Anti-KPNA1 (Aa 293-472) Polyclonal Antibody (DPABH-12265) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Total Page：16

File Type：pdf, Size：1020Kb

Anti-KPNA1 (aa 293-472) polyclonal antibody (DPABH-12265) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non- classical NLS. Immunogen Recombinant fragment corresponding to Human SRP1 aa 293-472. (BC002374).Sequence: IDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQS LLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTA EFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQV ALNGLENILRLGEQEAKRNG Isotype IgG Source/Host Rabbit Species Reactivity Mouse, Human Purification Immunogen affinity purified Conjugate Unconjugated Applications WB, IHC-P Format Liquid Size 100 μg Buffer pH: 7.20; Constituents: 98% PBS, 1% BSA Preservative 0.01% Sodium Azide 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved Storage Shipped at 4°C. Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. GENE INFORMATION Gene Name KPNA1 karyopherin alpha 1 (importin alpha 6) [ Homo sapiens ] Official Symbol KPNA1 Synonyms KPNA1; karyopherin alpha 1 (importin alpha 5); RCH2; SRP1; IPOA5; NPI-1; importin subunit alpha-5; SRP1-beta; importin alpha 5; importin-alpha-S1; RAG cohort protein 2; importin subunit alpha-1; nucleoprotein interactor 1; karyopherin subunit alpha-1; recombination activating gene cohort 2; Entrez Gene ID 3836 Protein Refseq NP_002255.3 UniProt ID P52294 Pathway Activation of DNA fragmentation factor; Apoptosis; Apoptotic execution phase; Cytokine Signaling in Immune system Function nuclear localization sequence binding; protein binding; protein transporter activity; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.

Copy Link

Recommended publications

KPNA1 Antibody Cat
KPNA1 Antibody Cat. No.: 5981 Western blot analysis of KPNA1 in Hela cell lysate with KPNA1 antibody at 1μg/mL. Immunocytochemistry of KPNA1 in HeLa cells with KPNA1 antibody at 2.5 μg/mL. Immunofluorescence of KPNA1 in K562 cells with KPNA1 antibody at 20 μg/mL. Specifications HOST SPECIES: Rabbit SPECIES REACTIVITY: Human, Mouse, Rat HOMOLOGY: Predicted species reactivity based on immunogen sequence: Bovine: (100%) KPNA1 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human KPNA1. IMMUNOGEN: The immunogen is located within amino acids 30 - 80 of KPNA1. TESTED APPLICATIONS: ELISA, ICC, IF, WB September 30, 2021 1 https://www.prosci-inc.com/kpna1-antibody-5981.html KPNA1 antibody can be used for detection of KPNA1 by Western blot at 1 μg/mL. Antibody can also be used for immunocytochemistry starting at 2.5 μg/mL. For immunofluorescence start at 20 μg/mL. APPLICATIONS: Antibody validated: Western Blot in human samples; Immunocytochemistry in human samples and Immunofluorescence in human samples. All other applications and species not yet tested. POSITIVE CONTROL: 1) Cat. No. 1201 - HeLa Cell Lysate 2) Cat. No. 17-001 - HeLa Cell Slide 3) Cat. No. 17-004 - K-562 Cell Slide Properties PURIFICATION: KPNA1 Antibody is affinity chromatography purified via peptide column. CLONALITY: Polyclonal ISOTYPE: IgG CONJUGATE: Unconjugated PHYSICAL STATE: Liquid BUFFER: KPNA1 Antibody is supplied in PBS containing 0.02% sodium azide. CONCENTRATION: 1 mg/mL KPNA1 antibody can be stored at 4˚C for three months and -20˚C, stable for up to one STORAGE CONDITIONS: year.
[Show full text]
Toxicogenomics Article
Toxicogenomics Article Discovery of Novel Biomarkers by Microarray Analysis of Peripheral Blood Mononuclear Cell Gene Expression in Benzene-Exposed Workers Matthew S. Forrest,1 Qing Lan,2 Alan E. Hubbard,1 Luoping Zhang,1 Roel Vermeulen,2 Xin Zhao,1 Guilan Li,3 Yen-Ying Wu,1 Min Shen,2 Songnian Yin,3 Stephen J. Chanock,2 Nathaniel Rothman,2 and Martyn T. Smith1 1School of Public Health, University of California, Berkeley, California, USA; 2Division of Cancer Epidemiology and Genetics, National Cancer Institute, Bethesda, Maryland, USA; 3National Institute of Occupational Health and Poison Control, Chinese Center for Disease Control and Prevention, Beijing, China were then ranked and selected for further exam- Benzene is an industrial chemical and component of gasoline that is an established cause of ination using several forms of statistical analysis. leukemia. To better understand the risk benzene poses, we examined the effect of benzene expo- We also specifically examined the expression sure on peripheral blood mononuclear cell (PBMC) gene expression in a population of shoe- of all cytokine genes on the array under the factory workers with well-characterized occupational exposures using microarrays and real-time a priori hypothesis that these key genes polymerase chain reaction (PCR). PBMC RNA was stabilized in the field and analyzed using a involved in immune function are likely to be comprehensive human array, the U133A/B Affymetrix GeneChip set. A matched analysis of six altered by benzene exposure (Aoyama 1986). exposed–control pairs was performed. A combination of robust multiarray analysis and ordering We then attempted to confirm the array find- of genes using paired t-statistics, along with bootstrapping to control for a 5% familywise error ings for the leading differentially expressed rate, was used to identify differentially expressed genes in a global analysis.
[Show full text]
Nuclear Import Protein KPNA7 and Its Cargos Acta Universitatis Tamperensis 2346
ELISA VUORINEN Nuclear Import Protein KPNA7 and its Cargos ELISA Acta Universitatis Tamperensis 2346 ELISA VUORINEN Nuclear Import Protein KPNA7 and its Cargos Diverse roles in the regulation of cancer cell growth, mitosis and nuclear morphology AUT 2346 AUT ELISA VUORINEN Nuclear Import Protein KPNA7 and its Cargos Diverse roles in the regulation of cancer cell growth, mitosis and nuclear morphology ACADEMIC DISSERTATION To be presented, with the permission of the Faculty Council of the Faculty of Medicine and Life Sciences of the University of Tampere, for public discussion in the auditorium F114 of the Arvo building, Arvo Ylpön katu 34, Tampere, on 9 February 2018, at 12 o’clock. UNIVERSITY OF TAMPERE ELISA VUORINEN Nuclear Import Protein KPNA7 and its Cargos Diverse roles in the regulation of cancer cell growth, mitosis and nuclear morphology Acta Universitatis Tamperensis 2346 Tampere University Press Tampere 2018 ACADEMIC DISSERTATION University of Tampere, Faculty of Medicine and Life Sciences Finland Supervised by Reviewed by Professor Anne Kallioniemi Docent Pia Vahteristo University of Tampere University of Helsinki Finland Finland Docent Maria Vartiainen University of Helsinki Finland The originality of this thesis has been checked using the Turnitin OriginalityCheck service in accordance with the quality management system of the University of Tampere. Copyright ©2018 Tampere University Press and the author Cover design by Mikko Reinikka Acta Universitatis Tamperensis 2346 Acta Electronica Universitatis Tamperensis 1851 ISBN 978-952-03-0641-0 (print) ISBN 978-952-03-0642-7 (pdf) ISSN-L 1455-1616 ISSN 1456-954X ISSN 1455-1616 http://tampub.uta.fi Suomen Yliopistopaino Oy – Juvenes Print Tampere 2018 441 729 Painotuote CONTENTS List of original communications ................................................................................................
