Anti-KPNA1 (aa 293-472) polyclonal antibody (DPABH-12265) This product is for research use only and is not intended for diagnostic use.

PRODUCT INFORMATION

Antigen Description Functions in nuclear import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the /substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non- classical NLS.

Immunogen Recombinant fragment corresponding to Human SRP1 aa 293-472. (BC002374).Sequence: IDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQS LLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTA EFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQV ALNGLENILRLGEQEAKRNG

Isotype IgG

Source/Host Rabbit

Species Reactivity Mouse, Human

Purification Immunogen affinity purified

Conjugate Unconjugated

Applications WB, IHC-P

Format Liquid

Size 100 μg

Buffer pH: 7.20; Constituents: 98% PBS, 1% BSA

Preservative 0.01% Sodium Azide

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]

Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved Storage Shipped at 4°C. Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

GENE INFORMATION

Gene Name KPNA1 karyopherin alpha 1 (importin alpha 6) [ Homo sapiens ]

Official Symbol KPNA1

Synonyms KPNA1; karyopherin alpha 1 (importin alpha 5); RCH2; SRP1; IPOA5; NPI-1; importin subunit alpha-5; SRP1-beta; importin alpha 5; importin-alpha-S1; RAG cohort protein 2; importin subunit alpha-1; nucleoprotein interactor 1; karyopherin subunit alpha-1; recombination activating gene cohort 2;

Entrez Gene ID 3836

Protein Refseq NP_002255.3

UniProt ID P52294

Pathway Activation of DNA fragmentation factor; Apoptosis; Apoptotic execution phase; Cytokine Signaling in Immune system

Function nuclear localization sequence binding; protein binding; protein transporter activity;

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]

Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved