHIOHFWHGLQWKHILQDQFLDOVWDWHPHQWV VHH1RWH 5HVWULFWHGDQG8QUHVWULFWHG1HW3RVLWLRQ 7KHUHVWULFWHGSRUWLRQRIQHWSRVLWLRQUHSUHVHQWVDPRXQWVUHVWULFWHGE\H[WHUQDOHQWLWLHVVXFKDVVWDWH OHJLVODWLRQVWDWHRUIHGHUDOJUDQWRUDJUHHPHQWVDQGFRQWUDFWVEHWZHHQWKH$JHQF\DQGRWKHUH[WHUQDO HQWLWLHV8QUHVWULFWHGQHWSRVLWLRQLQFOXGHVUHVHUYHVWKDWDUHVHWDVLGHSHUWKH$JHQF\¶VILQDQFLDO SROLFLHV VHH1RWH 3ULRU3HULRG$GMXVWPHQWV 7KHUHDUHQRDGMXVWPHQWVUHODWHGWRSULRUSHULRGV 127(±&$6+$1',19(670(176 8QGHUWKHUHTXLUHPHQWVRIWKH:DVKLQJWRQ6WDWH&OHDQ$LU$FWRQHFRXQW\ZLWKLQRXUIRXUFRXQW\MXULVGLFWLRQ .LQJ3LHUFH.LWVDSDQG6QRKRPLVK&RXQWLHV LVWRDFWDVWKH$JHQF\¶VWUHDVXUHU7KH$JHQF\KDVHQWHUHG LQWRDIRUPDOLQWHUORFDODJUHHPHQWZLWKWKH$JHQF\WRKDYHDOORILWVIXQGVQRWUHTXLUHGIRULPPHGLDWH H[SHQGLWXUHWREHLQYHVWHGLQWKH.LQJ&RXQW\,QYHVWPHQW3RRO ³3RRO´ 7KH3RROLVJXLGHGE\WKHIROORZLQJ SULQFLSOHV 7KHSULPDU\REMHFWLYHRIWKH3RRO¶VLQYHVWPHQWRISXEOLFIXQGVLVWRVDIHJXDUGLQYHVWPHQWSULQFLSDO 7KHVHFRQGDU\REMHFWLYHLVWRPDLQWDLQVXIILFLHQWOLTXLGLW\WRHQVXUHWKDWIXQGVDUHDYDLODEOHWRPHHWGDLO\ FDVKIORZUHTXLUHPHQWV 7KHWKLUGFRQVLGHUDWLRQLVWRDFKLHYHDUHDVRQDEOH\LHOGFRQVLVWHQWZLWKWKHVHREMHFWLYHV 7KH3RROLVDGPLQLVWHUHGE\WKH.LQJ&RXQW\7UHDVXU\2SHUDWLRQV6HFWLRQDVDQH[WHUQDOLQYHVWPHQWSRRO )RULQYHVWPHQWSXUSRVHVWKHFRXQW\SRROVWKHFDVKEDODQFHVRIFRXQW\IXQGVDQGSDUWLFLSDWLQJFRPSRQHQW XQLWVDQGDOORZVIRUSDUWLFLSDWLRQE\RWKHUOHJDOO\VHSDUDWHHQWLWLHVVXFKDVVSHFLDOGLVWULFWVIRUZKLFKWKH FRXQW\LVWKHH[RIILFLRWUHDVXUHUDQGSXEOLFDXWKRULWLHV7KHH[WHUQDOSRUWLRQRIWKH.&,3 WKHSRUWLRQWKDW EHORQJVWRVSHFLDOGLVWULFWVDQGSXEOLFDXWKRULWLHVRWKHUWKDQFRPSRQHQWXQLWV LVUHSRUWHGLQDQ,QYHVWPHQW 7UXVW)XQG,WLVWKHFRXQW\SROLF\WRLQYHVWDOOFRXQW\IXQGVLQWKH3RRO $OOVHFXULWLHVDUHUHSRUWHGDWIDLUYDOXHDQGUHSRUWVDUHSUHSDUHGPRQWKO\DQGGLVWULEXWHGWRDOO3RRO SDUWLFLSDQWV7KH3RROYDOXHVSDUWLFLSDQWV¶VKDUHVXVLQJDQDPRUWL]HGFRVWEDVLV0RQWKO\LQFRPHLV GLVWULEXWHGWRSDUWLFLSDQWVEDVHGRQWKHLUUHODWLYHSDUWLFLSDWLRQGXULQJWKHSHULRG,QFRPHLVFDOFXODWHGEDVHG RQUHDOL]HGLQYHVWPHQWJDLQVDQGORVVHVLQWHUHVWLQFRPHEDVHGRQVWDWHGUDWHV ERWKSDLGDQGDFFUXHG DQG WKHDPRUWL]DWLRQRIGLVFRXQWVDQGSUHPLXPVRQDVWUDLJKWOLQHEDVLV,QFRPHLVUHGXFHGE\WKHFRQWUDFWXDOO\ Page 43 of 85 DJUHHGXSRQIHHV7KLVPHWKRGGLIIHUVIURPWKHIDLUYDOXHPHWKRGXVHGWRYDOXHLQYHVWPHQWVLQWKHILQDQFLDO VWDWHPHQWVEHFDXVHWKHDPRUWL]HGFRVWPHWKRGLVQRWGHVLJQHGWRGLVWULEXWHWRSDUWLFLSDQWVDOOXQUHDOL]HG JDLQVDQGORVVHVGXHWRFKDQJHVLQWKHIDLUYDOXHV7KHQHWFKDQJHLQIDLUYDOXHVRIWKHLQYHVWPHQWVLV UHSRUWHGDVDQLQFUHDVHRUGHFUHDVHLQFDVKDQGFDVKHTXLYDOHQWVLQWKHVWDWHPHQWRIQHWSRVLWLRQ $VRI-XQHWKH$JHQF\LQYHVWPHQWV DPRXQWKHOGLQWKH3RRODQGIDLUYDOXH ZHUHWKHIROORZLQJ ,QYHVWPHQWV +HOGLQ.LQJ &RXQW\ (IIHFWLYH ,QYHVWPHQW7\SH ,QYHVWPHQW3RRO )DLU9DOXH 'XUDWLRQ .LQJ&RXQW\,QYHVWPHQW3RRO Page 44 of 85 7KHWRWDOIDLUYDOXHRILQYHVWPHQWVLQFUHDVHGIURPWKHSULRU\HDUGXHWRDFRPELQDWLRQRILQFUHDVHG LQYHVWPHQWVLQFUHDVHGPDUNHWYDOXHRIWKHXQLPSDLUHGLQYHVWPHQWVDQGGHFUHDVHGIDLUYDOXHIRUWKHLPSDLUHG SRUWLRQRILQYHVWPHQWV7KHLQFUHDVHVGHFUHDVHVLQIDLUYDOXHFRPELQHGZLWKWKHLQFUHDVHLQLQYHVWPHQWV UHVXOWHGLQWKHUHFRJQLWLRQRIDQHWXQUHDOL]HGJDLQRI7KLVZDVPDLQO\GXHWRWKHLQFUHDVHLQWKHIDLU YDOXHUDWLRIRUXQLPSDLUHGLQYHVWPHQWVIURPWR ,PSDLUHG,QYHVWPHQWV $WILVFDO\HDUHQGDOOLPSDLUHGFRPPHUFLDOSDSHULQYHVWPHQWVKDYHFRPSOHWHGHQIRUFHPHQWHYHQWV7KH.LQJ &RXQW\LPSDLUHGLQYHVWPHQWSRROKHOGRQHFRPPHUFLDOSDSHUDVVHWZKHUHWKHLPSDLUHGSRRODFFHSWHGDQ H[FKDQJHRIIHUDQGLVUHFHLYLQJWKHFDVKIORZVIURPWKHLQYHVWPHQW¶VXQGHUO\LQJVHFXULWLHV7KHLPSDLUHGSRRO DOVRKHOGWKHUHVLGXDOLQYHVWPHQWVLQRQHFRPPHUFLDOSDSHUDVVHWVWKDWZHUHSDUWRIFRPSOHWHGHQIRUFHPHQW HYHQWVZKHUHWKHLPSDLUHGSRRODFFHSWHGWKHFDVKRXWRSWLRQ$WWKHHQGRI)<WKH$JHQF\¶VVKDUHRIWKH LPSDLUHGLQYHVWPHQWSRROSULQFLSDOZDV PD[LPXPULVNRIORVV DQGWKH$JHQF\¶VIDLUYDOXHRIWKHVH LQYHVWPHQWVDWILVFDO\HDUHQGZDV3HUWKH$JHQF\¶VILQDQFLDOSROLF\ZHPDLQWDLQDQLQWHUHVWLQFRPH UHVHUYHLQWKHHYHQWWKHUHDUHXQSODQQHGLQYHVWPHQWORVVHV ,QWHUHVW5DWH5LVN $VRI-XQHWKH3RRO¶VDYHUDJHGXUDWLRQZDV \HDUV$VDPHDQVRIOLPLWLQJLWVH[SRVXUHWRULVLQJ LQWHUHVWUDWHVVHFXULWLHVSXUFKDVHGLQWKH3RROPXVWKDYHDILQDOPDWXULW\RUZHLJKWHGDYHUDJHOLIHQRORQJHU WKDQILYH\HDUV:KLOHWKH3RRO¶VPDUNHWYDOXHLVFDOFXODWHGRQDPRQWKO\EDVLVXQUHDOL]HGJDLQVDQGORVVHV DUH QRW GLVWULEXWHG WR SDUWLFLSDQWV 7KH 3RRO GLVWULEXWHV HDUQLQJV PRQWKO\ XVLQJ DQ DPRUWL]HG FRVW PHWKRGRORJ\ &UHGLW5LVN $VRI-XQHWKH$JHQF\¶VLQYHVWPHQWLQWKH3RROZDVQRWUDWHGE\DQDWLRQDOO\UHFRJQL]HGVWDWLVWLFDO UDWLQJRUJDQL]DWLRQ 15652 ,QFRPSOLDQFHZLWKVWDWHVWDWXWHV3RROSROLFLHVDXWKRUL]HLQYHVWPHQWVLQ86 7UHDVXU\VHFXULWLHV86DJHQF\VHFXULWLHVDQGPRUWJDJHEDFNHGVHFXULWLHVFRUSRUDWHQRWHV UDWHGDWOHDVW ³$´ PXQLFLSDOVHFXULWLHV UDWHGDWOHDVW³$´E\WZR15652V FRPPHUFLDOSDSHU UDWHGDWOHDVWWKHHTXLYDOHQW RI ³$´ FHUWLILFDWHV RI GHSRVLWV LVVXHG E\ TXDOLILHG SXEOLF GHSRVLWDULHV UHSXUFKDVH DJUHHPHQWV DQG WKH /RFDO*RYHUQPHQW,QYHVWPHQW3RROPDQDJHGE\WKH:DVKLQJWRQ6WDWH7UHDVXUHU¶VRIILFH 5HFRQFLOLDWLRQWR)LQDQFLDO6WDWHPHQWV 7DEOHEHORZOD\VRXWWKHUHFRQFLOLDWLRQEHWZHHQWKHWRWDOLQYHVWPHQWVKHOGLQWKH3RROVKRZQDERYHLQ 7DEOHDQGWKHDPRXQWRI&DVKDQG&DVK(TXLYDOHQWVUHSRUWHGRQWKHILQDQFLDOVWDWHPHQWV 7DEOH1RWH 5HFRQFLOLDWLRQWR)LQDQFLDO6WDWHPHQWV -XQH ,QYHVWPHQWV+HOGLQ.LQJ&RXQW\,QYHVWPHQW 3RRO )DLU9DOXH$GMXVWPHQWDW-XQHWK )DLU9DOXHRI,QYHVWPHQWV $GGEDFN ,QWHUHVW(DUQHGEXWQRWUHFHLYHG 5HFRQFLOLDWLRQLWHPVWLPLQJ DGMXVWPHQWV 2XWVWDQGLQJ&KHFNVQRWFOHDUHG 3HWW\&DVK &DVKDQG&DVK(TXLYDOHQWV)LQDQFLDO 6WDWHPHQWV %RRN9DOXH $PRXQWVPD\QRWDGGGXHWRURXQGLQJ 7KHERRNYDOXH ILQDQFLDOVWDWHPHQWDPRXQW LQFUHDVHGIURP WRIRUWKHVDPHUHDVRQVKLJKOLJKWHG HDUOLHULQWKLVQRWH 127(±$&&281765(&(,9$%/( 7RWDOUHFHLYDEOHV QHWRIWKHDOORZDQFHIRUGRXEWIXODFFRXQWV DW-XQHZHUHPLOOLRQD GHFUHDVHIURPWKHSULRU\HDUDVWKHUHVXOWRIVHYHUDOIDFWRUV6XSSOHPHQWDOLQFRPH SHUFDSLWD UHFHLYDEOHV GHFUHDVHGGXHWRHDUOLHUTXDUWHUO\SD\PHQWVE\VHYHUDOMXULVGLFWLRQVJUDQWVDQGFRQWUDFWVUHFHLYDEOHV GHFUHDVHGGXHWRPRUHWLPHO\SD\PHQWV HYHQWKRXJKJUDQWUHYHQXHVLQFUHDVHGLQ DQGRWKHU Page 45 of 85 UHFHLYDEOHV PRGLILFDWLRQVWRVHYHUDOVRXUFHV¶RSHUDWLQJSHUPLWV GHFUHDVHG7KHGHFUHDVHVZHUHRIIVHWE\ DQLQFUHDVHLQQHW5HJLVWUDWLRQUHFHLYDEOHV ORZHUFROOHFWLRQH[SHULHQFHIRUWKHFDOHQGDU\HDUIHH ELOOLQJV 7DEOH1RWH $FFRXQWV5HFHLYDEOH -XQH -XQH &KDQJH 5HJLVWUDWLRQ3URJUDP)HHV5HFHLYDEOH $OORZDQFHIRU'RXEWIXO$FFRXQWV 1HW5HJLVWUDWLRQ3URJUDP5HFHLYDEOHV 6WDWH)HGHUDO*UDQWVDQG&RQWUDFWV5HFHLYDEOH 6XSSOHPHQWDO,QFRPH 3HU&DSLWD )HHV5HFHLYDEOH 2WKHU5HFHLYDEOHV 7RWDO5HFHLYDEOHV 1HW 7RWDOVPD\QRWDGGGXHWRURXQGLQJ 127(±&$3,7$/$66(76 0DMRUH[SHQVHVIRUFDSLWDODVVHWVLQFOXGLQJPDMRUUHSDLUVWKDWLQFUHDVHXVHIXOOLYHVDUHFDSLWDOL]HGLIWKH\DUH JUHDWHUWKDQ0DLQWHQDQFHUHSDLUVDQGPLQRUUHQHZDOVDUHDFFRXQWHGIRUDVH[SHQVHVZKHQ LQFXUUHGZKLOHDOOFDSLWDODVVHWVDUHYDOXHGDWKLVWRULFDOFRVW7KHRULJLQDOFRVWRIRSHUDWLQJSURSHUW\UHWLUHGRU RWKHUZLVHGLVSRVHGRIDQGWKHFRVWRILQVWDOODWLRQOHVVVDOYDJHLVFKDUJHGWRDFFXPXODWHGGHSUHFLDWLRQ 'HSUHFLDWLRQH[SHQVHLVFKDUJHGWRRSHUDWLRQVWRDOORFDWHWKHFRVWRIFDSLWDODVVHWVRYHUWKHLUHVWLPDWHG XVHIXOOLYHVXVLQJWKHVWUDLJKWOLQHPHWKRGZLWKXVHIXOOLYHVUDQJLQJIURPWKUHHWRWHQ\HDUV &DSLWDODVVHWVDUHFODVVLILHGLQWKHIROORZLQJFDWHJRULHVDQGKDYHXVHIXOOLYHVDVVKRZQEHORZ &DWHJRU\ /LIH PRQWKV 9HKLFOHV &RPSXWHUV PRQWKOLIH &RPSXWHUV PRQWKOLIH /HDVHKROG,PSURYHPHQWV 7HUPRI/HDVHV 0RQLWRULQJ/DE6KRSDQG)LHOG (TXLSPHQW ,QILVFDO\HDUWKH$JHQF\DFTXLUHGLQFDSLWDODVVHWV7KHVHSXUFKDVHVLQFOXGHGYHKLFOHV FDSLWDOL]HGFRPSXWHUHTXLSPHQWDQGDLUPRQLWRULQJHTXLSPHQW$W\HDUHQGWRWDOFDSLWDODVVHWVZHUH DQGQHWFDSLWDODVVHWVDIWHUDFFXPXODWHGGHSUHFLDWLRQRIZHUH D LQFUHDVHIURPWKHSULRU\HDU'HFUHDVHVLQFDSLWDODVVHWVDQGDFFXPXODWHGGHSUHFLDWLRQRIUHIOHFW ZULWHRIIVRIGLVSRVHGDVVHWV YHKLFOHV(9EDWWHULHV 7RWDOGHSUHFLDWLRQH[SHQVHIRU)<ZDV±RI WKLVWRWDOUHODWHGWRRSHUDWLQJH[SHQVHVDQG ZDVLQFOXGHGLQQRQRSHUDWLQJH[SHQVHV 7KHVFKHGXOHRIDVVHWVDQGDFFXPXODWHGGHSUHFLDWLRQLVVKRZQEHORZ Page 46 of 85 7DEOH1RWH %DODQFHDW-XQH %DODQFHDW-XQH )<&DSLWDO$VVHW5ROOIRUZDUG ,QFUHDVHV 'HFUHDVHV &DSLWDO$VVHWV%HLQJ'HSUHFLDWHG 9HKLFOHV &RPSXWHUV /HDVHKROG,PSURYHPHQWV 0RQLWRULQJ(TXLSPHQW 7RWDO&DSLWDO$VVHWV%HLQJ'HSUHFLDWHG /HVVDFFXPXODWHGGHSUHFLDWLRQIRU 9HKLFOHV &RPSXWHUV /HDVHKROG,PSURYHPHQWV 0RQLWRULQJ(TXLSPHQW 7RWDO$FFXPXODWHG'HSUHFLDWLRQ 7RWDO&DSLWDO$VVHWV%HLQJ'HSUHFLDWHG1HW 7RWDOVPD\QRWDGGGXHWRURXQGLQJ 127(±$&&281763$<$%/( 7KHDFFRXQWVSD\DEOHEDODQFHDWILVFDO\HDUHQGZDVDLQFUHDVHIURPWKHSULRU\HDU 7KHRYHUDOOLQFUHDVHZDVSULPDULO\GXHWRLQFUHDVHGOHJDOH[SHQVHSD\DEOHVDWWKHHQGRI7KLVLVDOVR WKHUHDVRQWKDWWKHSHUFHQWDJHRIFXUUHQWSD\DEOHVLQFUHDVHGIURP)< WR)< 7DEOH1RWH $FFRXQWV3D\DEOH5ROOIRUZDUG -XO\ WR-XQH %HJLQQLQJ (QGLQJ %DODQFH-XO\ %DODQFH-XQH $GGLWLRQV 0RGLILFDWLRQV 3D\PHQWV $FFRXQWV3D\DEOH $FFRXQWV3D\DEOH$JLQJ )< )< &XUUHQW WR'D\V3DVW'XH 2YHU'D\V3DVW'XH 7RWDO$FFRXQWV3D\DEOH &XUUHQW 7RWDOVPD\QRWDGGGXHWRURXQGLQJ 127(3(16,213/$16 )RUSXUSRVHVRIPHDVXULQJWKHQHWSHQVLRQOLDELOLW\RUDVVHWGHIHUUHGRXWIORZVRIUHVRXUFHVDQG GHIHUUHGLQIORZVRIUHVRXUFHVUHODWHGWRSHQVLRQVDQGSHQVLRQH[SHQVHLQIRUPDWLRQDERXWWKH ILGXFLDU\QHWSRVLWLRQRIDOOVWDWHVSRQVRUHGSHQVLRQSODQVDQGDGGLWLRQVWRGHGXFWLRQVIURPWKRVH SODQV¶ILGXFLDU\QHWSRVLWLRQKDYHEHHQGHWHUPLQHGRQWKHVDPHEDVLVDVWKH\DUHUHSRUWHGE\WKH :DVKLQJWRQ6WDWH'HSDUWPHQWRI5HWLUHPHQW6\VWHPV)RUWKLVSXUSRVHEHQHILWSD\PHQWV LQFOXGLQJ UHIXQGVRIHPSOR\HHFRQWULEXWLRQV DUHUHFRJQL]HGZKHQGXHDQGSD\DEOHLQDFFRUGDQFHZLWKWKH EHQHILWWHUPV,QYHVWPHQWVDUHUHSRUWHGDWIDLUYDOXH 7KHIROORZLQJWDEOHUHSUHVHQWVWKH$JHQF\¶VDJJUHJDWHSHQVLRQDPRXQWVIRUDOOSODQVVXEMHFWWRWKH UHTXLUHPHQWVRI*$6%IRUWKH\HDU Page 47 of 85 $JHQF\3HQVLRQ$PRXQWV$OO3ODQV -XQH 3HQVLRQ/LDELOLWLHV 'HIHUUHGRXWIORZRIUHVRXUFHV 'HIHUUHGLQIORZVRIUHVRXUFHV 3HQVLRQH[SHQVHH[SHQGLWXUHV 6WDWH6SRQVRUHG3HQVLRQ3ODQV 6XEVWDQWLDOO\DOO$JHQF\IXOOWLPHDQGTXDOLI\LQJSDUWWLPHHPSOR\HHVSDUWLFLSDWHLQRQHRIWKHIROORZLQJ VWDWHZLGHUHWLUHPHQWV\VWHPVDGPLQLVWHUHGE\WKH:DVKLQJWRQ6WDWH'HSDUWPHQWRI5HWLUHPHQW6\VWHPV XQGHUFRVWVKDULQJPXOWLSOHHPSOR\HUSXEOLFHPSOR\HHGHILQHGEHQHILWDQGGHILQHGFRQWULEXWLRQUHWLUHPHQW SODQV7KHVWDWH/HJLVODWXUHHVWDEOLVKHVDQGDPHQGVODZVSHUWDLQLQJWRWKHFUHDWLRQDQGDGPLQLVWUDWLRQRIDOO SXEOLFUHWLUHPHQWV\VWHPV 7KH'HSDUWPHQWRI5HWLUHPHQW6\VWHPV '56 DGHSDUWPHQWZLWKLQWKHSULPDU\JRYHUQPHQWRIWKH6WDWHRI :DVKLQJWRQLVVXHVDSXEOLFO\DYDLODEOHFRPSUHKHQVLYHDQQXDOILQDQFLDOUHSRUW &$)5 WKDWLQFOXGHVILQDQFLDO VWDWHPHQWVDQGUHTXLUHGVXSSOHPHQWDU\LQIRUPDWLRQIRUHDFKSODQ7KH'56&$)5PD\EHREWDLQHGE\ ZULWLQJWR 'HSDUWPHQWRI5HWLUHPHQW6\VWHPV &RPPXQLFDWLRQV8QLW 32%R[ 2O\PSLD:$ 2UWKH'56&$)5PD\EHGRZQORDGHGIURPWKH'56ZHEVLWHDWZZZGUVZDJRY 3XEOLF(PSOR\HHV¶5HWLUHPHQW6\VWHP 3(56 3(56PHPEHUVLQFOXGHHOHFWHGRIILFLDOV VWDWHHPSOR\HHV HPSOR\HHVRIWKH6XSUHPH$SSHDOVDQG6XSHULRU &RXUWV HPSOR\HHVRIWKHOHJLVODWXUH HPSOR\HHVRIGLVWULFWDQGPXQLFLSDOFRXUWV HPSOR\HHVRIORFDO JRYHUQPHQWV DQGKLJKHUHGXFDWLRQHPSOR\HHVQRWSDUWLFLSDWLQJLQKLJKHUHGXFDWLRQUHWLUHPHQWSURJUDPV 3(56LVFRPSULVHGRIWKUHHVHSDUDWHSHQVLRQSODQVIRUPHPEHUVKLSSXUSRVHV3(56SODQVDQGDUH GHILQHGEHQHILWSODQVDQG3(56SODQLVDGHILQHGEHQHILWSODQZLWKDGHILQHGFRQWULEXWLRQFRPSRQHQW 3(563ODQSURYLGHVUHWLUHPHQWGLVDELOLW\DQGGHDWKEHQHILWV5HWLUHPHQWEHQHILWVDUHGHWHUPLQHGDVWZR SHUFHQWRIWKHPHPEHU¶VDYHUDJHILQDOFRPSHQVDWLRQ $)& WLPHVWKHPHPEHU¶V\HDUVRIVHUYLFH7KH$)&LV WKHDYHUDJHRIWKHPHPEHU¶VKLJKHVWFRQVHFXWLYHVHUYLFHPRQWKV0HPEHUVDUHHOLJLEOHIRUUHWLUHPHQW IURPDFWLYHVWDWXVDWDQ\DJHZLWKDWOHDVW\HDUVRIVHUYLFHDWDJHZLWKDWOHDVW\HDUVRIVHUYLFHRUDW DJHZLWKDWOHDVWILYH\HDUVRIVHUYLFH0HPEHUVUHWLULQJIURPDFWLYHVWDWXVSULRUWRWKHDJHRIPD\ UHFHLYHDFWXDULDOO\UHGXFHGEHQHILWV5HWLUHPHQWEHQHILWVDUHDFWXDULDOO\UHGXFHGWRUHIOHFWWKHFKRLFHRID VXUYLYRUEHQHILW2WKHUEHQHILWVLQFOXGHGXW\DQGQRQGXW\GLVDELOLW\SD\PHQWVDQRSWLRQDOFRVWRIOLYLQJ DGMXVWPHQW &2/$ DQGDRQHWLPHGXW\UHODWHGGHDWKEHQHILWLIIRXQGHOLJLEOHE\WKH'HSDUWPHQWRI/DERU DQG,QGXVWULHV3(56PHPEHUVZHUHYHVWHGDIWHUWKHFRPSOHWLRQRIILYH\HDUVRIHOLJLEOHVHUYLFH7KHSODQ ZDVFORVHGWRQHZHQWUDQWVRQ6HSWHPEHU &RQWULEXWLRQV 7KH3(563ODQPHPEHUFRQWULEXWLRQUDWHLVHVWDEOLVKHGE\6WDWHVWDWXWHDWSHUFHQW7KHHPSOR\HU FRQWULEXWLRQUDWHLVGHYHORSHGE\WKH2IILFHRIWKH6WDWH$FWXDU\DQGLQFOXGHVDQDGPLQLVWUDWLYHH[SHQVH FRPSRQHQWWKDWLVFXUUHQWO\VHWDWSHUFHQW(DFKELHQQLXPWKHVWDWH3HQVLRQ)XQGLQJ&RXQFLODGRSWV 3ODQHPSOR\HUFRQWULEXWLRQUDWHV7KH3(563ODQUHTXLUHGFRQWULEXWLRQUDWHV H[SUHVVHGDVDSHUFHQWDJH RIFRYHUHGSD\UROO IRUZHUHDVIROORZV Page 48 of 85 3(563ODQ $FWXDO&RQWULEXWLRQ5DWHV (PSOR\HU (PSOR\HH -DQXDU\±$XJXVW 3(563ODQ 3(563ODQ8$$/ $GPLQLVWUDWLYH)HH 7RWDO 6HSWHPEHU±'HFHPEHU 3(563ODQ 3(563ODQ8$$/ $GPLQLVWUDWLYH)HH 7RWDO 3(563ODQSURYLGHVUHWLUHPHQWGLVDELOLW\DQGGHDWKEHQHILWV5HWLUHPHQWEHQHILWVDUHGHWHUPLQHGDVWZR SHUFHQWRIWKHPHPEHU¶VDYHUDJHILQDOFRPSHQVDWLRQ $)& WLPHVWKHPHPEHU¶V\HDUVRIVHUYLFHIRU3ODQ DQGSHUFHQWRI$)&IRU3ODQ7KH$)&LVWKHDYHUDJHRIWKHPHPEHU¶VKLJKHVWSDLGFRQVHFXWLYH VHUYLFHPRQWKV7KHUHLVQRFDSRQ\HDUVRIVHUYLFHFUHGLW0HPEHUVDUHHOLJLEOHIRUUHWLUHPHQWZLWKDIXOO EHQHILWDWZLWKDWOHDVWILYH\HDUVRIVHUYLFHFUHGLW5HWLUHPHQWEHIRUHDJHLVFRQVLGHUHGDQHDUO\ UHWLUHPHQW3(563ODQPHPEHUVZKRKDYHDWOHDVW\HDUVRIVHUYLFHFUHGLWDQGDUH\HDUVRIDJHRU ROGHUDUHHOLJLEOHIRUHDUO\UHWLUHPHQWZLWKDEHQHILWWKDWLVUHGXFHGE\DIDFWRUWKDWYDULHVDFFRUGLQJWRDJHIRU HDFK\HDUEHIRUHDJH3(563ODQPHPEHUVZKRKDYHRUPRUH\HDUVRIVHUYLFHFUHGLWDQGDUHDW OHDVW\HDUVROGFDQUHWLUHXQGHURQHRIWZRSURYLVLRQV x :LWKDEHQHILWWKDWLVUHGXFHGE\WKUHHSHUFHQWIRUHDFK\HDUEHIRUHDJH RU x :LWKDEHQHILWWKDWKDVDVPDOOHU RUQR UHGXFWLRQ GHSHQGLQJRQDJH WKDWLPSRVHVVWULFWHUUHWXUQWR ZRUNUXOHV 3(563ODQPHPEHUVKLUHGRQRUDIWHU0D\KDYHWKHRSWLRQWRUHWLUHHDUO\E\DFFHSWLQJDUHGXFWLRQ RIILYHSHUFHQWIRUHDFK\HDURIUHWLUHPHQWEHIRUHDJH7KLVRSWLRQLVDYDLODEOHRQO\WRWKRVHZKRDUHDJH RUROGHUDQGKDYHDWOHDVW\HDUVRIVHUYLFHFUHGLW3(563ODQUHWLUHPHQWEHQHILWVDUHDOVR DFWXDULDOO\UHGXFHGWRUHIOHFWWKHFKRLFHRIDVXUYLYRUEHQHILW2WKHU3(563ODQEHQHILWVLQFOXGHGXW\DQG QRQGXW\GLVDELOLW\SD\PHQWVDFRVWRIOLYLQJDOORZDQFH EDVHGRQWKH&3, FDSSHGDWWKUHHSHUFHQWDQQXDOO\ DQGDRQHWLPHGXW\UHODWHGGHDWKEHQHILWLIIRXQGHOLJLEOHE\WKH'HSDUWPHQWRI/DERUDQG,QGXVWULHV3(56 PHPEHUVDUHYHVWHGDIWHUFRPSOHWLQJILYH\HDUVRIHOLJLEOHVHUYLFH3ODQPHPEHUVDUHYHVWHGLQWKH GHILQHGEHQHILWSRUWLRQRIWKHLUSODQDIWHUWHQ\HDUVRIVHUYLFH RUDIWHUILYH\HDUVRIVHUYLFHLIPRQWKVRIWKDW VHUYLFHDUHHDUQHGDIWHUDJH 3(563ODQGHILQHGFRQWULEXWLRQEHQHILWVDUHWRWDOO\GHSHQGHQWRQHPSOR\HHFRQWULEXWLRQVDQGLQYHVWPHQW HDUQLQJVRQWKRVHFRQWULEXWLRQV3(563ODQPHPEHUVFKRRVHWKHLUFRQWULEXWLRQUDWHXSRQMRLQLQJ PHPEHUVKLSDQGKDYHDFKDQFHWRFKDQJHUDWHVXSRQFKDQJLQJHPSOR\HUV$VHVWDEOLVKHGE\VWDWXWH3ODQ UHTXLUHGGHILQHGFRQWULEXWLRQUDWHVDUHVHWDWDPLQLPXPRISHUFHQWDQGHVFDODWHWRSHUFHQWZLWKDFKRLFH RIVL[RSWLRQV(PSOR\HUVGRQRWFRQWULEXWHWRWKHGHILQHGFRQWULEXWLRQEHQHILWV3(563ODQPHPEHUVDUH LPPHGLDWHO\YHVWHGLQWKHGHILQHGFRQWULEXWLRQSRUWLRQRIWKHLUSODQ &RQWULEXWLRQV 7KH3(563ODQHPSOR\HUDQGHPSOR\HHFRQWULEXWLRQUDWHVDUHGHYHORSHGE\WKH2IILFHRIWKH6WDWH $FWXDU\WRIXOO\IXQG3ODQDQGWKHGHILQHGEHQHILWSRUWLRQRI3ODQ7KH3ODQHPSOR\HUUDWHVLQFOXGHD FRPSRQHQWWRDGGUHVVWKH3(563ODQ8$$/DQGDQDGPLQLVWUDWLYHH[SHQVHWKDWLVFXUUHQWO\VHWDW SHUFHQW(DFKELHQQLXPWKHVWDWH3HQVLRQ)XQGLQJ&RXQFLODGRSWV3ODQHPSOR\HUDQGHPSOR\HH FRQWULEXWLRQUDWHVDQG3ODQFRQWULEXWLRQUDWHV7KH3(563ODQUHTXLUHGFRQWULEXWLRQUDWHV H[SUHVVHG DVDSHUFHQWDJHRIFRYHUHGSD\UROOV IRU ZHUHDVIROORZV Page 49 of 85 3(563ODQ $FWXDO&RQWULEXWLRQ5DWHV (PSOR\HU (PSOR\HH -DQXDU\±$XJXVW 3(563ODQ 3(563ODQ8$$/ $GPLQLVWUDWLYH)HH (PSOR\HH3(563ODQ 9DULHV 7RWDO 6HSWHPEHU±'HFHPEHU 3(563ODQ 3(563ODQ8$$/ $GPLQLVWUDWLYH)HH (PSOR\HH3(563ODQ 9DULHV 7RWDO 7KH$JHQF\¶VDFWXDO3(56SODQFRQWULEXWLRQVZHUH WR3(563ODQDQGWR3(563ODQ IRUWKH\HDUHQGHG-XQH $FWXDULDO$VVXPSWLRQV 7KHWRWDOSHQVLRQOLDELOLW\ 73/ IRUHDFKRIWKH'56SODQVZDVGHWHUPLQHGXVLQJWKHPRVWUHFHQWDFWXDULDO YDOXDWLRQFRPSOHWHGLQZLWKDYDOXDWLRQGDWHRI-XQH 7KHDFWXDULDODVVXPSWLRQVXVHGLQWKH YDOXDWLRQZHUHEDVHGRQWKHUHVXOWVRIWKH2IILFHRIWKH6WDWH$FWXDU\¶V 26$ ([SHULHQFH6WXG\ DQGWKH (FRQRPLF([SHULHQFH6WXG\ $GGLWLRQDODVVXPSWLRQVIRUVXEVHTXHQWHYHQWVDQGODZFKDQJHVDUHFXUUHQWDVRIWKH DFWXDULDOYDOXDWLRQ UHSRUW7KH73/ZDVFDOFXODWHGDVRIWKHYDOXDWLRQGDWHDQGUROOHGIRUZDUGWRWKHPHDVXUHPHQWGDWHRI-XQH 3ODQOLDELOLWLHVZHUHUROOHGIRUZDUGIURP-XQH WR-XQHUHIOHFWLQJHDFKSODQ¶V QRUPDOFRVW XVLQJWKHHQWU\DJHFRVWPHWKRG DVVXPHGLQWHUHVWDQGDFWXDOEHQHILWSD\PHQWV x ,QIODWLRQ WRWDOHFRQRPLFLQIODWLRQ VDODU\LQIODWLRQ x 6DODU\LQFUHDVHV ,QDGGLWLRQWRWKHEDVHVDODU\LQIODWLRQDVVXPSWLRQVDODULHVDUHDOVR H[SHFWHGWRJURZE\SURPRWLRQVDQGORQJHYLW\ x ,QYHVWPHQWUDWHRIUHWXUQ x 0RUWDOLW\UDWHVZHUHGHYHORSHGXVLQJWKH6RFLHW\RI$FWXDULHV¶3XE+PRUWDOLW\UDWHVZKLFKYDU\ E\PHPEHUVWDWXVDVWKHEDVHWDEOH7KH26$DSSOLHGDJHRIIVHWVIRUHDFKV\VWHPDVDSSURSULDWHWR EHWWHUWDLORUWKHPRUWDOLW\UDWHVWRWKHGHPRJUDSKLFVRIHDFKSODQ26$DSSOLHGWKHORQJWHUP03 JHQHUDWLRQDOLPSURYHPHQWVFDOHDOVRGHYHORSHGE\WKH6RFLHW\$FWXDULHVWRSURMHFWPRUWDOLW\UDWHVIRU HYHU\\HDUDIWHUWKHEDVHWDEOH0RUWDOLW\UDWHVDUHDSSOLHGRQDJHQHUDWLRQDOEDVLV PHDQLQJHDFK PHPEHULVDVVXPHGWRUHFHLYHDGGLWLRQDOPRUWDOLW\LPSURYHPHQWVLQHDFKIXWXUH\HDUWKURXJKRXWKLVRU KHUOLIHWLPH 7KHUHZHUHFKDQJHVLQPHWKRGVDQGDVVXPSWLRQVVLQFHWKHODVWYDOXDWLRQ x 26$ XSGDWHG LWV GHPRJUDSKLF DVVXPSWLRQV EDVHG RQ WKH UHVXOWV RI LWV ODWHVW GHPRJUDSKLF H[SHULHQFHVWXG\6HH26$¶V'HPRJUDSKLF([SHULHQFH6WXG\DWOHJZDJRYRVD x 26$XSGDWHGWKH(DUO\5HWLUHPHQW)DFWRUVDQG-RLQWDQG6XUYLYRUIDFWRUVXVHGLQLWVPRGHOWR PDWFK WKH RQHV LPSOHPHQWHG E\ '56 RQ 2FWREHU 7KHVH IDFWRUV DUH XVHG WR YDOXH Page 50 of 85 EHQHILWV IRU PHPEHUV ZKR HOHFW WR UHWLUH HDUO\ DQG IRU VXUYLYRUV RI PHPEHUV WKDW GLH SULRU WR UHWLUHPHQW x 7KH YDOXDWLRQ LQFOXGHV OLDELOLWLHV DQG DVVHWV IRU 3ODQ PHPEHUV SXUFKDVLQJ 7RWDO $OORFDWLRQ 3RUWIROLRDQQXLWLHVZKHQGHWHUPLQLQJFRQWULEXWLRQUDWHVDQGIXQGHGVWDWXV x 26$VLPSOLILHGLWVPRGHOLQJRIPHGLFDOSUHPLXPUHLPEXUVHPHQWVIRUVXUYLYRUVRIGXW\UHODWHG GHDWKVLQ/(2)) x 26$ FKDQJHG LWV PHWKRG RI XSGDWLQJ FHUWDLQ GDWD LWHPV WKDW FKDQJH DQQXDOO\ LQFOXGLQJ WKH SXEOLFVDIHW\GXW\UHODWHGGHDWKOXPSVXPDQG:DVKLQJWRQVWDWHDYHUDJHZDJH26$VHWWKHVH YDOXHV DW DQG ZLOO SURMHFW WKHP LQWR WKH IXWXUH XVLQJ DVVXPSWLRQV XQWLO WKH QH[W 'HPRJUDSKLF ([SHULHQFH 6WXG\ LQ 6HH OHJZDJRYRVD IRU PRUH LQIRUPDWLRQ RQ WKLV PHWKRGFKDQJH 'LVFRXQW5DWH 7KHGLVFRXQWUDWHXVHGWRPHDVXUHWKHWRWDOSHQVLRQOLDELOLW\IRUDOO'56SODQVZDVSHUFHQW 7RGHWHUPLQHWKDWUDWHDQDVVHWVXIILFLHQF\WHVWZDVFRPSOHWHGWRWHVWZKHWKHUHDFKSHQVLRQSODQ¶VILGXFLDU\ QHWSRVLWLRQZDVVXIILFLHQWWRPDNHDOOSURMHFWHGIXWXUHEHQHILWSD\PHQWVIRUFXUUHQWSODQPHPEHUV%DVHGRQ 26$¶V DVVXPSWLRQV WKH SHQVLRQ SODQV¶ ILGXFLDU\ QHW SRVLWLRQ ZDV SURMHFWHG WR EH DYDLODEOH WR PDNH DOO SURMHFWHGIXWXUHEHQHILWSD\PHQWVRIFXUUHQWSODQPHPEHUV7KHUHIRUHWKHORQJWHUPH[SHFWHGUDWHRIUHWXUQ RISHUFHQWZDVXVHGWRGHWHUPLQHWKHWRWDOOLDELOLW\ /RQJ7HUP([SHFWHG5DWHRI5HWXUQ 7KHORQJWHUPH[SHFWHGUDWHRIUHWXUQRQWKH'56SHQVLRQSODQLQYHVWPHQWVRISHUFHQWZDVGHWHUPLQHG XVLQJDEXLOGLQJEORFNPHWKRG,QVHOHFWLQJWKLVDVVXPSWLRQWKH2IILFHRIWKH6WDWH$FWXDU\ 26$ UHYLHZHG WKH KLVWRULFDO H[SHULHQFH GDWD FRQVLGHUHG WKH KLVWRULFDO FRQGLWLRQV WKDW SURGXFHG SDVW DQQXDO LQYHVWPHQW UHWXUQV DQG FRQVLGHUHG &DSLWDO 0DUNHW $VVXPSWLRQV &0$¶V DQG VLPXODWHG H[SHFWHG LQYHVWPHQW UHWXUQV SURYLGHGE\WKH:DVKLQJWRQ6WDWH,QYHVWPHQW%RDUG :6,% 7KH:6,%XVHVWKH&0$¶VDQGWKHLUWDUJHW DVVHWDOORFDWLRQWRVLPXODWHIXWXUHLQYHVWPHQWUHWXUQVDWYDULRXVIXWXUHWLPHV (VWLPDWHG5DWHVRI5HWXUQE\$VVHW&ODVV %HVW HVWLPDWHV RI DULWKPHWLF UHDOUDWHVRIUHWXUQIRU HDFK PDMRUDVVHWFODVVLQFOXGHG LQ WKH SHQVLRQ SODQ¶V WDUJHWDVVHWDOORFDWLRQDVRI-XQHDUHVXPPDUL]HGLQWKHWDEOHEHORZ7KHLQIODWLRQFRPSRQHQWXVHG WR FUHDWH WKH WDEOH LV SHUFHQW DQG UHSUHVHQWV WKH :6,%¶V PRVW UHFHQW ORQJWHUP HVWLPDWH RI EURDG HFRQRPLFLQIODWLRQ /RQJ7HUP $VVHW&ODVV 7DUJHW ([SHFWHG5HDO5DWHRI $OORFDWLRQ 5HWXUQ$ULWKPHWLF )L[HG,QFRPH 7DQJLEOH$VVHWV 5HDO(VWDWH *OREDO(TXLW\ 3ULYDWH(TXLW\ 6HQVLWLYLW\RIWKH1HW3HQVLRQ/LDELOLW\$VVHW Page 51 of 85 7KHWDEOHEHORZSUHVHQWVWKH$JHQF\¶VSURSRUWLRQDWHVKDUHRIWKHQHWSHQVLRQOLDELOLW\FDOFXODWHGXVLQJWKH GLVFRXQWUDWHRISHUFHQWDVZHOODVZKDWWKH$JHQF\¶VSURSRUWLRQDWHVKDUHRIWKHQHWSHQVLRQOLDELOLW\ ZRXOGEHLILWZHUHFDOFXODWHGXVLQJDGLVFRXQWUDWHWKDWLVSHUFHQWDJHSRLQWORZHU SHUFHQW RU SHUFHQWDJHSRLQWKLJKHU SHUFHQW WKDQWKHFXUUHQWUDWH &XUUHQW'LVFRXQW 'HFUHDVH ,QFUHDVH 6HQVLWLYLW\WR&KDQJHV 5DWH 3(56 3(56 3HQVLRQ3ODQ)LGXFLDU\1HW3RVLWLRQ 'HWDLOHGLQIRUPDWLRQDERXWWKH6WDWH¶VSHQVLRQSODQV¶ILGXFLDU\QHWSRVLWLRQLVDYDLODEOHLQWKHVHSDUDWHO\ LVVXHG'56ILQDQFLDOUHSRUW 3HQVLRQ/LDELOLWLHV $VVHWV 3HQVLRQ([SHQVHDQG'HIHUUHG2XWIORZVRI5HVRXUFHVDQG'HIHUUHG ,QIORZVRI5HVRXUFHV5HODWHGWR3HQVLRQV $W-XQHWKH$JHQF\UHSRUWHGDWRWDOSHQVLRQOLDELOLW\RIIRULWVSURSRUWLRQDWHVKDUHRIWKH QHWSHQVLRQOLDELOLWLHVDVIROORZV $JHQF\1HW3HQVLRQ/LDELOLW\ -XQH 3(56 3(56 7RWDO $W-XQHWKH$JHQF\¶VSURSRUWLRQDWHVKDUHRIWKHFROOHFWLYHQHWSHQVLRQOLDELOLWLHVZDVDVIROORZV RQO\ UHSRUWDSSOLFDEOHSODQV $JHQF\3URSRUWLRQDWH6KDUHRI 3URSRUWLRQDWH 3URSRUWLRQDWH &KDQJHLQ :DVKLQJWRQ6WDWH3HQVLRQ 6KDUH 6KDUH 3URSRUWLRQ /LDELOLW\ 3(56 3(56 8VHGIRUWKH$JHQF\ V)< ILQDQFLDOUHSRUWV 8VHGIRUWKH$JHQF\ V)<ILQDQFLDOUHSRUWV (PSOR\HUFRQWULEXWLRQWUDQVPLWWDOVUHFHLYHGDQGSURFHVVHGE\WKH'56IRUWKHILVFDO\HDUHQGHG-XQHDUH XVHGDVWKHEDVLVIRUGHWHUPLQLQJHDFKHPSOR\HU¶VSURSRUWLRQDWHVKDUHRIWKHFROOHFWLYHSHQVLRQDPRXQWV UHSRUWHGE\WKH'56LQWKH6FKHGXOHVRI(PSOR\HUDQG1RQHPSOR\HU$OORFDWLRQVIRUDOOSODQVH[FHSW/(2)) 3HQVLRQ([SHQVH )RUWKH\HDUHQGHG-XQHWKH$JHQF\UHFRJQL]HGSHQVLRQH[SHQVHDVIROORZV Page 52 of 85 $JHQF\3HQVLRQ([SHQVH -XO\WKURXJK-XQH 3(56 3(56 7RWDO 'HIHUUHG2XWIORZVRI5HVRXUFHVDQG'HIHUUHG,QIORZVRI5HVRXUFHV $W-XQHWKH$JHQF\UHSRUWHGGHIHUUHGRXWIORZVRIUHVRXUFHVDQGGHIHUUHGLQIORZVRIUHVRXUFHV UHODWHGWRSHQVLRQVIURPWKHIROORZLQJVRXUFHV -XO\ WKURXJK-XQH 3(56 'HIHUUHG2XWIORZV 'HIHUUHG,QIORZV RI5HVRXUFHV RI5HVRXUFHV 'LIIHUHQFHVEHWZHHQH[SHFWHGDQGDFWXDOH[SHULHQFH 1HWGLIIHUHQFHEHWZHHQSURMHFWHGDQGDFWXDO LQYHVWPHQWHDUQLQJVRQSHQVLRQSODQLQYHVWPHQWV &KDQJHVRIDVVXPSWLRQV &KDQJHVLQSURSRUWLRQDQGGLIIHUHQFHVEHWZHHQ FRQWULEXWLRQVDQGSURSRUWLRQDWHVKDUHRI FRQWULEXWLRQV &RQWULEXWLRQVVXEVHTXHQWWRWKHPHDVXUHPHQWGDWH 7RWDO 'HIHUUHG2XWIORZV 'HIHUUHG,QIORZV 3(56 RI5HVRXUFHV RI5HVRXUFHV 'LIIHUHQFHVEHWZHHQH[SHFWHGDQGDFWXDOH[SHULHQFH 1HWGLIIHUHQFHEHWZHHQSURMHFWHGDQGDFWXDO LQYHVWPHQWHDUQLQJVRQSHQVLRQSODQLQYHVWPHQWV &KDQJHVRIDVVXPSWLRQV &KDQJHVLQSURSRUWLRQDQGGLIIHUHQFHVEHWZHHQ FRQWULEXWLRQVDQGSURSRUWLRQDWHVKDUHRI FRQWULEXWLRQV &RQWULEXWLRQVVXEVHTXHQWWRWKHPHDVXUHPHQWGDWH 7RWDO 'HIHUUHG2XWIORZV 'HIHUUHG,QIORZV 7RWDO3ODQV RI5HVRXUFHV RI5HVRXUFHV 'LIIHUHQFHVEHWZHHQH[SHFWHGDQGDFWXDOH[SHULHQFH 1HWGLIIHUHQFHEHWZHHQSURMHFWHGDQGDFWXDO LQYHVWPHQWHDUQLQJVRQSHQVLRQSODQLQYHVWPHQWV &KDQJHVRIDVVXPSWLRQV &KDQJHVLQSURSRUWLRQDQGGLIIHUHQFHVEHWZHHQ FRQWULEXWLRQVDQGSURSRUWLRQDWHVKDUHRI FRQWULEXWLRQV &RQWULEXWLRQVVXEVHTXHQWWRWKHPHDVXUHPHQWGDWH 7RWDO Page 53 of 85 'HIHUUHGRXWIORZVRIUHVRXUFHVUHODWHGWRSHQVLRQVUHVXOWLQJIURPWKH$JHQF\¶VFRQWULEXWLRQVVXEVHTXHQWWR WKHPHDVXUHPHQWGDWHZLOOEHUHFRJQL]HGDVDUHGXFWLRQRIWKHQHWSHQVLRQOLDELOLW\LQWKH\HDUHQGHG-XQH 2WKHUDPRXQWVUHSRUWHGDVGHIHUUHGRXWIORZVDQGGHIHUUHGLQIORZVRIUHVRXUFHVUHODWHGWRSHQVLRQVZLOO EHUHFRJQL]HGLQSHQVLRQH[SHQVHDVIROORZV Page 54 of 85 ([SOLFLWPHGLFDOVXEVLG\IRUSRVWUHWLUHHVDQGVSRXVHV ,PSOLFLWPHGLFDOVXEVLG\ ,PSOLFLWGHQWDOVXEVLG\ 7KHH[SOLFLWVXEVLGLHVDUHPRQWKO\DPRXQWVSDLGSHUSRVWUHWLUHHDQGVSRXVH$VRIWKHYDOXDWLRQGDWHWKH H[SOLFLWVXEVLG\IRUSRVWUHWLUHHVDQGVSRXVHVLVWKHOHVVHURIRURIWKHPRQWKO\SUHPLXPV7KH UHWLUHHVDQGVSRXVHVFXUUHQWO\SD\WKHSUHPLXPPLQXVZKHQWKHSUHPLXPLVRYHUSHUPRQWKDQG SD\KDOIWKHSUHPLXPZKHQWKHSUHPLXPLVORZHUWKDQ 7KHLPSOLFLWPHGLFDOVXEVLG\LVWKHGLIIHUHQFHEHWZHHQWKHWRWDOFRVWRIPHGLFDOEHQHILWVDQGWKHSUHPLXPV )RUSUHUHWLUHHVDQGVSRXVHVWKHUHWLUHHSD\VWKHIXOOSUHPLXPDPRXQWEXWWKDWDPRXQWLVEDVHGRQDSRRO WKDWLQFOXGHVDFWLYHHPSOR\HHV$FWLYHHPSOR\HHVZLOOWHQGWREH\RXQJHUDQGKHDOWKLHUWKDQUHWLUHHVRQ DYHUDJHDQGWKHUHIRUHFDQEHH[SHFWHGWRKDYHORZHUDYHUDJHKHDOWKFRVWV)RUSRVWUHWLUHHVDQG VSRXVHVWKHUHWLUHHGRHVQRWSD\WKHIXOOSUHPLXPGXHWRWKHVXEVLG\GLVFXVVHGDERYH *$6%UHTXLUHVWKHSURMHFWLRQRIWKHWRWDOFRVWRIEHQHILWSD\PHQWVWREHEDVHGRQFODLPVFRVWVRUDJH DGMXVWHGSUHPLXPVDSSUR[LPDWLQJFODLPVFRVWV%HFDXVHFODLPVFRVWVDUHH[SHFWHGWRYDU\E\DJHDQGVH[ ZHKDYHXVHGFODLPVFRVWVWKDWYDU\E\DJHDQGVH[7KHSURMHFWLRQRIUHWLUHHSUHPLXPVLVEDVHGRQFXUUHQW DPRXQWVIRUWKHUHWLUHHV¶VKDUHRIWKHSUHPLXPSURMHFWHGZLWKWKHPHGLFDOWUHQGDVVXPSWLRQ 3D\DV\RXJRIXQGLQJRFFXUVZKHQDQHPSOR\HUFKRRVHVWRFRQWULEXWH SD\ IRUEHQHILWVRQO\ZKHQWKH\ RFFXURUEHFRPHGXH DIWHUUHWLUHPHQW %HIRUHWKLVFRVWZDVH[SHQVHGDVWKH$JHQF\SDLGWKHFXUUHQW \HDU VVXEVLGLHV+RZHYHUWKHXQIXQGHGOLDELOLW\ZKLFKLVWKHGLIIHUHQFHEHWZHHQZKDWWKH$JHQF\DFFUXHV DVVXPLQJRQJRLQJIXWXUHSD\PHQWV DQGZKDWWKH$JHQF\FXUUHQWO\SD\VZDVJURZLQJDQGZDVQRW DFFRXQWHGIRUXQGHUWKHSD\DV\RXJRPHWKRG7KH$JHQF\IXQGVWKHLPSOLFLWDQGH[SOLFLWVXEVLGLHVRQD SD\DV\RXJREDVLVPHDQLQJWKDWWKH$JHQF\SD\VWKHVHFRVWVDVWKH\RFFXURUEHFRPHGXH7KHUHDUHQR DVVHWVDFFXPXODWLQJLQDTXDOLI\LQJWUXVW $QQXDO23(%([SHQVHDQG7RWDO23(%/LDELOLW\ )RUWKHH[SHQVHDQG23(%OLDELOLW\UHSRUWLQJWKHYDOXDWLRQGDWHLV-XO\7KLVLVWKHGDWHDVRI ZKLFKWKHFHQVXVGDWDLVJDWKHUHGDQGWKHDFWXDULDOYDOXDWLRQLVSHUIRUPHG7KHPHDVXUHPHQWGDWHLV-XQH 7KLVLVWKHGDWHDVRIZKLFKWKHWRWDO23(%OLDELOLW\LVGHWHUPLQHG*$6%DOORZVDODJRIXSWR RQH\HDUEHWZHHQWKHPHDVXUHPHQWGDWHDQGWKHUHSRUWLQJGDWH1RDGMXVWPHQWLVUHTXLUHGEHWZHHQWKH PHDVXUHPHQWGDWHDQGWKHUHSRUWLQJGDWH7KHUHSRUWLQJGDWHLV-XQHRUWKH$JHQF\¶VILVFDO\HDU HQG7KHIROORZLQJWDEOHUHSUHVHQWVWKHDJJUHJDWH23(%DPRXQWVIRUDOOSODQVVXEMHFWWRWKHUHTXLUHPHQWVRI *$6%IRUWKHUHSRUWLQJ\HDU)< $JJUHJDWH23(%$PRXQWV$OO3ODQV 5HSRUWLQJ3HULRG -XO\ -XQH 23(%/LDELOLWLHV 23(%$VVHWV 'HIHUUHGRXWIORZVRIUHVRXFHV 'HIHUUHGLQIORZVRIUHVRXUFH 23(%([SHQVH 7KHWRWDO23(%OLDELOLW\LVDOVRUHSRUWHGDVRIWKHEHJLQQLQJRIWKHPHDVXUHPHQWSHULRG7RWDO23(%H[SHQVH IRUWKH\HDULVPDGHXSRIVHUYLFHFRVWRUWKHSRUWLRQRIWKHDFWXDULDOSUHVHQWYDOXHRIH[SHFWHGEHQHILW SD\PHQWVWKDWLVDWWULEXWHGWRWKHYDOXDWLRQ\HDULQWHUHVWRQWKHWRWDOOLDELOLW\WKHHIIHFWVRISODQFKDQJHVWKH UHFRJQLWLRQRIHFRQRPLFGHPRJUDSKLFJDLQVRUORVVHVDQGWKHUHFRJQLWLRQRIDVVXPSWLRQFKDQJHVRULQSXWV 7KHFRPSRQHQWVRI23(%H[SHQVHIRU)<DUHVKRZQEHORZ Page 55 of 85 23(%([SHQVH 5HSRUWLQJ3HULRG 0HDVXUHPHQW3HULRG -XO\ -XO\ WR-XQH -XQH 6HUYLFHFRVW ,QWHUHVWRQWRWDO23(%OLDELOLW\ (IIHFWRISODQFKDQJHV 5HFRJQLWLRQRI'HIHUUHG ,QIORZV2XWIORZVRI5HVRXUFHV 5HFRJQLWLRQRI HFRQRPLFGHPRJUDSKLFJDLQVRU ORVVHV5HFRJQLWLRQRIDVVXPSWLRQ FKDQJHVRULQSXWV 23(%([SHQVH 7KHWRWDO23(%OLDELOLW\ZDVGHWHUPLQHGE\DQDFWXDULDOYDOXDWLRQDVRIWKHYDOXDWLRQGDWHFDOFXODWHGEDVHG RQWKHGLVFRXQWUDWHVEHORZDQGWKHQSURMHFWHGWRWKHPHDVXUHPHQWGDWHV 7RWDO23(%/LDELOLW\ 5HSRUWLQJ3HULRG 0HDVXUHPHQW3HULRG -XO\ -XO\ WR-XQH -XQH 7RWDO23(%OLDELOLW\ &RYHUHGHPSOR\HHSD\UROO 7RWDO23(%OLDELOLW\DVDRI FRYHUHGHPSOR\HHSD\UROO 9DOXDWLRQGDWH-XQH 0HDVXUHPHQWGDWH-XQH 'LVFRXQW5DWH±%HJLQQLQJRI0HDVXUHPHQW Page 56 of 85 &KDQJHVLQ7RWDO23(%/LDELOLW\ 5HSRUWLQJ3HULRG -XO\ -XQH %DODQFHDW-XQH 6HUYLFHFRVW ,QWHUHVWRQWRWDO23(%OLDELOLW\ (IIHFWRISODQFKDQJHV (IIHFWRIHFRQRPLFGHPRJUDSKLF JDLQVRUORVVHV (IIHFWRIDVVXPSWLRQFKDQJHVRU LQSXWV ([SHFWHGEHQHILWSD\PHQWV %DODQFHDW-XQH (PSOR\HHV&RYHUHGE\%HQHILW7HUPV $WWKHFHQVXVGDWHRI-XO\ UHSRUWLQJGDWHRI-XQH WKHIROORZLQJHPSOR\HHVDQGUHWLUHHV ZHUHFRYHUHGE\WKHEHQHILWWHUPV (PSOR\HHV&RYHUHGE\%HQHILW7HUPV $FWLYHHPSOR\HHV 5HWLUHHV 7RWDO 6HQVLWLYLW\$QDO\VLV 7KHIROORZLQJSUHVHQWVWKHWRWDO23(%OLDELOLW\RIWKHDJHQF\DIWHUDGHFUHDVHQRGHFUHDVHDQGD LQFUHDVHLQWKHGLVFRXQWUDWHDQGKHDOWKFDUHFRVWV 6HQVLWLYLW\$QDO\VLV 'HFUHDVH &XUUHQW ,QFUHDVH 'LVFRXQW5DWH +HDOWKFDUH7UHQG )XQGHG6WDWXVDQG)XQGLQJ3URJUHVV ,QRUGHUWRIXQGWKH23(%SODQWKH$JHQF\ZRXOGKDYHWRHVWDEOLVKDQLUUHYRFDEOHWUXVWZKLFKPHDQVWKDW WKH$JHQF\ZRXOGQRORQJHUKDYHFRQWURORIWKHPRQH\SXWLQWRWKHWUXVW(YHQLIWKH$JHQF\OHIWWKH3(%% SURJUDPWKH$JHQF\ZRXOGQRWEHDEOHWRJHWWKHPRQH\RXWRIWKHWUXVW$VRI-XQHWKHSODQZDV IXQGHG6HHWKH5HTXLUHG6XSSOHPHQWDU\,QIRUPDWLRQ±23(%DIWHUWKH1RWHVVHFWLRQ $FWXDULDOYDOXDWLRQVLQYROYHHVWLPDWHVRIWKHYDOXHRIUHSRUWHGDPRXQWVDQGDVVXPSWLRQVDERXWWKHSUREDELOLW\ RIRFFXUUHQFHRIHYHQWVIDULQWRWKHIXWXUH([DPSOHVLQFOXGHDVVXPSWLRQVDERXWIXWXUHHPSOR\PHQWPRUWDOLW\ DQGWKHKHDOWKFDUHFRVWWUHQG$PRXQWVGHWHUPLQHGUHJDUGLQJWKHIXQGHGVWDWXVRIWKHSODQDQGWKHDQQXDO UHTXLUHGSD\PHQWVRIWKHHPSOR\HUDUHVXEMHFWWRFRQWLQXDOUHYLVLRQDVDFWXDOUHVXOWVDUHFRPSDUHGZLWKSDVW Page 57 of 85 H[SHFWDWLRQVDQGQHZHVWLPDWHVDUHPDGHDERXWWKHIXWXUH7KHVFKHGXOHRIIXQGLQJSURJUHVVLVSUHVHQWHGDV UHTXLUHGVXSSOHPHQWDU\LQIRUPDWLRQIROORZLQJWKHQRWHVWRWKHILQDQFLDOVWDWHPHQWV $FWXDULDO0HWKRGVDQG$VVXPSWLRQV :HXWLOL]HGWKH:DVKLQJWRQ6WDWH$FWXDU\3(%%$00RQOLQHWRROIRUHVWLPDWLQJWKH23(%H[SHQVH DQGOLDELOLW\$GGLWLRQDODVVXPSWLRQVLQFOXGH $VVXPHGRIPHPEHUVVHOHFWD803SODQDQGVHOHFWD.DLVHU3HUPDQHQWH .3 SODQ ƒ803SUHDQGSRVW0HGLFDUHFRVWVDQGSUHPLXPVDUHHTXDOWRWKH8QLIRUP0HGLFDO3ODQ 803 ƒ7KH.3SUH0HGLFDUHFRVWVDQGSUHPLXPVDUHDEOHQGRI.3&ODVVLFDQG.39DOXH ƒ7KH.3SRVW0HGLFDUHFRVWVDQGSUHPLXPVDUHHTXDOWR.30HGLFDUH (VWLPDWHGUHWLUHPHQWVHUYLFHIRUHDFKDFWLYHFRKRUWEDVHGRQWKHDYHUDJHHQWU\DJHRIZLWKDPLQLPXP VHUYLFHRI\HDU)RUH[DPSOHDQDJHPHPEHULVDVVXPHGWRKDYH\HDUVRIVHUYLFH 6HUYLFHLVDFRPSRQHQWRIEHQHILWHOLJLELOLW\ $VVXPSWLRQVIRUUHWLUHPHQWGLVDELOLW\WHUPLQDWLRQDQGPRUWDOLW\DUHEDVHGRQWKH3(%%23(%$95 ƒ$VVXPHGDOOHPSOR\HHVDUHUHWLUHPHQWHOLJLEOHDWDJH5HOLHGRQRXUUHWLUHPHQWUDWHVIRUPHPEHUVZLWK \HDUVRIVHUYLFH$VVXPHGDUDWHRIUHWLUHPHQWDWWKHDJHRI (DFKFRKRUWLVDVVXPHGWREHDPDOHIHPDOHVSOLWDQGIXUWKHUDVVXPHGWKDWHOLJLEOHVSRXVHVDUHWKH VDPHDJHDVWKHSULPDU\PHPEHU 6HOHFWHGWKHDJHEDVHGFRKRUWVIRUWKLV$002QOLQH7RROEDVHGXSRQWKHRYHUDOOGLVWULEXWLRQRI6WDWH HPSOR\HHVDQGUHWLUHHVWKDWSDUWLFLSDWHLQ3(%% 'LGQRWLQFOXGHGHQWDOEHQHILWVZKHQFDOFXODWLQJWKH7RWDO23(%/LDELOLW\'HQWDOEHQHILWVUHSUHVHQWOHVV WKDQSHUFHQWRIWKHDFFUXHGEHQHILWREOLJDWLRQVXQGHUWKH3(%%23(%$95:HZLOOFRQWLQXH WRPRQLWRUWKHLPSDFWDQGPD\FRQVLGHULQFOXGLQJGHQWDOEHQHILWVLQIXWXUHXSGDWHVRIWKHWRRO 127(±5,6.0$1$*(0(17 7KH$JHQF\VHOILQVXUHVXQHPSOR\PHQWFRPSHQVDWLRQIRUDOORILWVHPSOR\HHV$FWXDOHPSOR\HHFODLPVDUH SDLGE\WKH6WDWH'HSDUWPHQWRI(PSOR\PHQW6HFXULW\DQGWKHQUHLPEXUVHGE\WKH$JHQF\7KHDJHQF\ UHVHUYHIRUSRWHQWLDOXQHPSOR\PHQWFRPSHQVDWLRQSD\PHQWVZDV DVRI-XQH)RU)< WKH$JHQF\SDLGRXWWZRFODLPVIRUXQHPSOR\PHQWWRWDOLQJ ,QDGGLWLRQWKH$JHQF\VHOILQVXUHVIRUVKRUWWHUPGLVDELOLW\IRULWVHPSOR\HHVDQGXVHVDWKLUGSDUW\ DGPLQLVWUDWRUWRPDQDJHWKHSURJUDP,QWKHUHZHUHQRVKRUWWHUPGLVDELOLW\FODLPVSDLG7KH$JHQF\ GRHVQRWKDYHDVSHFLILFUHVHUYHVHWDVLGHIRUVKRUWWHUPGLVDELOLW\ KRZHYHUWKH$JHQF\¶VEXGJHWLQFOXGHVIXOO VDODU\DQGEHQHILWVIRUHPSOR\HHVRQVKRUWWHUPGLVDELOLW\ VKRUWWHUPGLVDELOLW\LVRIDQHPSOR\HH¶V ZDJHV )RUSURSHUW\DQGULVNOLDELOLW\FRYHUDJHWKH$JHQF\LVDPHPEHURI(QGXULVDULVNSRRORIORFDOJRYHUQPHQWV &KDSWHU5&:SURYLGHVWKHH[FOXVLYHVRXUFHRIORFDOJRYHUQPHQWHQWLW\DXWKRULW\WRLQGLYLGXDOO\RUMRLQWO\ VHOILQVXUHULVNVMRLQWO\SXUFKDVHLQVXUDQFHRUUHLQVXUDQFHDQGWRFRQWUDFWIRUULVNPDQDJHPHQWFODLPVDQG DGPLQLVWUDWLYHVHUYLFHV(QGXULVZDVIRUPHG-XO\ SXUVXDQWWRWKHSURYLVLRQVRI&KDSWHU5&: &KDSWHU:$&DQG&KDSWHU 5&: $VRI-XQH WKHUHZHUH(QGXULVPHPEHUVUHSUHVHQWLQJDEURDGDUUD\RIVSHFLDOSXUSRVHGLVWULFWV WKURXJKRXWWKHVWDWH(QGXULVSURYLGHVSURSHUW\DQGOLDELOLW\FRYHUDJHDVZHOODVULVNPDQDJHPHQWVHUYLFHV DQGRWKHUUHODWHGDGPLQLVWUDWLYHVHUYLFHV Page 58 of 85 0HPEHUVPDNHDQDQQXDOFRQWULEXWLRQWRIXQG(QGXULVDQGVKDUHLQWKHVHOILQVXUHGUHWHQWLRQRIWKHMRLQWO\ SXUFKDVHGH[FHVVDQGRUUHLQVXUDQFHFRYHUDJH7KHVHOILQVXUHGUHWHQWLRQLV x GHGXFWLEOHRQOLDELOLW\ORVVWKHPHPEHULVUHVSRQVLEOHIRUWKHILUVWRIWKH GHGXFWLEOHDPRXQWRIHDFKFODLPZKLOH(QGXULVLVUHVSRQVLEOHIRUWKHUHPDLQLQJ RQDOLDELOLW\ ORVV x GHGXFWLEOHRQSURSHUW\ORVVWKHPHPEHULVUHVSRQVLEOHIRUWKHILUVWRIWKHGHGXFWLEOH DPRXQWRIHDFKFODLPZKLOH(QGXULVLVUHVSRQVLEOHIRUWKHUHPDLQLQJ RQDSURSHUW\ORVV x (QGXULVLVUHVSRQVLEOHIRUWKHGHGXFWLEOHRQERLOHUDQGPDFKLQHU\ORVV (QGXULVDFTXLUHVUHLQVXUDQFHIURPXQUHODWHGLQVXUDQFHFRPSDQLHVRQD³SHURFFXUUHQFH´EDVLVWRFRYHUDOO ORVVHVRYHUWKHGHGXFWLEOHVDVVKRZQRQWKHSROLF\PD[LPXPOLPLWV/LDELOLW\FRYHUDJHLVIRUDOOOLQHVRI OLDELOLW\FRYHUDJHLQFOXGLQJ3XEOLF2IILFLDO¶V/LDELOLW\7KH3URSHUW\FRYHUDJHLVZULWWHQRQDQ³DOOULVN´EODQNHW EDVLVXVLQJFXUUHQW6WDWHPHQWRI9DOXHV7KH3URSHUW\FRYHUDJHLQFOXGHVEXWLVQRWOLPLWHGWRPRELOH HTXLSPHQWERLOHUDQGPDFKLQHU\HOHFWURQLFGDWDSURFHVVLQJHTXLSPHQWEXVLQHVVLQWHUUXSWLRQFRXUVHRI FRQVWUXFWLRQDQGDGGLWLRQVSURSHUW\LQWUDQVLWILQHDUWVDQGDXWRPRELOHSK\VLFDOGDPDJHWRLQVXUHGYHKLFOHV /LDELOLW\FRYHUDJHOLPLWLVPLOOLRQSHURFFXUUHQFHDQGSURSHUW\FRYHUDJHOLPLWLVELOOLRQSHURFFXUUHQFH (QGXULVRIIHUVFULPHFRYHUDJHXSWRDOLPLWRIPLOOLRQSHURFFXUUHQFH 6LQFH(QGXULVLVDFRRSHUDWLYHSURJUDPWKHUHLVDMRLQWOLDELOLW\DPRQJWKHSDUWLFLSDWLQJPHPEHUV7KH FRQWUDFWUHTXLUHVPHPEHUVWRFRQWLQXHPHPEHUVKLSIRUDSHULRGRIQRWOHVVWKDQRQH \HDUDQGPXVWJLYH QRWLFHGD\VEHIRUHWHUPLQDWLQJSDUWLFLSDWLRQ7KH0DVWHU$JUHHPHQW ,QWHUJRYHUQPHQWDO&RQWUDFW LV DXWRPDWLFDOO\UHQHZHGDIWHUWKHLQLWLDORQH IXOOILVFDO\HDUFRPPLWPHQW(YHQDIWHUWHUPLQDWLRQDPHPEHU LVVWLOOUHVSRQVLEOHIRUFRQWULEXWLRQWR(QGXULVIRUDQ\XQUHVROYHGXQUHSRUWHGDQGLQSURFHVVFODLPVIRUWKH SHULRGWKH\ZHUHDVLJQDWRU\WRWKH0DVWHU$JUHHPHQW(QGXULVLVIXOO\IXQGHGE\LWVPHPEHUSDUWLFLSDQWV &ODLPVDUHILOHGE\PHPEHUVZLWK(QGXULVDQGDUHDGPLQLVWHUHGLQKRXVH,QWKHSDVW\HDUFODLPVKDYHQRW H[FHHGHGLQVXUDQFHFRYHUDJH$%RDUGRI'LUHFWRUVFRQVLVWLQJRIVHYHQ ERDUGPHPEHUVJRYHUQV(QGXULV ,WVPHPEHUVHOHFWWKH%RDUGDQGWKHSRVLWLRQVDUHILOOHGRQDURWDWLQJEDVLV7KH%RDUGPHHWVTXDUWHUO\DQGLV UHVSRQVLEOHIRUFRQGXFWLQJWKHEXVLQHVVDIIDLUVRI(QGXULV ,Q)<WKHUHZHUHLQLQVXUDQFHFODLPVSDLGRXWRUILOHG 7DEOH 5LVNDQGSURSHUW\LQVXUDQFH SUHPLXPVSDLGLQ)<ZHUH ,QVXUDQFHVHWWOHPHQWVKDYHEHHQOHVVWKDQLQVXUDQFHSUHPLXPVLQ HDFKRIWKHODVWWKUHH\HDUV 7DEOH1RWH /ŶƐƵƌĂŶĐĞůĂŝŵƐWĂŝĚKƵƚ &ODLPV3DLGWR &ODLPV3DLGWR7KLUG )<,QVXUDQFH&ODLPV $JHQF\ 3DUWLHV 7RWDO $XWR3K\VLFDO'DPDJH *HQHUDO/LDELOLW\ 7RWDO 127( &203/,$1&($1'(1)25&(0(17$*(1&< 7KH$JHQF\LVDFRPSOLDQFHDQGHQIRUFHPHQWDJHQF\ZLWKYDULRXVFDVHVSHQGLQJEHIRUHDQDGPLQLVWUDWLYH WULEXQDOHQWLWOHGWKH3ROOXWLRQ&RQWURO+HDULQJV%RDUG ³3&+%´ LQYROYLQJWKHHQIRUFHPHQWRIWKH:DVKLQJWRQ 6WDWH&OHDQ$LU$FWDQGWKHUHJXODWLRQVRIWKH$JHQF\7KHVHFDVHVDUHQRWFDXVHVRIDFWLRQDJDLQVWWKH $JHQF\EXWDUHHQIRUFHPHQWDFWLRQV$SSHDOVRIGHFLVLRQVE\WKH3&+%FDQSURFHHGLIILOHGLQVXSHULRU FRXUWZLWKVXEVHTXHQWDSSHDOVWRWKHDSSHOODWHFRXUWVLQWKH6WDWHRI:DVKLQJWRQ7KH$JHQF\DOVR VRPHWLPHVVHHNVWKHSD\PHQWRIXQSDLGFLYLOSHQDOWLHVLQVXSHULRUFRXUW$OLVWLQJRIWKHRSHQDQGFORVHG FDVHVLVDYDLODEOHIURPWKH$JHQF\ VOHJDOGHSDUWPHQW 127(±/($6(6 7KH$JHQF\LVFRPPLWWHGXQGHUYDULRXVOHDVHVIRUDWRWDORI EH\RQG-XQH$OORIWKHVH OHDVHV DUH FRQVLGHUHG RSHUDWLQJ OHDVHV IRU DFFRXQWLQJ SXUSRVHV 7RWDO OHDVH H[SHQVHV IRU WKH \HDU HQGHG -XQHDPRXQWHGWR Page 59 of 85 3URSHUW\/HDVHV 7KH$JHQF\KDVRQHRIILFHORFDWLRQ 7KLUG$YHQXH6XLWH6HDWWOH:$ ZKLFKLWOHDVHVXQGHU DQRQFDQFHOODEOHRSHUDWLQJOHDVH,QDGGLWLRQWRWKHVFKHGXOHGOHDVHREOLJDWLRQVVKRZQLQWKHWDEOHEHORZ WKHOHDVHLQFOXGHVHVFDODWLRQSURYLVLRQVIRUDGGLWLRQDOUHQWDGMXVWPHQWVEDVHGRQWKHMDQLWRULDOKRXUO\ODERU UDWHVWKH&RQVXPHU3ULFH,QGH[WKHFRVWRIHOHFWULFLW\DQGDQQXDOLQFUHDVHVLQSURSHUW\WD[HV7KHUHQW DGMXVWPHQWVDUHUHYLVHGRQFHSHU\HDUEDVHGRQWKHFKDQJHLQWKLVGDWDIURPWKHEDVH\HDURIIRUWKH SHULRGXSWKURXJK-DQXDU\)XWXUHPLQLPXPUHQWDOFRPPLWPHQWVH[FOXGLQJHVFDODWLRQSURYLVLRQV DUHDVIROORZV /HVVRU 7LPH3HULRG $PRXQW &OLVH3URSHUWLHV,QF0DLQRIILFH OHDVH 7RWDO ,QDGGLWLRQWRWKHRIILFHVSDFHWKH$JHQF\OHDVHVVWRUDJHVSDFHLQWKHVDPHEXLOGLQJORFDWLRQDQGIURPWKH VDPHOHVVRU7KHUHPDLQLQJDPRXQWRQWKLVSRUWLRQRIWKHOHDVHLV IRUWKHSHULRGIURP-XO\ WKURXJK-DQXDU\ /HVVRU 7LPH3HULRG $PRXQW &OLVH3URSHUWLHV,QF6WRUDJH6SDFHV 7RWDO 7KH$JHQF\OHDVHVDGGLWLRQDOSURSHUW\ZLWKLQLWVIRXUFRXQW\MXULVGLFWLRQIRULWVDLUTXDOLW\GDWDFROOHFWLRQ PRQLWRULQJVLWHVDQGWKHFRPSRQHQWVRIWKHIXWXUHFRPPLWPHQWVRIDUHVKRZQEHORZ /HVVRU 7LPH3HULRG $PRXQW $XEXUQ6FKRRO'LVWULFW &LW\RI/DNH)RUHVW3DUN0RQLWRULQJ 6LWH 0DU\VYLOOH6FKRRO'LVWULFW0RQLWRULQJ 6LWH *HQHUDO6HUYLFHV$GPLQLVWUDWLRQ 0RQLWRULQJ6LWH 3XJHW6RXQG(QHUJ\0RQLWRULQJ6LWH 7DFRPD&DPERGLDQ(YDQJHOLFDO&KXUFK 0RQLWRULQJ6LWH 7RWDO (TXLSPHQW/HDVHV 7KH$JHQF\OHDVHVRIILFHHTXLSPHQW FRSLHUVSRVWDJHPDFKLQH XQGHUWKHRSHUDWLQJOHDVHV)XWXUH FRPPLWPHQWVDUHOLVWHGEHORZ /HVVRU(TXLSPHQW 7LPH3HULRG $PRXQW 3DFLILF$XWRPDWLRQ86%DQN 1HRSRVW0DLO)LQDQFH 7RWDO Page 60 of 85 127(±&+$1*(6,1/21*7(50/,$%,/,7,(6 $W-XQHORQJWHUPOLDELOLWLHVGHFUHDVHG IURPWKHSULRU\HDUSULPDULO\GXHWRWKHUHGXFWLRQLQ WKHQHWSHQVLRQOLDELOLW\DVDUHVXOWRIWKHGHFUHDVHLQWKHVWDWHHVWLPDWHGQHWSHQVLRQOLDELOLW\FRPELQHGZLWKD UHGXFWLRQLQWKH$JHQF\¶VSRUWLRQRIWKDWOLDELOLW\ $WWKHHQGRIHDFKILVFDO\HDUWKH$JHQF\DOORFDWHVWKHWRWDOFRPSHQVDWHGDEVHQFHVOLDELOLW\EHWZHHQFXUUHQW DQGQRQFXUUHQWOLDELOLWLHVEDVHGRQDUHYLHZRIWKHDYHUDJHHPSOR\HHXVDJHDQGFDVKRXWRIYDFDWLRQVLFN DQG FRPSHQVDWRU\ WLPH XVLQJ D WKUHH\HDU UROOLQJ DYHUDJH 7KH QRQFXUUHQW SRUWLRQ RI FRPSHQVDWHG DEVHQFHVLQFUHDVHGDVDUHVXOWRIWKHLQFUHDVHLQHDUQHGXQXVHGSDLG OHDYH HPSOR\HHVXVHG OHVV SDLGOHDYHWKDQHDUQHG 7DEOH1RWH /RQJ7HUP/LDELOLW\5ROOIRUZDUG &XUUHQW %HJLQQLQJ (QGLQJ%DODQFH 3RUWLRQ'XH %DODQFH $GGLWLRQV 5HGXFWLRQV :LWKLQ2QH Page 61 of 85 REQUIRED SUPPLEMENTARY INFORMATION - State Sponsored Plans Puget Sound Clean Air Agency Schedule of Proportionate Share of the Net Pension Liability PERS Plan 1 As of June 30, 2020 (reporting date) Last 10 Fiscal Years* Reporting Date 2020 2019 2018 2017 2016 2015 2014 20XX 20XX 20XX 20XX 20XX Measurement Date 6/30/2019 6/30/2018 6/30/2017 6/31/2016 6/30/2015 6/31/2014 6/31/2013 Employer's proportion of the net pension liability (asset) % 0.044882% 0.475910% 0.053544% 0.055300% 0.056507% 0.056744% 0.055534% Employer's proportionate share of the net pension liability $ 1,725,872 2,125,430 2,540,705 2,982,223 2,955,841 2,858,505 3,244,993 TOTAL $ 1,725,872 2,125,430 2,540,705 2,982,223 2,955,841 2,858,505 3,244,993 Covered payroll (at measurement date)* $ 6,292,958 6,185,736 6,635,087 6,496,674 6,370,814 6,101,162 6,021,351 Page 62 of85 Employer's proportionate share of the net pension liability as a percentage of covered payroll % 27.43% 34.36% 38.29% 45.90% 46.40% 46.85% 53.89% Plan fiduciary net position as a percentage of the total pension liability % 67.12% 63.22% 61.24% 57.03% 59.10% 61.19% 61.19% Notes to Schedule: * As of measurement date; until a full 10-year trend is compiled, we are presenting information only for those years for which information is available Puget Sound Clean Air Agency Schedule of Proportionate Share of the Net Pension Liability PERS Plans 2 & 3 As of June 30, 2020 (reporting date) Last 10 Fiscal Years* Reporting Date 2020 2019 2018 2017 2016 2015 2014 20XX 20XX 20XX 20XX 20XX Measurement Date 6/30/2019 6/30/2018 6/30/2017 6/31/2016 6/30/2015 6/31/2014 6/31/2013 Employer's proportion of the net pension liability (asset) % 0.057905% 0.059132% 0.066762% 0.069004% 0.070816% 0.070962% 0.071028% Employer's proportionate share of the net pension liability $ 562,454 1,009,626 2,319,660 3,474,297 2,530,296 1,434,398 3,032,906 TOTAL $ 562,454 1,009,626 2,319,660 3,474,297 2,530,296 1,434,398 3,032,906 Covered payroll (at measurement date)* $ 6,292,958 6,185,736 6,635,087 6,496,674 6,370,814 6,101,162 6,021,351 Employer's proportionate share of the net Page 63 of85 pension liability as a percentage of covered payroll % 8.94% 16.32% 34.96% 53.48% 39.72% 23.51% 50.37% Plan fiduciary net position as a percentage of the total pension liability % 97.77% 95.77% 90.97% 85.82% 89.20% 93.29% 93.29% Notes to Schedule: * As of measurement date; until a full 10-year trend is compiled, we are presenting information only for those years for which information is available Puget Sound Clean Air Agency Schedule of Employer Contributions PERS Plan 1 For the year ended June 30, 2020 (reporting date) Last 10 Fiscal Years* Reporting Date 2020 2019 2018 2017 2016 2015 2014 20XX 20XX 20XX 20XX 20XX Measurement Date 6/30/2019 6/30/2018 6/30/2017 6/31/2016 6/30/2015 6/31/2014 6/31/2013 Statutorily or contractually required contributions $ 309,346 321,823 318,115 322,085 314,911 259,704 251,166 Contributions in relation to the statutorily or contractually required contributions* $ (309,346) (321,823) (318,115) (322,085) (314,911) (259,704) (251,166) - - - - - Contribution deficiency (excess) $ ------ Covered payroll (at measurement date)* $ 6,292,958 6,185,736 6,635,087 6,496,674 6,370,814 6,101,162 6,021,351 Contributions as a percentage of covered Page 64 of85 payroll % 4.92% 5.20% 4.79% 4.96% 4.94% 4.26% 4.17% Notes to Schedule: * As of measurement date; until a full 10-year trend is compiled, we are presenting information only for those years for which information is available Puget Sound Clean Air Agency Schedule of Employer Contributions PERS Plans 2 & 3 For the year ended June 30, 2020 (reporting date) Last 10 Fiscal Years* Reporting Date 2020 2019 2018 2017 2016 2015 2014 20XX 20XX 20XX 20XX 20XX Measurement Date 6/30/2019 6/30/2018 6/30/2017 6/31/2016 6/30/2015 6/31/2014 6/31/2013 Statutorily or contractually required contributions $ 514,650 472,928 456,272 407,775 398,356 315,450 299,770 Contributions in relation to the statutorily or contractually required contributions* $ (514,650) (472,928) (456,272) (407,775) (398,356) (315,450) (299,770) - - - - - Contribution deficiency (excess) $ ------ Covered payroll (at measurement date)* $ 6,292,958 6,185,736 6,635,087 6,496,674 6,370,814 6,101,162 6,021,351 Contributions as a percentage of covered Page 65 of85 payroll % 8.18% 7.65% 6.88% 6.28% 6.25% 5.17% 4.98% Notes to Schedule: * As of measurement date; until a full 10-year trend is compiled, we are presenting information only for those years for which information is available RSI - OPEB Puget Sound Clean Air Agency Schedule of Changes in Total OPEB Liability and Related Ratios Retiree Medical and Dental Benefits under the Public Employees Benefits Board (PEBB) For the year ended June 30, 2019 (plan measurement date) Last 10 Fiscal Years* Measurement Date --- > 6/30/2020 6/30/2018 6/30/2017 6/30/2016 NA NA NA NA NA NA Reporting Date ---> 2020 2019 2018 2017 2016 2015 2014 2013 2012 2011 Service cost $ 159,266 $ 160,930 $ 195,660 NA NA NA NA NA NA NA Interest on total OPEB liability 135,227 137,364 118,630 NA NA NA NA NA NA NA Changes of benefit terms - - - NA NA NA NA NA NA NA Effect of Economic/demographic gains or losses - - - NA NA NA NA NA NA NA Effect of assumption changes or inputs 236,740 (204,917) (554,783) NA NA NA NA NA NA NA Expected benefit payments (79,256) (51,088) (49,589) NA NA NA NA NA NA NA Page 66 of85 Change 451,977 42,289 (290,081) Total OPEB liability, beginning $ 3,743,649 $ 3,701,360 $ 3,991,441 NA NA NA NA NA NA NA Total OPEB liability, ending $ 4,195,626 $ 3,743,649 $ 3,701,360 NA NA NA NA NA NA NA Covered Payroll (as of measurement date) 6,498,489 6,185,736 6,635,087 Total OPEB liability as a % of covered employee payroll 64.56% 60.52% 55.78% *Until a full 10-year trend is compiled, only information for those years available is presented. No assets are accumulated in a trust that meets the criteria in paragraph 4 of GASB 75 to pay related benefits. See notes to the financials - assumption changes related to the discount rate used, projected healthcare costs, significant hiring or terming of employees, and significant retirements can affect the trends in the amounts reported for OPEB. MCAG No 1024 Puget Sound Clean Air Agency Schedule 16 Schedule of Expenditures of Federal Awards For the Year Ended June 30, 2020 Federal Agency Expenditures (whole dollars) From Pass- CFDA Through From Direct Passed Through (Pass Through Agency) Federal Program Number Other Award Number Awards Awards Total to Subrecipients Note Surveys, Studies, Research, Investigations, Demonstrations, and Special Purpose Activities Relating to the Clean Air Act Surveys, Studies, Research, Environmental Protection Agency, Investigations, Office of Air and Radiation (via Demonstrations, and Special Washington State Department of Purpose Activities Relating Ecology) To Clean Air Act 66.034 AQPM25-1924-PSCAA-00011$ 91,098 $ - $ 91,098 $ - 1 & 2 Total Surveys, Studies, Research, Investigations,$ 91,098 $ - $ 91,098 $ - Demonstrations, and Special Purpose Activities Relating to the Clean Air Act Page 67 of85 The accompanying notes are an integral part of this schedule. MCAG No 1024 Puget Sound Clean Air Agency Schedule 16 Schedule of Expenditures of Federal Awards For the Year Ended June 30, 2020 Federal Agency Expenditures (whole dollars) From Pass- CFDA Through From Direct Passed Through (Pass Through Agency) Federal Program Number Other Award Number Awards Awards Total to Subrecipients Note National Clean Diesel Emissions Reduction Program National Clean Diesel Emissions Reduction Environmental Protection Agency, Program/DERA Clean Diesel Office of Air and Radiation Funding Assistance Program 66.039 DE-01J53801 $ - $ 649,477 $ 649,477 $ 637,500 1,2,3 & 4 National Clean Diesel Emissions Reduction Page 68 of85 Environmental Protection Agency, Program/DERA Clean Diesel Office of Air and Radiation Funding Assistance Program 66.039 DE-01J40801 $ - $ 66,145 $ 66,145 $ 50,855 1,2,3 & 4 Total National Clean Diesel Emissions Reduction Program/DERA Clean Diesel Funding Assistance Program $ - $ 715,622 $ 715,622 $ 688,355 Diesel Emissions Reduction Act (DERA) State Grants Environmental Protection Agency, Diesel Emissions Reduction Office of the Administrator (via Act (DERA) State Washington State Department of Grants/Washington State Ecology) Clean Diesel Grant Program 66.040 OTGP-2020-PSCAA-00024$ 14,320 $ -$ 14,320 $ - 1,2 & 4 Total Diesel Emissions Reduction Act (DERA) State Grants $ 14,320 $ - $ 14,320 $ - Performance Partnership Grants Environmental Protection Agency, Office of the Administrator (via Washington State Department of Performance Partnership Ecology) Grants 66.605 AQCORE-1921-PSCAA-00014$ 941,600 $ -$ 941,600 $ - 1 & 2 Total Performance Partnership Grants$ 941,600 $ - $ 941,600 $ - The accompanying notes are an integral part of this schedule. MCAG No 1024 Puget Sound Clean Air Agency Schedule 16 Schedule of Expenditures of Federal Awards For the Year Ended June 30, 2020 Federal Agency Expenditures (whole dollars) From Pass- CFDA Through From Direct Passed Through (Pass Through Agency) Federal Program Number Other Award Number Awards Awards Total to Subrecipients Note Conservation Research and Development Conservation Research and Development/Energy U. S. Department of Energy Efficiency EE 81.086 DE-EE0007402$ - $ 93,750 $ 93,750 $ - 1 & 2 Total Conservation Research and Development/Energy Efficiency EE $ - $ 93,750 $ 93,750 $ - Total Federal Expenditures$ 1,047,018 $ 809,372 $ 1,856,390 $ 688,355 Page 69 of85 The accompanying notes are an integral part of this schedule. MCAG NO. 1024 Puget Sound Clean Air Agency Schedule 16 Notes to the Schedule of Expenditures of Federal Awards Fiscal Year 2020 (July 1, 2019 through June 30, 2020) NOTE 1 – BASIS OF ACCOUNTING For Federal expenditures, this schedule is prepared on the same basis of accounting as the Puget Sound Clean Air Agency’s financial statements. The Agency uses the accrual basis of accounting for Proprietary funds. NOTE 2 – PROGRAM COSTS For Federal expenditures, the amounts shown as current year expenditures represent only the federal grant portion of the program costs. Entire program costs, including matching funds from the Agency or beneficiaries, may be higher than the expenditure amounts shown on the schedule. Such expenditures are recognized following, as applicable, whether the cost principles in the OMB circular A-87, Cost Principles for State, Local, and Indian Tribal Governments, or the cost principles contained in Title 2 U. S. Code of Federal Regulations Part 200, Uniform Administrative Requirements, Cost Principles, and Audit Requirements for Federal Awards, wherein certain types of expenditures are not allowable or are limited as to reimbursement. NOTE 3 – AMOUNTS AWARDED TO SUBRECIPIENTS The Agency Passed $688,354.69 to Subrecipients. DE-01J53801 DERA School Bus Replacements $637,500.00 DE-01J40801 Puget Sound Harbor Vessel Replacement $ 50,854.69 NOTE 4 – INDIRECT COST RATE The Agency has not elected to use the 10-percent de minimis indirect cost rate allowed under the Uniform Guidance and has used the Agency’s federally approved indirect rates. The amount expended includes $15,816.01 claimed as an indirect cost recovery distributed as follows: Grant No. Title Indirect Rate Indirect Cost Recovery DE-01J53801 DERA School Bus Replacements 61.37% $ 4,555.03 DE-01J40801 Puget Sound Harbor Vessel Repl 61.37% $ 5,814.83 OTGP-2020-PSCAA-00024 Harbor Vessel Engine Repl Grant 2019–Federal 61.37% $ 5,446.15 $15,816.01 Page 70 of 85 ABOUT THE STATE AUDITOR’S OFFICE The State Auditor’s Office is established in the Washington State Constitution and is part of the executive branch of state government. The State Auditor is elected by the people of Washington and serves four-year terms. We work with state agencies, local governments and the public to achieve our vision of increasing trust in government by helping governments work better and deliver higher value. In fulfilling our mission to provide citizens with independent and transparent examinations of how state and local governments use public funds, we hold ourselves to those same standards by continually improving our audit quality and operational efficiency, and by developing highly engaged and committed employees. As an agency, the State Auditor’s Office has the independence necessary to objectively perform audits, attestation engagements and investigations. Our work is designed to comply with professional standards as well as to satisfy the requirements of federal, state and local laws. The Office also has an extensive quality control program and undergoes regular external peer review to ensure our work meets the highest possible standards of accuracy, objectivity and clarity. Our audits look at financial information and compliance with federal, state and local laws for all local governments, including schools, and all state agencies, including institutions of higher education. In addition, we conduct performance audits and cybersecurity audits of state agencies and local governments, as well as state whistleblower, fraud and citizen hotline investigations. The results of our work are available to everyone through the more than 2,000 reports we publish each year on our website, www.sao.wa.gov. Additionally, we share regular news and other information via an email subscription service and social media channels. We take our role as partners in accountability seriously. The Office provides training and technical assistance to governments both directly and through partnerships with other governmental support organizations. Stay connected at sao.wa.gov Other ways to stay in touch Find your audit team Main telephone: Request public records (564) 999-0950 Search BARS manuals (GAAP and cash), and find reporting templates Toll-free Citizen Hotline: Learn about our training workshops (866) 902-3900 and on-demand videos Email: Discover which governments serve you [email protected] — enter an address on our map Explore public financial data with the Financial Intelligence Tool Office of the Washington State Auditor sao.wa.gov Page 71 of 85 Office of the Washington State Auditor Pat McCarthy Issue Date – (Inserted by OS) Board of Directors Puget Sound Clean Air Agency Seattle, Washington Report on Agreed-Upon Procedures Please find attached our report on the results of performing certain agreed-upon procedures as specified in our report. We are issuing this report for the information and use of the parties specified in our report, and it is not suitable for any other purpose. However, this report is a matter of public record and its distribution is not limited. Sincerely, Pat McCarthy State Auditor Olympia, WA Americans with Disabilities In accordance with the Americans with Disabilities Act, we will make this document available in alternative formats. For more information, please contact our Office at (564) 999-0950, TDD Relay at (800) 833-6388, or email our webmaster at [email protected] . Insurance Building, P.O. Box 40021 Olympia, Washington 98504-0021 (564) 999-0950 [email protected] Page 72 of 85 INDEPENDENT ACCOUNTANT’S REPORT Karen Houser, Finance Manager Puget Sound Clean Air Agency 1904 Third Avenue, Suite 105 Seattle, WA 98101 To the Board of Directors and Management of the Puget Sound Clean Air Agency: We have performed the procedures enumerated below, which were agreed to by the management of the Puget Sound Clean Air Agency and the Washington State Department of Ecology, related to the Agency’s Air Operating Permit (AOP) program and the Agency’s compliance with program requirements established by Chapter 70.94.161-.162 of the Revised Code of Washington and Chapter 173-401 of the Washington Administrative Code, during the period July 1, 2018 through June 30, 2020. The Agency’s management is responsible for managing the AOP program, compliance with these requirements, and for the accuracy of its financial records. The sufficiency of these procedures is solely the responsibility of those parties specified in this report. Consequently, we make no representation regarding the sufficiency of the procedures enumerated below either for the purpose for which this report has been requested or for any other purpose. Procedure Results The agreed-upon procedures and associated results are as follows: Procedures related to collection of fees 1. Inspect the Agency’s written procedure for developing, assessing and collecting fees from its sources and determine whether it is more than three years old. Results: We inspected the Agency’s written procedure for developing, assessing and collecting fees from its sources which was last updated in February 2019. The Agency’s procedures are less than three years old. 2. Compare totals from the AOP permit ledgers or systems to the general ledger for each fiscal year. (Applicable only if permits were issued out of a separate system than the general ledger and may only be feasible if permit amounts are included in the permit ledger or system.) Results: We compared the totals from the AOP system to the general ledger for each fiscal year and confirmed they agree. Office of the Washington State Auditor sao.wa.gov Page 2 Page 73 of 85 3. Judgmentally select AOP permits issued during the engagement period and trace amounts to receipts and to the general ledger. Results: We selected both AOP permits issued during the engagement period and traced amounts to receipts and to the general ledgers. No exceptions were found as a result of applying this procedure. 4. Inspect a judgmental selection of AOP permit accounts receivables for each fiscal year and determine whether late fees were assessed and collection measures initiated in accordance with Agency policies and procedures. Results: We inspected both AOP permit accounts receivables for each fiscal year and determined late fees were assessed and collection measures initiated in accordance with Agency policies and procedures. Procedures related to computation of fees 5. Inspect invoices for a judgmental selection of AOP permits issued during the engagement period to ensure fees agreed with the Agency’s approved fee schedule and fee calculation worksheets. Results: We inspected invoices for both AOP permits issued during the engagement period and confirmed fees agreed with the Agency’s approved fee schedule and fee calculation worksheets. Procedures related to revenue and expenditure accounting 6. Identify which fund or accounts are used to account for AOP revenue and expenses. Results: Fund code OPRMFD is used exclusively for the Operating Permit Title V Fund to specify operating permit revenues and expenses. 7. Inspect all Agency general ledger accounts used to account for AOP revenue and expenses and determine whether AOP revenue and expenses are commingled with other revenue sources or expense uses. Results: We inspected all Agency general ledger accounts used to account for AOP revenue and expenses and determined AOP revenue and expenses are not commingled with other revenue sources or expense uses. 8. Judgmentally select expenses accounted for in non-AOP accounts during the engagement period and inspect supporting documentation to determine whether they were for AOP activities. Results: We judgmentally selected 20 expenses accounted for in non-AOP accounts during the engagement period and inspected supporting documentation. We determined they were not for AOP activities. Office of the Washington State Auditor sao.wa.gov Page 3 Page 74 of 85 Procedures related to authorized activities 9. Judgmentally select AOP program expenses (including payroll) for the engagement period and inspect supporting documentation to determine whether they were for allowable program activities. Results: We judgmentally selected 25 AOP program expenses for the engagement period and inspected supporting documentation. We determined they were for allowable program activities. 10. Inspect supporting documentation for a judgmental selection of tasks the sources were billed for during the engagement period and determine whether they were completed. Results: This is not applicable because the Agency does not bill sources based on tasks. Therefore, we did not apply this procedure. 11. Inspect the Agency’s indirect cost allocations and determine whether indirect costs were also charged to the program as direct costs. Results: We inspected the Agency’s indirect cost allocations and determined the indirect costs were not charged to the program as direct costs. Procedures related to available funds 12. Inspect Agency interim and year-end balance sheets for each fiscal year to determine if the AOP program had a negative fund balance at any time during the engagement period. Results: We inspected the Agency’s monthly balance sheets for fiscal years ended June 30, 2019 and 2020 and determined the AOP program did not have a negative fund balance at any time during the engagement period. 13. Inspect uses of AOP program revenues collected in excess of actual program costs for each fiscal year and determine whether Agency complied with its policy for handling excess program revenue. Results: We inspected uses of AOP program revenues collected in excess of actual program costs for each fiscal year and determined the Agency complied with its policy for handling excess program revenue. 14. To ensure all Title V facilities were billed for permit fees during the engagement period, perform a query of all Title V sources and synthetic minors on an annual basis. Results: We determined all Title V facilities were billed for permit fees during the engagement period. This agreed-upon procedures engagement was conducted in accordance with attestation standards established by the American Institute of Certified Public Accountants, and the standards applicable to attestation engagements contained in Government Auditing Standards , issued by the Comptroller Office of the Washington State Auditor sao.wa.gov Page 4 Page 75 of 85 General of the United States. We were not engaged to and did not conduct an examination or review, the objectives of which would be the expression of an opinion or conclusion on the financial information of the Agency’s AOP program, on compliance with specified requirements, or on the internal control over compliance with the specified requirements. Additionally, the agreed-upon procedures do not constitute an audit or review of the financial statements or any part thereof, the objective of which is the expression of an opinion or conclusion, respectively, on the financial statements or a part thereof. Accordingly, we do not express such opinions or conclusions. Had we performed additional procedures, other matters might have come to our attention that would have been reported to you. Restriction on Use This report is intended for the information and use of the Board of Directors and management of the Puget Sound Clean Air Agency and the Department of Ecology and is not suitable for any other purpose. However, this report is a matter of public record and its distribution is not limited. Sincerely, Pat McCarthy State Auditor Olympia, WA March 16, 2021 Office of the Washington State Auditor sao.wa.gov Page 5 Page 76 of 85 Summary of Uncorrected Items Description Statement / Schedule Opinion Unit We noted a variance of $3,883 for the PERS 2/3 Statement of Net Position Puget Sound Clean Air Agency Deferred Inflows. The Agency was missing a reconciliation of net cash flows from operating activities. With out the reconciliation, we were unable to trace the net operating income and the depreciation expense and any prior period adjustment Statement of Cash Flows Puget Sound Clean Air Agency affecting the calculation of net operating income to the Proprietary Fund Statement of Revenues, Expenses and Changes in Fund Net Position. Note 11 is missing the current portion due within one year from the Table in Changes in Long-term Liabilities. The Note 11 – Changes in Long-term Puget Sound Clean Air Agency ending balance should include both current and non- Liabilities current portions The Agency misclassified expenses of $1,617,890 related Statement of Revenues, Expenses to grants (such as payroll) to non-operating expenses, Puget Sound Clean Air Agency and Changes in Net Position instead of operating. Statement of Cash Flows – Cash flows from noncapital financing activities section – “non-operating revenues (expenses), net of non-cash adjustments” were $971K Statement of Cash Flows Puget Sound Clean Air Agency when more than $1.4 million is reported in the operating statement. Statement of Cash Flows - If applicable, the statement should be accompanied by information (in narrative or tabular form) concerning any non-cash investing, capital, or financing activities of the period that affected recognized assets or liabilities but did not result in cash Statement of Cash Flows Puget Sound Clean Air Agency flows. Since the agency has a line item “non-operating revenues (expenses), net of non-cash adjustments” that they have non-cash transactions that should be disclosed. The MD&A includes one reference to "net assets." This is an outdated term and should be replaced by, "net MD&A Puget Sound Clean Air Agency position." Washington State Auditor's Office Page 1 of 1 Page 77 of 85 Page 78 of 85 Page 79 of 85 Page 80 of 85 Page 81 of 85 Page 82 of 85 Page 83 of 85 Page 84 of 85 Page 85 of 85 DATE March 18, 2021 Board of Directors TO Puget Sound Clean Air Agency SUBJECT Briefing – FY22 Budget: CY22 Supplemental Income (Per Capita) Honorable Members: The purpose of this memo is to brief the Board on the CY22 Supplemental Income (Per Capita). Attachment A provides additional information by comparing the actual CY21 Supplemental Income and the proposed amount apportioned under the three methods. The Washington State Clean Air Act, at RCW 70.94.093, requires that the Board of Directors of the Agency: 1. Shall select a method of determining the apportionment of supplemental income based on one of the following: 1) the population method (Method 1), which allocates the per capita fees to each jurisdiction based on their respective populations; 2) the assessed value method (Method 2), which allocates the per capita fees to each jurisdiction based on their respective total assessed property values; or 3) the 50:50 method (Method 3), which blends the population and assessed value methods in allocating the per capita fees to jurisdictions; and, 2. Shall certify by the fourth Monday in June of each year the share of the Agency’s supplemental income budget that shall be paid in the next calendar year by each city and county located in the Agency's jurisdictional area. From 2019 to 2021, the supplemental income rate has been adopted each year at a flat rate of 83 cents per capita – we propose keeping the rate flat at 83 cents for CY22 given the current economic uncertainties affecting the jurisdictions. The total supplemental income is based on the four-county population of 4,264,200 (April 2020 Washington Office of Financial Management report) and the proposed rate of 83 cents per capita - this results in a proposed total assessment of $3,529,286. The total assessment is then apportioned to each jurisdiction under one of the three methods described above and as adopted by the Board. Attachment A compares the actual 2021 supplemental income (under the adopted 50:50 method and 83 cents) to the proposed 2022 supplemental income at 83 cents per capita and under each method of apportionment. The proposed CY22 supplemental income would increase about $50k, or 1.45% (the percent increase in the four-county population) from CY21. Population growth has slowed in recent years to 1.45% (from over 2% two years ago). The assessed property values have continued to increase but at a slower rate (4.3%) than the past several years (9%-13%). Variations in jurisdiction’s annual per capita assessment are due to changes in each jurisdiction’s population and assessed property value relative to the total four-county changes. For example, Kitsap, Pierce, and Snohomish counties’ increases in the assessment under the 50:50 method were driven mostly by the higher-than-average increases in assessed values – 6.5%-9.5% compared to the average of 4.3%. Under the 50:50 method, each county’s percent of the total assessment would change slightly from 2021 due mainly to the relative changes in assessed property values - King County would decrease from 60.1% to 59.6%, Kitsap County would remain at 5.4%, Pierce County would increase from 17.2% to 17.5%, and Snohomish County would increase from 17.3% to 17.5%. As shown in Attachment A, assessments under Method 1 (population) and Method 2 (assessed property value) would result in wide swings from the previous year’s assessment – the smoothing effect of the 50:50 Method has resulted in the Board adopting this method in the last three decades. Some jurisdictions under the 50:50 method would have decreased assessments from the prior year due to little or no change in population combined with lower-than-average changes in assessed property. We will request action on the selection of the apportionment method and the per capita rate in the April Board meeting. Respectfully submitted, Craig T. Kenworthy Executive Director Attachment jwc - 2 - Per Capita Assessment - Actual CY2021 Compared to Proposed CY2022 Change in Per Capita Assessment from 2021 Actual to 2022 under each method Population Assessed Value Actual CY2021 - at 83 cents Proposed CY2022 - at 83 cents 50:50 Method Method Method $ Change Assessed in Per $ Change $ Change in Assessed 50:50 Assessed 50:50 Population Value Capita % in Per % Per Capita % Population Property Values Method Population Property Values Method Method Method Fees Change Capita Fees Change Fees Change Per Capita Rate $ 0.83 $ 0.83 $ 0.83 $ 0.83 Jurisdiction Algona 3,190 635,541,724 $ 2,484 3,210 710,798,052 $ 2,594 $ 2,664 $ 2,524 $ 110 4.4% $ 180 7.3% $ 40 1.6% Auburn (Part) 71,740 11,011,486,530 49,872 71,960 11,849,437,204 50,905 59,727 42,084 1,033 2.1% 9,855 19.8% (7,788) -15.6% Beaux Arts 300 208,491,757 505 300 211,188,580 500 249 750 (5) -1.0% (256) -50.7% 245 48.5% Bellevue 145,300 68,318,402,917 185,006 148,100 71,293,126,396 188,063 122,923 253,202 3,057 1.7% (62,083) -33.6% 68,196 36.9% Black Diamond 4,525 1,010,636,846 3,723 5,205 1,112,933,931 4,136 4,320 3,953 413 11.1% 597 16.0% 230 6.2% Bothell (Part) 28,570 7,157,203,764 24,921 29,730 7,191,391,210 25,108 24,676 25,541 187 0.8% (245) -1.0% 620 2.5% Burien 52,000 7,877,912,707 35,960 52,300 8,207,791,119 36,280 43,409 29,151 320 0.9% 7,449 20.7% (6,809) -18.9% Carnation 2,220 402,535,850 1,656 2,265 407,950,576 1,664 1,880 1,449 8 0.5% 224 13.5% (207) -12.5% Clyde Hill 3,055 3,025,493,616 6,790 3,055 3,027,322,750 6,644 2,536 10,752 (146) -2.2% (4,254) -62.7% 3,962 58.3% Covington 20,280 2,870,055,119 13,655 20,530 3,098,266,122 14,022 17,040 11,004 367 2.7% 3,385 24.8% (2,651) -19.4% Des Moines 31,580 4,748,403,120 21,773 32,260 4,867,556,097 22,032 26,776 17,287 259 1.2% 5,003 23.0% (4,486) -20.6% Duvall 7,840 1,470,525,425 5,938 7,950 1,534,857,512 6,025 6,599 5,451 87 1.5% 661 11.1% (487) -8.2% Enumclaw, part 12,200 1,689,726,791 8,147 12,610 1,885,408,835 8,581 10,466 6,696 434 5.3% 2,319 28.5% (1,451) -17.8% Federal Way 97,840 12,075,445,354 62,646 98,340 12,754,309,543 63,460 81,622 45,298 814 1.3% 18,976 30.3% (17,348) -27.7% Hunts Point 420 1,242,616,557 2,443 420 1,210,732,654 2,324 349 4,300 (119) -4.9% (2,094) -85.7% 1,857 76.0% Issaquah 37,590 12,007,393,649 37,518 38,690 12,217,010,326 37,751 32,113 43,390 233 0.6% (5,405) -14.4% 5,872 15.6% Kenmore 23,320 5,324,117,730 19,396 23,450 5,322,258,745 19,183 19,464 18,902 (213) -1.1% 68 0.3% (494) -2.5% Kent 129,800 23,002,042,032 95,854 130,500 24,427,645,579 97,536 108,315 86,756 1,682 1.8% 12,461 13.0% (9,098) -9.5% Kirkland 88,940 31,652,672,725 94,688 90,660 32,190,057,111 94,786 75,248 114,325 98 0.1% (19,440) -20.5% 19,637 20.7% Lake Forest Park 13,250 3,455,657,267 11,807 13,280 3,441,434,665 11,622 11,022 12,222 (185) -1.6% (785) -6.6% 415 3.5% Maple Valley 26,180 4,337,773,278 18,783 26,630 4,623,843,141 19,262 22,103 16,422 479 2.6% 3,320 17.7% (2,361) -12.6% Medina 3,245 4,714,784,383 9,953 3,300 4,624,684,427 9,582 2,739 16,425 (371) -3.7% (7,214) -72.5% 6,472 65.0% Mercer Island 24,470 15,199,083,170 37,899 24,690 15,328,872,435 37,467 20,493 54,442 (432) -1.1% (17,406) -45.9% 16,543 43.6% Milton (Part) 1,195 175,843,995 817 1,595 184,775,294 990 1,324 656 173 21.2% 507 62.0% (161) -19.7% Newcastle 12,450 3,694,577,615 11,911 12,870 3,886,990,612 12,244 10,682 13,805 333 2.8% (1,229) -10.3% 1,894 15.9% Normandy Park 6,610 1,809,616,438 6,046 6,625 1,883,894,859 6,095 5,499 6,691 49 0.8% (547) -9.1% 645 10.7% North Bend 6,965 1,720,587,323 6,031 7,455 1,872,100,728 6,418 6,188 6,649 387 6.4% 157 2.6% 618 10.2% Pacific(Part) 6,875 662,770,089 4,063 6,895 690,597,048 4,088 5,723 2,453 25 0.6% 1,660 40.9% (1,610) -39.6% Redmond 65,860 25,913,357,771 74,633 69,900 27,159,726,862 77,238 58,017 96,460 2,605 3.5% (16,616) -22.3% 21,827 29.2% Renton 104,700 20,038,161,673 80,028 105,500 21,134,581,379 81,313 87,565 75,061 1,285 1.6% 7,537 9.4% (4,967) -6.2% Sammamish 64,410 20,095,772,302 63,412 65,100 19,900,870,078 62,356 54,033 70,679 (1,056) -1.7% (9,379) -14.8% 7,267 11.5% Sea Tac 29,180 7,002,893,467 24,893 29,180 7,304,721,195 25,081 24,219 25,943 188 0.8% (674) -2.7% 1,050 4.2% Seattle 747,300 257,958,280,787 780,999 761,100 262,134,061,774 781,350 631,713 930,987 351 0.0% (149,286) -19.1% 149,988 19.2% Shoreline 56,370 11,764,631,816 44,868 56,980 12,076,248,955 45,092 47,293 42,890 224 0.5% 2,425 5.4% (1,978) -4.4% Population Assessed Value Actual CY2021 - at 83 cents Proposed CY2022 - at 83 cents 50:50 Method Method Method $ Change Assessed in Per $ Change $ Change in Assessed 50:50 Assessed 50:50 Population Value Capita % in Per % Per Capita % Population Property Values Method Population Property Values Method Method Method Fees Change Capita Fees Change Fees Change Per Capita Rate $ 0.83 $ 0.83 $ 0.83 $ 0.83 Skykomish 205 36,158,842 151 205 34,008,812 145 170 121 (6) -4.0% 19 12.7% (30) -20.0% Snoqualmie 13,670 3,473,387,729 12,013 13,680 3,555,931,322 11,992 11,354 12,629 (21) -0.2% (659) -5.5% 616 5.1% Tukwila 20,930 7,351,976,382 22,106 21,360 7,883,057,562 22,863 17,729 27,997 757 3.4% (4,377) -19.8% 5,891 26.6% Woodinville 12,410 4,507,431,729 13,378 12,790 4,614,051,396 13,501 10,616 16,387 123 0.9% (2,762) -20.6% 3,009 22.5% Yarrow Point 1,040 1,477,785,215 3,129 1,030 1,444,452,931 2,992 855 5,130 (137) -4.4% (2,274) -72.7% 2,001 64.0% Total Incorp. King County 1,978,025 591,121,235,484 1,899,895 2,011,700 607,298,947,817 1,913,285 1,669,711 2,156,863 13,390 0.7% (230,184) -12.1% 256,968 13.5% Total Unincorp. King County 248,275 51,369,256,560 196,805 249,100 52,235,933,520 196,138 206,753 185,519 (667) -0.3% 9,948 5.1% (11,286) -5.7% Total King County 2,226,300 642,490,492,044 2,096,700 2,260,800 659,534,881,337 2,109,423 1,876,464 2,342,382 12,723 0.6% (220,236) -10.5% 245,682 11.7% Bainbridge Island 24,520 9,222,192,924 27,010 25,070 9,562,650,167 27,385 20,808 33,962 375 1.4% (6,202) -23.0% 6,952 25.7% Bremerton 42,080 4,001,032,935 24,767 41,750 4,410,485,289 25,158 34,653 15,664 391 1.6% 9,886 39.9% (9,103) -36.8% Port Orchard 14,390 2,072,895,477 9,756 14,770 2,236,031,476 10,100 12,259 7,941 344 3.5% 2,503 25.7% (1,815) -18.6% Poulsbo 11,180 2,030,684,280 8,346 11,550 2,174,433,432 8,655 9,587 7,723 309 3.7% 1,241 14.9% (623) -7.5% Total Incorp. Kitsap County 92,170 17,326,805,616 69,879 93,140 18,383,600,364 71,298 77,306 65,291 1,419 2.0% 7,427 10.6% (4,588) -6.6% Total Unincorp. Kitsap County 177,930 24,821,380,269 119,149 179,060 26,483,488,586 121,339 148,620 94,058 2,190 1.8% 29,471 24.7% (25,091) -21.1% Total Kitsap County 270,100 42,148,185,885 189,028 272,200 44,867,088,950 192,637 225,926 159,348 3,609 1.9% 36,898 19.5% (29,680) -15.7% Auburn (part) 9,980 1,338,843,282 6,586 9,980 1,423,822,610 6,670 8,283 5,057 84 1.3% 1,697 25.8% (1,529) -23.2% Bonney Lake 21,060 3,304,031,819 14,771 21,390 3,570,936,322 15,218 17,754 12,682 447 3.0% 2,983 20.2% (2,089) -14.1% Buckley 4,885 694,731,250 3,295 5,080 764,921,896 3,467 4,216 2,717 172 5.2% 921 28.0% (578) -17.6% Carbonado 665 68,633,788 401 685 76,902,980 421 569 273 20 5.0% 168 41.8% (128) -31.9% Du Pont 9,425 1,786,146,155 7,172 9,525 1,966,531,226 7,445 7,906 6,984 273 3.8% 734 10.2% (188) -2.6% Eatonville 2,970 288,138,482 1,759 3,010 311,865,201 1,803 2,498 1,108 44 2.5% 739 42.0% (651) -37.0% Edgewood 11390 1997528056 8,373 12,070 2280297881 9,058 10,018 8,099 685 8.2% 1,645 19.6% (274) -3.3% Fife 10,140 2,791,019,594 9,303 10,200 2,936,518,069 9,448 8,466 10,429 145 1.6% (837) -9.0% 1,126 12.1% Fircrest 6,770 984,627,839 4,607 6,790 1,083,449,810 4,742 5,636 3,848 135 2.9% 1,029 22.3% (759) -16.5% Gig Harbor 10,770 3,183,696,881 10,281 11,240 3,478,997,723 10,843 9,329 12,356 562 5.5% (952) -9.3% 2,075 20.2% Lakewood 59,670 7,456,764,386 38,374 60,030 8,111,198,629 39,316 49,825 28,807 942 2.5% 11,451 29.8% (9,567) -24.9% Milton(Part) 6,735 918,820,561 4,472 6,805 1,018,339,336 4,632 5,648 3,617 160 3.6% 1,176 26.3% (855) -19.1% Orting 8,380 868,366,873 5,063 8,635 961,158,709 5,290 7,167 3,414 227 4.5% 2,104 41.6% (1,649) -32.6% Pacific(Part) 35 247,290,016 466 30 262,067,458 478 25 931 12 2.6% (441) -94.7% 465 99.7% Puyallup 41,570 6,928,321,607 29,898 42,700 7,385,296,569 30,835 35,441 26,229 937 3.1% 5,543 18.5% (3,669) -12.3% Roy 820 74,692,640 477 820 79,551,659 482 681 283 5 1.0% 204 42.7% (194) -40.8% Ruston 1,005 299,778,877 964 1,040 328,529,699 1,015 863 1,167 51 5.3% (101) -10.5% 203 21.0% South Prairie 480 51,533,526 293 500 55,032,113 305 415 195 12 4.1% 122 41.6% (98) -33.3% Steilacoom 6,450 1,041,399,405 4,578 6,505 1,138,541,303 4,721 5,399 4,044 143 3.1% 821 17.9% (534) -11.7% Sumner 10,120 3,492,589,446 10,575 10,360 3,731,166,761 10,925 8,599 13,251 350 3.3% (1,976) -18.7% 2,676 25.3% Tacoma 211,400 29,781,934,614 142,094 213,300 32,426,115,141 146,101 177,039 115,164 4,007 2.8% 34,945 24.6% (26,930) -19.0% University Place 33,090 4,643,905,624 22,209 33,310 5,167,407,710 23,000 27,647 18,352 791 3.6% 5,438 24.5% (3,857) -17.4% Wilkeson 490 51,060,985 297 495 56,822,235 306 411 202 9 3.0% 114 38.3% (95) -32.1% Population Assessed Value Actual CY2021 - at 83 cents Proposed CY2022 - at 83 cents 50:50 Method Method Method $ Change Assessed in Per $ Change $ Change in Assessed 50:50 Assessed 50:50 Population Value Capita % in Per % Per Capita % Population Property Values Method Population Property Values Method Method Method Fees Change Capita Fees Change Fees Change Per Capita Rate $ 0.83 $ 0.83 $ 0.83 $ 0.83 Total Incorp. Pierce County 468,300 72,293,855,706 326,308 474,500 78,615,471,040 336,521 393,835 279,208 10,213 3.1% 67,527 20.7% (47,100) -14.4% Total Unincorp. Pierce County 420,000 53,540,566,348 272,031 426,200 59,132,289,437 281,879 353,746 210,012 9,848 3.6% 81,715 30.0% (62,019) -22.8% Total Pierce County 888,300 125,834,422,054 598,339 900,700 137,747,760,477 618,400 747,581 489,220 20,061 3.4% 149,242 24.9% (109,119) -18.2% Arlington 19,740 3,007,053,360 13,681 20,600 3,351,354,351 14,500 17,098 11,903 819 6.0% 3,417 25.0% (1,778) -13.0% Bothell (Part) 18,180 5,228,696,561 17,089 18,670 5,434,479,533 17,399 15,496 19,301 310 1.8% (1,593) -9.3% 2,212 12.9% Brier 6,665 1,489,770,735 5,485 6,760 1,533,889,564 5,529 5,611 5,448 44 0.8% 126 2.3% (37) -0.7% Darrington 1,410 164,222,083 885 1,420 175,363,294 901 1,179 623 16 1.8% 294 33.2% (262) -29.6% Edmonds 42,170 11,011,221,440 37,600 42,470 11,648,792,913 38,311 35,250 41,371 711 1.9% (2,350) -6.2% 3,771 10.0% Everett 111,800 20,056,364,230 83,007 112,700 21,040,865,174 84,135 93,541 74,728 1,128 1.4% 10,534 12.7% (8,279) -10.0% Gold Bar 2,150 223,523,348 1,300 2,195 238,099,341 1,334 1,822 846 34 2.6% 522 40.1% (454) -35.0% Granite Falls 3,900 474,152,402 2,484 4,425 546,424,783 2,807 3,673 1,941 323 13.0% 1,189 47.9% (543) -21.9% Index 175 24,516,167 117 175 27,615,079 122 145 98 5 4.3% 28 24.1% (19) -16.2% Lake Stevens 33,080 4,923,888,286 22,716 34,150 5,298,584,282 23,581 28,345 18,818 865 3.8% 5,629 24.8% (3,898) -17.2% Lynnwood 39,600 7,503,860,299 30,131 40,690 7,953,751,038 31,010 33,773 28,248 879 2.9% 3,642 12.1% (1,883) -6.2% Marysville 67,820 8,863,283,518 44,324 69,180 9,729,494,216 45,987 57,419 34,555 1,663 3.8% 13,095 29.5% (9,769) -22.0% Mill Creek 20,590 4,454,155,944 16,675 20,590 4,661,388,455 16,822 17,090 16,555 147 0.9% 415 2.5% (120) -0.7% Monroe 19,250 2,884,711,378 13,254 19,800 3,115,841,466 13,750 16,434 11,066 496 3.7% 3,180 24.0% (2,188) -16.5% Mountlake Terrace 21,590 3,565,803,521 15,469 21,660 3,827,637,924 15,786 17,978 13,594 317 2.0% 2,509 16.2% (1,875) -12.1% Mukilteo 21,350 5,444,416,654 18,798 21,360 5,704,037,281 18,994 17,729 20,258 196 1.0% (1,069) -5.7% 1,460 7.8% Snohomish 10,200 1,676,400,322 7,293 10,240 1,833,886,262 7,506 8,499 6,513 213 2.9% 1,206 16.5% (780) -10.7% Stanwood 7,020 1,044,541,349 4,820 7,125 1,135,631,876 4,974 5,914 4,033 154 3.2% 1,094 22.7% (787) -16.3% Sultan 5,180 599,658,156 3,244 5,530 671,346,408 3,487 4,590 2,384 243 7.5% 1,346 41.5% (860) -26.5% Woodway 1,350 761,967,333 1,951 1,360 790,704,157 1,969 1,129 2,808 18 0.9% (822) -42.1% 857 43.9% Total Incorp. Snohomish County 453,220 83,402,207,086 340,323 461,100 88,719,187,397 348,904 382,713 315,092 8,581 2.5% 42,390 12.5% (25,231) -7.4% Total Unincorp. Snohomish County 365,480 61,772,530,193 264,432 369,400 65,673,202,067 269,922 306,602 233,243 5,490 2.1% 42,170 15.9% (31,189) -11.8% Total Snohomish County 818,700 145,174,737,279 604,755 830,500 154,392,389,464 618,826 689,315 548,335 14,071 2.3% 84,560 14.0% (56,420) -9.3% Grand Total 4,203,400 $ 955,647,837,262 $ 3,488,822 4,264,200 $ 996,542,120,228 $ 3,539,286 $ 3,539,286 $ 3,539,286 $ 50,464 1.4% $ 50,464 1.4% $ 50,464 1.4% $ 3,488,822 $ 3,539,286 The CY22 assessment is based on population estimates for 2020 (April 2020 - WA Office of Financial Management Population Trends report) The CY22 assessment is based on 2020 assessed property values from county assessors for the 2021 tax year DATE March 18, 2021 Board of Directors TO Puget Sound Clean Air Agency SUBJECT Transportation Climate Planning Update -Clean Transportation Projects Honorable Members: At your March meeting, we will provide an update on several ongoing Agency transportation projects to reduce greenhouse gas (GHG) emissions: • Our community-led electric vehicle (EV) carshare pilot project in Seattle’s South Park neighborhood in partnership with Villa Comunitaria. • A recent effort to assess barriers and opportunities for increasing EV sales by gathering information from car dealerships in our region. • Ongoing efforts with the Puget Sound Regional Council to assist regional jurisdictions in their transportation electrification efforts. • Our work with partner organizations to help overcome key barriers to charging infrastructure installation in multi-unit buildings. • Recent outreach to drivers for transportation network companies like Uber and Lyft – both of which have stated an intention to have 100% of the vehicles in their networks be electric by 2030. • New efforts to replace diesel-fueled cargo handling equipment (CHE) with electric CHE. I look forward to our discussion. Respectfully submitted, Craig T. Kenworthy Executive Director Attachment jwc - 1 - Transportation Climate Planning Update Clean Transportation Updates Board of Directors March 25, 2021 Agenda • Background • Project Updates o Villa Comunitaria EV Carshare o EV Dealership Engagement o Regional EV (REV) Collaboration o Vehicle Charging Innovations for Multi-Unit Dwellings o Electrifying Ride-Share o Cargo-Handling Equipment Electrification • Questions and Open Discussion Transportation Climate Planning Update March 25, 2021 Background • Transportation emissions accounted for 38% of the regions total GHGs • Significant health impacts • Disadvantaged communities disproportionately impacted by transportation pollution • Unequal access to clean transportation technologies Transportation Climate Planning Update March 25, 2021 Background Transportation Climate Planning Update March 25, 2021 Villa Comunitaria EV Carshare • Overview o Community-owned 3-year pilot project o Agency to fund vehicles and charging infrastructure o Villa to undertake all program management with Agency assistance o Contract in development • Next steps o Pursue additional funding opportunities o Fund second vehicle o Ongoing outreach and education Transportation Climate Planning Update March 25, 2021 EV Dealership Engagement • Overview o SB 5811 - WA ZEV Mandate • Phased Approach o Phase 1: Information Gathering o Phase 2: Develop a dealership engagement strategy, as needed • Phase 1: Information Gathering o WSADA survey & literature review o Industry outreach & consultation o Department of Licensing records request Transportation Climate Planning Update March 25, 2021 WSADA Survey Findings 1. Dealerships are only somewhat familiar with ZEV Mandate but are familiar with EV Incentives 2. Training is not a perceived obstacle 3. Challenges include typical customer concerns ($, range anxiety, charging infrastructure) 4. Successes include training, partnerships, and leasing options Transportation Climate Planning Update March 25, 2021 Research Findings • Barriers: o Lack of diverse EV models o Consumers are missing vital information at the dealerships o EV sales mentality • Vehicle rebates and tax incentives have a significant effect on total EV sales (and are most effective when offered at the point of sale) • Consumer and dealer outreach and education programs remain critical • Existing policy solutions and incentive programs exist which can serve as good models Transportation Climate Planning Update March 25, 2021 Transportation Climate Planning Update March 25, 2021 EV Dealership Engagement Next Steps • Analyze DOL data, once available • Encourage more collaboration across the EV market • Close information gaps Transportation Climate Planning Update March 25, 2021 Regional EV (REV) Collaboration • Series of meetings co-hosted by PSRC/PSCAA • February 10th session focused on “Electrifying Your Comprehensive Plan” o >50 attendees from city planning/facilities departments, fleet managers, utilities, developers, etc. • Meeting goals: o Assess challenges and opportunities relating to electrification efforts o Discuss proposal for an information clearinghouse Transportation Climate Planning Update March 25, 2021 High-Level Themes Challenges Opportunities • Ensuring electrification is affordable and • Equitable electrification resources and accessible to communities facing the highest examples, with a focus on communities facing barriers the highest barriers • Regional infrastructure planning guidance – • Tools to translate electrification needs to what to install and where? stakeholders (e.g., regional charging infrastructure analysis) • Identify solutions to overcome slow pace and • Funding opportunities and grant assistance barriers to charging infrastructure installation • Additional guidance from PSRC on actions, • Model language for building codes, land use, programs, and policies that demonstrate zoning, development regs., design guidelines, alignment with VISION 2050 etc. to support EV deployment and demonstrate compliance with VISION 2050 • Viability of fleet demonstration projects and • Promote opportunities for peer-to-peer whether EVs are going to work for specific use learning (Clean Cities, WSU Clean cases Transportation Program) Transportation• Utility Climate coordination, Planning especiallyUpdate regarding rural • Guidance for coordinating with your utility March 25, 2021 areas and improving electrical distribution Goals for a Resource Clearinghouse 1. Provide the information, tools, and resources jurisdictions need to help electrify their comprehensive plans 2. Develop a user-friendly online clearinghouse for information sharing 3. Provide sample code language that enables electrification 4. Allow jurisdictions to promote their best practices and success stories through a public platform 5. Update the clearinghouse as needed with new and relevant information Transportation Climate Planning Update March 25, 2021 Vehicle Charging Innovations for Multi-Unit Dwelling • Project Leads: Center for Sustainable Energy, Forth Mobility, Energetics • Project goal: Create and broadly disseminate a Multi-Unit Dwelling EV charging toolkit • WWCC/PSCAA Role: o 2019-2020: Stakeholder interviews to assess barriers o 2021-2022: Toolkit dissemination Transportation Climate Planning Update March 25, 2021 Electrifying Ride-Hailing • Pre-COVID, talked to ~250 Uber and Lyft drivers o Challenges identified: • Lack of information about EVs • Charging • Upfront cost of EVs • Available EV models • Pandemic has reduced ride-hailing by 80%+ • Planning for outreach once COVID concerns reduced • Uber and Lyft publicly committed to go all-electric by 2030 Transportation Climate Planning Update March 25, 2021 Cargo-Handling Equipment (CHE) Electrification • Overview o Replacing diesel-fueled CHE with electric CHE o Currently working on Ecology State DERA grant to replace 6 CHE o Applying for another 8-10 CHE replacements in a National DERA grant • Next steps o Build relationships with port terminals, distribution centers, & railyards that own CHE o Pursue additional funding opportunities o Help coordinate the matching funding opportunities with potential projects Transportation Climate Planning Update March 25, 2021 Questions? Ideas? Transportation Climate Planning Update March 25, 2021 DATE March 18, 2021 Board of Directors TO Puget Sound Clean Air Agency SUBJECT Executive Director’s Report Honorable Members: Let’s start with some very good news. Thanks in large part to the efforts of staff of the National Association of Clean Air Agencies (where I co-chair the relevant committee on public funding) the recent COVID relief bill contains an additional 50 million dollars for EPA to grant to state and local air quality agencies. In addition, there is another 50 million dollars that can potentially go to air quality work as well as water quality. To give you some sense of scale, the total FY21 nationwide grant was 228 million so 50 million is a substantial sum. Here are some highlights from what we have been doing to clean the air and protect the climate. GOAL ONE – PROTECT PUBLIC HEALTH AND THE ENVIRONMENT FROM AIR POLLUTION Objective 1.1 – Meet National Ambient Air Quality Standards This month we reported our 2020 PM10 (coarse particle pollution) levels for our PM10 maintenance areas (includes parts of Kent, the Tacoma Tideflats, and the Seattle Duwamish Valley) to the Washington State Department of Ecology (Ecology), as required under our PM10 maintenance plan. PM10 includes fine particles (PM2.5) as well as larger particles including dust. The reporting for PM10 uses a five-year average that includes the wildfire smoke from 2017, 2018, and 2020, so our report included some elevated levels. Since the elevated levels are clearly not a result of local PM10 in the area, we do not expect any further required action at this time with Ecology and the Environmental Protection Agency (EPA). Objective 1.2 – Reduce transportation emissions, especially diesel particulate, in highly impacted locations Staff has been working with BNSF on an application for EPA’s National Diesel Emission Reduction Act grant program to replace nine diesel yard trucks with nine all-electric yard trucks. This project would be the first in the region to demonstrate electric cargo-handling equipment operating multiple shifts. It also includes specific actions to provide outreach to the local community and provide lessons learned to the goods movement industry. The project location is adjacent to the Allentown community in Tukwila, which is one of our focus communities. We expect to hear back from EPA on whether our project was selected sometime in the fall. Objective 1.3 – Reduce emissions and exposures from wood smoke and outdoor burning At the end of February, our scaled-up outreach efforts promoting clean-burning practices have ramped back down. Over the spring, staff will continue to promote the “Clean Burning Challenge” program and our Wood Stove Program. Staff is taking feedback from the Board and Advisory Council into consideration as we begin FY22 outreach planning. As of March 10th, our FY20-21 Ecology grant-funded Wood Stove Program had 737 households follow through with their projects. This includes 571 recycling projects (259 in King County, 168 in Pierce County, and 144 in Snohomish County) which have been issued their $350 reward check for scrapping their old wood stove. Another 166 households have funds reserved or redeemed for their $1,500 Replacement Discount project (offered only in Snohomish County) to upgrade to a cleaner heating appliance. For our Agency-funded Kitsap County drop-off recycling effort, so far 181 households have followed through with their recycling project and have been issued a $350 reward for scrapping their old wood stove. The combined programs, serving all our four counties, have incentivized the removal of 918 old wood stoves/inserts for this program cycle of fiscal years 2020-21. Objective 1.5 – Characterize and communicate air quality throughout the region, with the active participation of the public 2 As an example of the varied nature of our work here, last month, we tracked a fishing boat fire in Commencement Bay and responded to local media inquiries. The vessel was carrying 10,000 pounds of ammonia and 48,000 gallons of diesel. We helped explain some of the potential risks from any direct inhilation, and also let the public know we didn’t expect any long-term health impacts from the smoke. We have shared a draft of our quality assurance plan for our EPA- and Agency-funded Community Air Toxics Study with technical partners. The plan is used to help ensure accurate measurement to assure quality interpretation of the results from the study. We plan to begin sampling this summer. Objective 1.6 – Reduce inequities in air pollution exposure Our engagement teams have developed a survey to collect feedback on the DIY filter- fan program that was deployed ahead of the 2020 wildfire season. The effort is a continuation of the partnerships developed over the years to ensure continuity of communication, follow-up, and future improvements to our programs. The filter-fan survey was designed with partner input to both understand how the fans were used before, during, and after the wildfire event. In addition, we wanted to understand what information was helpful or lacking in order to ensure community members are able to maximize the potential benefits of the filter-fan as a mitigation tool for smoke and fine particulate exposure. Options for the survey are both digital (online) as well as verbal (phone interviews) and have been made accessible to a number of languages to meet the community groups we partnered with. Over the coming month, we will work to collect as many survey responses as possible, analyze, and incorporate the feedback into the DIY filter fan program we are beginning to develop for Summer 2021. In addition, the Duwamish Valley Engagement Team maintains ongoing, robust dialogue with community partners and stakeholders engaged with the community’s Clean Air Program, which is facilitated by the Duwamish River Cleanup Coalition. The Clean Air Program is comprised of a range of community-based organizations, individuals, environmental and government agencies. Recent learning from this effort includes the need to ensure that we provide clear communication on Agency efforts in the community, and help the community understand our regulatory role and authority in order to manage expectations among 2 all parties. In addition, we continue to reflect on how we might be able to better consider community input and feedback on our processes and how we might be able to creatively leverage tools and resources outside of our Agency to support community concerns. GOAL TWO – BECOME THE MOST CLIMATE-FRIENDLY REGION IN THE UNITED STATES Objective 2.1 – Reduce emissions of greenhouse gases from transportation Staff continues to make progress on the Villa Comunitaria Electric Vehicle (EV) Carshare Project, a community-owned, 3-year pilot program to develop an EV carshare. This is one of the transportation projects we briefed you on last month. Our goals with this pilot project are to both reduce transportation emissions and improve air quality in the South Park community of Seattle, as well as introduce the community to electric vehicles. The FY22 contract is currently under review. We look forward to updating you on that project as it officially gets underway. EXCELLENCE GOAL – EMPLOY THE BEST PEOPLE, POLICIES, AND PRACTICES TO ACHIEVE OUR WORK Objective 3.2 – Develop a culture that integrates environmental justice and equity principles into our day-to-day work and decisions The Department of Clean Air Initiatives continues its work to develop a racial equity toolkit to pilot among their projects. After conducting initial research on racial equity toolkits, staff is moving to the next phase of this work involving draft toolkit development and testing. As part of this phase, staff will also provide recommendations on resource and staffing needs to support toolkit use, provide guidance for users, and continue to solicit management feedback on the toolkit to support wider adoption at the Agency after the pilot phase. The Agency continues to work to advance internal equity by holding monthly racial caucusing groups (BIPOC group and the white anti-racism alliance group). The management team had its initial meeting with BIPOC staff and we will provide you with an update on that as part of the equity update agenda item. 2 2021 BOARD MEETING DATES REMAINING March 25 April 22 May 27 June 17 (Budget approval) July 22 (Executive Director’s performance evaluation) August (no meeting) September 23 October 28 November 18 (Joint meeting with the Advisory Council) December 16 GENERAL I am pleased to announce that I recently promoted Heather Beckford to the position of Human Resources and Organizational Development Director. Heather’s role has become broader than that of a human resources manager and she is a critical part of our ongoing efforts to improve our agency’s culture. Her promotion is effective March 16th. Respectfully submitted, Craig T. Kenworthy Executive Director jwc 2 PUGET SOUND CLEAN AIR AGENCY Notices of Construction/Notifications February 2021 King Kitsap Pierce Snohomish Mobile Total Approved 9 0 2 0 0 11 Notices/Notifications Approved February 1 through February 28, 2021 Date Approved NC# Firm Name Location Equipment ______2/12/21 12085 West Coast Auto Body & Painting Tacoma General Order ARO-1 (July 8, 2014) 2/12/21 12091 Tesla, Inc. Bellevue General Order ARO-1 (July 8, 2014) 2/12/21 12092 Tesla, Inc. Bellevue General Order ARO-1 (July 8, 2014) 2/16/21 12088 Gravity Coffee Pacific Coffee roaster 2/22/21 12102 Joint Base Lewis-McChord Fort Lewis Dust collector 2/22/21 12042 Brook Furniture Rental Kent Relocation of existing spray booth 2/22/21 12094 Costco Wholesale #61 Federal Way Vapor recovery 2/22/21 12095 Atomo Coffee Seattle Coffee roaster 2/26/21 11769 Starbucks Coffee Co Kent Coffee roasters 2/26/21 12074 Ceradyne Inc - a 3M Company Seattle Nine furnaces and an electric oven 2/26/21 12084 Seven Coffee Roasters Seattle Coffee roaster Notifications No notifications were approved this month. Notices/Notifications Received February 1 through February 28, 2021 Date Received NC# Firm Name Location Equipment ______2/3/21 12102 Joint Base Lewis-McChord Fort Lewis Dust collector 2/4/21 12103 Western Pneumatic Tube Co Kirkland Soil remediation 2/4/21 12108 Martin Henry Coffee Roasters Puyallup Coffee roaster 2/10/21 12104 Aim Aerospace Sumner Inc. Sumner Baghouse and dust collection system 2/12/21 12106 Graphic Sheets Renton