[Show full text]
Supplementary Table S4. FGA Co-Expressed Gene List in LUAD
Supplementary Table S4. FGA co-expressed gene list in LUAD tumors Symbol R Locus Description FGG 0.919 4q28 fibrinogen gamma chain FGL1 0.635 8p22 fibrinogen-like 1 SLC7A2 0.536 8p22 solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 DUSP4 0.521 8p12-p11 dual specificity phosphatase 4 HAL 0.51 12q22-q24.1histidine ammonia-lyase PDE4D 0.499 5q12 phosphodiesterase 4D, cAMP-specific FURIN 0.497 15q26.1 furin (paired basic amino acid cleaving enzyme) CPS1 0.49 2q35 carbamoyl-phosphate synthase 1, mitochondrial TESC 0.478 12q24.22 tescalcin INHA 0.465 2q35 inhibin, alpha S100P 0.461 4p16 S100 calcium binding protein P VPS37A 0.447 8p22 vacuolar protein sorting 37 homolog A (S. cerevisiae) SLC16A14 0.447 2q36.3 solute carrier family 16, member 14 PPARGC1A 0.443 4p15.1 peroxisome proliferator-activated receptor gamma, coactivator 1 alpha SIK1 0.435 21q22.3 salt-inducible kinase 1 IRS2 0.434 13q34 insulin receptor substrate 2 RND1 0.433 12q12 Rho family GTPase 1 HGD 0.433 3q13.33 homogentisate 1,2-dioxygenase PTP4A1 0.432 6q12 protein tyrosine phosphatase type IVA, member 1 C8orf4 0.428 8p11.2 chromosome 8 open reading frame 4 DDC 0.427 7p12.2 dopa decarboxylase (aromatic L-amino acid decarboxylase) TACC2 0.427 10q26 transforming, acidic coiled-coil containing protein 2 MUC13 0.422 3q21.2 mucin 13, cell surface associated C5 0.412 9q33-q34 complement component 5 NR4A2 0.412 2q22-q23 nuclear receptor subfamily 4, group A, member 2 EYS 0.411 6q12 eyes shut homolog (Drosophila) GPX2 0.406 14q24.1 glutathione peroxidase
[Show full text]
Diversification of Importin-Α Isoforms in Cellular Trafficking and Disease States
Thomas Jefferson University Jefferson Digital Commons Department of Biochemistry and Molecular Biology Department of Biochemistry and Molecular Biology Faculty Papers 2-15-2015 Diversification of importin-α isoforms in cellular trafficking and disease states. Ruth A. Pumroy Thomas Jefferson University, [email protected] Gino Cingolani Thomas Jefferson University, [email protected] Let us know how access to this document benefits ouy Follow this and additional works at: https://jdc.jefferson.edu/bmpfp Part of the Medical Biochemistry Commons Recommended Citation Pumroy, Ruth A. and Cingolani, Gino, "Diversification of importin-α isoforms in cellular trafficking and disease states." (2015). Department of Biochemistry and Molecular Biology Faculty Papers. Paper 107. https://jdc.jefferson.edu/bmpfp/107 This Article is brought to you for free and open access by the Jefferson Digital Commons. The effeJ rson Digital Commons is a service of Thomas Jefferson University's Center for Teaching and Learning (CTL). The ommonC s is a showcase for Jefferson books and journals, peer-reviewed scholarly publications, unique historical collections from the University archives, and teaching tools. The effeJ rson Digital Commons allows researchers and interested readers anywhere in the world to learn about and keep up to date with Jefferson scholarship. This article has been accepted for inclusion in Department of Biochemistry and Molecular Biology Faculty Papers by an authorized administrator of the Jefferson Digital Commons. For more information, please contact: [email protected]. HHS Public Access Author manuscript Author Manuscript Author ManuscriptBiochem Author Manuscript J. Author manuscript; Author Manuscript available in PMC 2015 April 21. Published in final edited form as: Biochem J.