Single wall machine 2/12/21 12107 CPM Oldcastle Frederickson Baghouse 2/12/21 12110 Oberto Sausage Co, Kent Kent Four smoke generation units 2/16/21 12111 Strasser Woodenworks Inc. Woodinville Sanding machines 2/16/21 12113 Graphic Sheets Renton Boiler 2/16/21 12114 Everett Steel Everett Laser cutting device 2/16/21 12116 Seaboard Cabinet Co Lynnwood Baghouse 2/16/21 12117 Winterwood LLC Kent Paint booth 2/17/21 12105 Lafarge PNW Seattle Slag dryer limits 2/17/21 12109 Snohomish Co Community Everett Expand & renovate current Transit maintenance operations 2/19/21 12119 Cobalt Enterprises Arlington Relocation 2/22/21 12100 CSI Tunnel Systems Inc. Puyallup Concrete batch plant 2/22/21 12115 Space Exploration Technologies Redmond Spray booth 2/26/21 12112 Rapid Readymix Co Arlington Concrete manufacturing 2/26/21 12120 Tacoma Public Works Tacoma Baghouse & rotary dryer Continued… Page 1 of 2 Notices/Notifications Received February 1 through February 28, 2021 Notifications Date Received NC# Firm Name Location Equipment ______2/8/21 1696N 56th Street Chevron Tacoma Vapor recovery 2/12/21 1690N BP Arco AM/PM Tukwila Vapor recovery 2/12/21 1691N ARCO AM PM Kirkland Vapor recovery 2/16/21 1697N ISN Grocery (Chevron) Lynnwood Vapor recovery 2/18/21 1698N Fife Shell Food Mart Fife Vapor recovery 2/18/21 1699N Meridian Arco AM/PM Puyallup Vapor recovery 2/18/21 1701N Emanuel 76 - Redmond Fall City Rd Redmond Vapor recovery 2/18/21 1702N Main Street Grocery Tacoma Vapor recovery 2/22/21 1700N Nile Corp/Hassan II LLC dba Hassan Tacoma Vapor recovery Mini-Mart 2/26/21 1693N AM/PM #82174 Velocity Investments Renton Vapor recovery 2/26/21 1695N Clear Creek Grocery 76 Silverdale Vapor recovery Page 2 of 2 CONTRACTS INITIATED IN FY20 as of 3/9/21 PROJECT MGR/ NUMBER VENDOR/RECIPIENT DESCRIPTION/PROJECT START DATE EXPIRES AMOUNT FUND SOURCE CONTACT 2020-001 PrintWest Printing and mailing services 07/01/19 06/30/21 $50,000 Fee programs, per capita, civil penalty fund Joanna Cruse Varies up to FY20 2020-002 Foster Pepper Legal services 08/07/19 06/30/20 budgeted amount Civil Penalties (previously collected) Jennifer Dold ($450k) 2020-003 ABC Legal Legal notices 07/09/19 06/30/20 $9,000 All agency funding Rob Switalski 2020-004 Apex Legal Legal notices 07/09/19 06/30/20 $2,000 All agency funding Rob Switalski 2020-005 Pacific Power Group LLC ScRAPS program - DPF cleaning support services 07/24/19 06/30/20 $70,000 Ecology Grant - AQDIESEL-1517-PSCAA-00026 Beth Carper 2020-006 thru Deleted contracts-revised NA NA NA NA NA NA 2020-010 2020-011 University Place School District School bus replacements (propane-powered) 09/11/19 12/30/20 $75,000 EPA grant DE-01J53801 Kelly O'Callahan Month-to- 2020-012 Amazon Web Services 07/30/19 $2,000 All agency funding Graeme Carvlin month 2020-013 7/10/2019 12/31/2020 $ 150,000 Highline School District School bus replacements (propane-powered) EPA grant DE-01J53801 / DERA FY2019 Kelly O'Callahan 2020-013-1 02/10/2020 12/31/2020 $ 37,500 2020-014 Snohomish School District School bus replacements (propane-powered) 08/22/19 12/30/20 $75,000 EPA grant DE-01J53801 Kelly O'Callahan 2020-015 Tukwila School District School bus replacements (propane-powered) 09/05/19 12/30/20 $150,000 EPA grant DE-01J53801 Kelly O'Callahan Wood stove recycling support for Wood Smoke 2020-016 American Northwest Recycling 09/12/19 07/31/21 No funds exchanged NA Amy Warren program Services billed as 2020-017 Sound Screening Services, Inc. TERMINATED 08/01/19 TBD All agency funding Heather Beckford ordered 2020-018 Inkscape Freeware licensing - graphics software 08/09/19 06/30/25 NA NA - no funds exchanged Clement Miege 2020-019 Center for Sustainable Energy Multi-unit Dwelling EV Charging 04/01/19 03/31/22 $15,000 match Per Capita Kelly O'Callahan Racial Affinity Groups and Management Equity 2020-020 Anu Taranath 09/23/19 08/31/20 $9,300 Per Capita Tania Park Training Racial Affinity Groups and Management Equity 2020-021 Aparajeeta Duttchoudhury 09/23/19 08/31/20 $9,300 Per Capita Tania Park Training Racial Affinity Groups and Management Equity 2020-022 Serena Maurer 09/23/19 08/31/20 $9,300 Per Capita Tania Park Training 2020-023 CDW Government LLC Office-365 Exchange Online 11/01/19 06/30/20 $40,000 All agency funding Andy Tudhope 2020-024 Washington Green Schools Breathing Easier 10/14/19 08/31/20 $19,800 Per Capita Julio Sánchez Variable depending 2020-025 US Bank Credit Cards 09/24/19 12/31/20 on credit card Credit Card Arrangement - funding varies Karen Houser activity Variable - $30,000 Month to 2020-026 Bucklin Evens Legal Services - real estate 09/19/19 budget for all non- All agency funding (legal expenses) Jennifer Dold month extraordinary legal 1 of 5 CONTRACTS INITIATED IN FY20 as of 3/9/21 PROJECT MGR/ NUMBER VENDOR/RECIPIENT DESCRIPTION/PROJECT START DATE EXPIRES AMOUNT FUND SOURCE CONTACT 2020-027 Crowley Marine Services Engine Replacement 02/11/20 12/31/20 $180,000 DERA Grant DE-01J40801 Beth Carper 2020-028 All Phase Comm LLC Support & Maintenance of ShoreTel Phone System 12/24/19 10/22/20 $5,248 All Agency funding Andy Tudhope Confidential Disclosure Agreement (related to online 2020-029 Visa U.S.A. Inc 11/05/19 06/30/20 NA - no funds exchanged Andy Tudhope credit card payment arrangement) 2020-030 Villa Comunitaria Electric Car Share in South Park 01/03/20 03/02/20 $13,926 Per Capita Angela Song Environmental Coalition of South 2020-031 Electric Car Share in South Park 01/03/20 03/02/20 $11,851 Per Capita Angela Song Seattle (ECOSS) Ecology Grant - OTGP-2020-PSCAA - 00024 / EPA 2020-032 Template Marine Engine Replacements TBD 09/30/21 TBD Beth Carper & State DERA funding 2020-033 ICF International Clean Fuel Standard Draft Rule Comment Follow-up 01/01/20 06/30/20 $45,000 Per Capita and Civil Penalties Phil Swartzendruber Termination Donahue, Goldberb, Weaver & Legal Services in connection with the Regional Clean $325/hr attorney 2020-034 12/19/19 with 30 day Legal Reserve Jennifer Dold Littleton Fuel Standard $50/hr paralegal notice Columbia-Willamette Clean Cities Implementing Western Washington Clean Cities $90,000 US Dept of Energy contract 2020-035 04/02/20 02/28/21 $110,000 Amy Fowler Coalition Coalition $20,000 Coalition Dues 2020-036 Neopost Postage Machine Lease Services 02/03/20 04/30/25 $298.00/month All Agency funding Andy Tudhope 2020-037 Gibbs Houston Pauw Agreement for Legal Services 02/24/20 04/30/20 $675 All agency funding (legal expenses) Heather Beckford Ecology Grant - OTGP-2020-PSCAA - 00024 / EPA 2020-038 Centerline Logistics Corp Marine Engine Replacements - CE Tug 12/02/20 09/30/21 $289,000 Amy Warren & State DERA funding Ecology Grant - OTGP-2020-PSCAA - 00024 / EPA 2020-039 Star Marine Inc Star Marine Engine Replacement 06/17/20 09/30/21 $294,000 Beth Carper & State DERA funding Ecology Grant - OTGP-2020-PSCAA - 00024 / EPA 2020-040 Western Tugboat Company Western Tugboat Engine Replacement 03/23/20 09/30/21 $152,000 Beth Carper & State DERA funding OTGP-2020-PSCAA-00024 (Ecology Harbor Vessel 2020-041 Foss Maritime TERMINATED TBD 12/30/20 $86,000 Eng Repl) and Beth Carper DE-01J40801 (EPA Harbov Vessel Eng Repl) 2020-042 Artifex Software, Inc. TERMINATED TBD 02/07/25 N/A N/A Clement Miege $340/hour 2020-043 Life Cycle Associates, LLC Consultant Support for PCHB Hearing 03/17/20 06/30/21 $230/hour other Legal Reserve Jennifer Dold services Renew/Replace lease for high volume color multi- 2020-044 Pacific Office Automation 03/03/20 03/03/25 $1885/month All Ageny Funding Andy Tudhope function copier/printers 2020-045 Montana Von Fliss Public Speaking Training 02/25/20 06/30/20 $4,150 Per Capita Tania Park 2020-046 Indian Type Foundry Poppins Font License 02/25/20 12/31/2090 N/A No funds exchanged Tania Park Cost Reimbursement Agreement for PSE-related 2020-047 Puget Sound Energy, Inc. 03/05/20 TBD $80,000 Reimbursed expenses Jennifer Dold PCHB Proceeding 2020-048 Just Health Action Duwamish Clean Air Program Coordination 05/21/20 06/20/21 $9,800 Per Capita Adam Petrusky 2 of 5 CONTRACTS INITIATED IN FY20 as of 3/9/21 PROJECT MGR/ NUMBER VENDOR/RECIPIENT DESCRIPTION/PROJECT START DATE EXPIRES AMOUNT FUND SOURCE CONTACT 2020-049 Compensation Connections LLC Classification and Compensation Study 03/23/20 09/30/20 $62,060 All Agency Funding Heather Beckford 2020-050 Summit Law PLLC Legal Services 03/19/20 04/30/20 $355/hour All Agency Funding Heather Beckford 2020-051 King County Metro ORCA Business Card Passport 05/01/20 04/30/21 $53,010 All Agency Funding Heather Beckford 2020-052 The Northwest Seaport Alliance Drayage Truck Education Outreach ILA TBD 06/30/21 $12,000 Ecology DPF Cleaning Grant (0026) Beth Carper Legal Services with Law Offices of Gibbs Houston 2020-053 Gibbs Houston Pauw 01/18/20 04/30/20 $675 All agency Funding Heather Beckford Pauw Legal Services with Law Offices of Gibbs Houston 2020-054 Gibbs Houston Pauw 04/23/20 05/30/20 $6,110 All agency Funding Heather Beckford Pauw 2020-055 $9,500 Duwamish River Cleanup Coalition Clean Air Program Coordination 08/04/20 06/30/21 Equity & Community Engagement Kelly O'Callahan 2020-055-1 $1,500 3 of 5 CONTRACTS INITIATED IN FY21 as of 3/9/21 PROJECT MGR/ NUMBER VENDOR/RECIPIENT DESCRIPTION/PROJECT START DATE EXPIRES AMOUNT FUND SOURCE CONTACT Legal Messenger Services - For the performance of 2021-001 ABC Legal Services process service, legal messenger, and investigation 07/01/20 06/30/21 $8,000 All Agency Funding Rob Switalski services Legal Messenger Services - For the performance of 2021-002 Apex Legal Services process service, legal messenger, and investigation 07/01/20 06/30/21 $3,000 All Agency Funding Rob Switalski services CyberSource Payment Solutions - On-line credit card 2021-003 CyberSource, a VISA Company TBD Perpetual Variable All Agency Funding Andy Tudhope processor ON HOLD Legal Services - law firm to provide legal services to 2021-004 Foster Garvey PC 07/01/20 06/30/21 Variable Legal Reserves (previously collected civil penalties) Jennifer Dold Agency in FY21 Filter Fan Project: Box Fan Acquisition MOA for box 2021-005 Moore Wright Group 02/04/21 06/30/21 N/A N/A : No funds exchanged Gail Pethe fans being received from the Moore Wright Group 2021-006 Zoom.us TERMINATED N/A N/A N/A N/A Tania Park James G Murphy Commercial - 10% of purchase 2021-007 Auction of Surplus Vehicle 41377 10/03/20 10/30/20 Proceeds come to PSCAA Rick Hess Industrial - Real Estate Auctioneers price 2020 Wildfire Smoke Exposure Reduction: Filter Fan 2021-008 Tacoma-Pierce County Health Dept 09/21/20 06/30/22 $26,100 Civil Penalties Gail Pethe Project $3,500 services 2021-009 Gibbs Houston Pauw Legal Services 09/21/20 06/30/21 All Agency funding Heather Beckford $2,460 fees Interlocal Agreement - Outdoor Burning Outreach / 2021-010 East Pierce Fire & Rescue 09/02/20 TBD N/A N/A: No funds exchanged Rick Hess Collaboration 2021-011 Archbright Professional Services - Management Training TBD 12/31/20 $4,288 All Agency Funding Heather Beckford 2021-012 Anu Taranath POC Affinity Group Facilitation 11/06/20 08/31/21 $16,000 Per Capita Tania Park 2021-013 Aparajeeta Duttchoudhury POC Affinity Group Facilitation 11/06/20 08/31/21 $16,000 Per Capita Tania Park 2021-014 Serena Maurer WARA Affinity Group Facilitation 11/06/20 08/31/21 $16,000 Per Capita Tania Park 2021-015 Archbright Reclaim Archbright L & I Claims Administration TBD 12/31/21 $2,700 Annually All Agency Funding Heather Beckford 2021-016 Sea Mar Clinic Asthma Pilot Project TBD 12/31/21 $8,000 Per Capita - EVJ Workplan Tania Park 2021-017 Puget Sound Energy TERMINATED TBD 11/30/23 $1,050/year Site lease rent (Monitoring Dept 425) Matt Harper Website Services (Provide continuing service & $40,000 2021-018 CivicPlus TBD 10/31/23 Fees / Per Capita (normal admin overhead split) Steve Van Slyke support for Agency website platform) estimated total Auburn Seventh-Day Adventist Site lease rent (Monitoring Dept 425) 2021-019 Auburn 29th St site to replace Auburn School District 02/04/21 12/01/25 $2,400 / year Matt Harper Church 29th St Portion paid for by Ecology PM 2.5 grant 2021-020 King County GHG Emissions Inventories TBD 12/31/21 $60,000 Per Capita Isha Khanna Cleaner Indoor Air During Wildfires Challenge Co- 2021-021 U.S. Environmental Protection Agency TBD TBD $0 N/A Joel Creswell Sponsorship Agreement 2021-022 Grist Public Affairs LLC Legislative Liaison Services 02/23/21 06/30/22 $43,200 FY21 Per Capita Jennifer Dold Classification and Compensation - Support 2021-023 Compensation Connections TBD 11/30/21 $10,000 max All Agency Funding Heather Beckford Consultation Page 4 of 5 CONTRACTS INITIATED IN FY21 as of 3/9/21 PROJECT MGR/ NUMBER VENDOR/RECIPIENT DESCRIPTION/PROJECT START DATE EXPIRES AMOUNT FUND SOURCE CONTACT Electric yard truck - Replace diesel yard truck with Ecology Grant 2021-024 IKEA TBD 06/30/22 $150,000 Beth Carper electric yard truck OTGP-2021-PSCAA-00042 Lift Truck Replacement - Replacing diesel yard truck Ecology Grant 2021-025 Northwest Seaports Alliance TBD 09/30/22 $147,000 Beth Carper with electric yard truck OTGP-2021-PSCAA-00042 Marine engine replacement - Will replace with 2 2021-026 Chichagof Fisheries, Inc TBD 06/30/22 $48,000 EPA Grant DE-01J40801 Beth Carper propulsion and 1 auxiliary engine James G Murphy Commercial - 10% of purchase 2021-027 Auction of Surplus Vehicle 71396 04/15/21 04/15/21 Agency receives auction proceeds Rick Hess Industrial - Real Estate Auctioneers price 2021-028 Villa Comunitaria Low-Income Electric Vehicle Carshare Program TBD 06/30/27 $80,000 Civil Penalties Sara Nichols Page 5 of 5