[Show full text]
Role and Regulation of the P53-Homolog P73 in the Transformation of Normal Human Fibroblasts
Role and regulation of the p53-homolog p73 in the transformation of normal human fibroblasts Dissertation zur Erlangung des naturwissenschaftlichen Doktorgrades der Bayerischen Julius-Maximilians-Universität Würzburg vorgelegt von Lars Hofmann aus Aschaffenburg Würzburg 2007 Eingereicht am Mitglieder der Promotionskommission: Vorsitzender: Prof. Dr. Dr. Martin J. Müller Gutachter: Prof. Dr. Michael P. Schön Gutachter : Prof. Dr. Georg Krohne Tag des Promotionskolloquiums: Doktorurkunde ausgehändigt am Erklärung Hiermit erkläre ich, dass ich die vorliegende Arbeit selbständig angefertigt und keine anderen als die angegebenen Hilfsmittel und Quellen verwendet habe. Diese Arbeit wurde weder in gleicher noch in ähnlicher Form in einem anderen Prüfungsverfahren vorgelegt. Ich habe früher, außer den mit dem Zulassungsgesuch urkundlichen Graden, keine weiteren akademischen Grade erworben und zu erwerben gesucht. Würzburg, Lars Hofmann Content SUMMARY ................................................................................................................ IV ZUSAMMENFASSUNG ............................................................................................. V 1. INTRODUCTION ................................................................................................. 1 1.1. Molecular basics of cancer .......................................................................................... 1 1.2. Early research on tumorigenesis ................................................................................. 3 1.3. Developing
[Show full text]
Karyopherin Alpha 1 Regulates Satellite Cell Proliferation And
Karyopherin Alpha 1 Regulates Satellite Cell Proliferation and Survival By Modulating Nuclear Import Hyojung Choo, Emory University Alicia Cutler, Emory University Franziska Rother, Max-Delbrück-Center for Molecular Medicine Michael Bader, Max-Delbrück-Center for Molecular Medicine Grace Pavlath, Emory University Journal Title: STEM CELLS Volume: Volume 34, Number 11 Publisher: AlphaMed Press | 2016-11-01, Pages 2784-2797 Type of Work: Article | Post-print: After Peer Review Publisher DOI: 10.1002/stem.2467 Permanent URL: https://pid.emory.edu/ark:/25593/s324r Final published version: http://dx.doi.org/10.1002/stem.2467 Copyright information: © 2016 AlphaMed Press Accessed September 23, 2021 10:27 AM EDT HHS Public Access Author manuscript Author ManuscriptAuthor Manuscript Author Stem Cells Manuscript Author . Author manuscript; Manuscript Author available in PMC 2017 June 01. Published in final edited form as: Stem Cells. 2016 November ; 34(11): 2784–2797. doi:10.1002/stem.2467. Karyopherin alpha 1 regulates satellite cell proliferation and survival by modulating nuclear import Hyo-Jung Choo1,*, Alicia Cutler1,2, Franziska Rother3, Michael Bader3, and Grace K. Pavlath1,* 1Department of Pharmacology, Emory University, Atlanta, GA 30322, USA 2Graduate Program in Biochemistry, Cell and Developmental Biology, Emory University, Atlanta, GA 30322, USA 3Max-Delbrück-Center for Molecular Medicine, Berlin-Buch, Germany Abstract Satellite cells are stem cells with an essential role in skeletal muscle repair. Precise regulation of gene expression is critical for proper satellite cell quiescence, proliferation, differentiation and self -renewal. Nuclear proteins required for gene expression are dependent on the nucleocytoplasmic transport machinery to access to nucleus, however little is known about regulation of nuclear transport in satellite cells.
[Show full text]
Nuclear Import of Prototype Foamy Virus Transactivator Bel1 Is Mediated by KPNA1, KPNA6 and KPNA7
INTERNATIONAL JOURNAL OF MOLECULAR MEDICINE 38: 399-406, 2016 Nuclear import of prototype foamy virus transactivator Bel1 is mediated by KPNA1, KPNA6 and KPNA7 JIHUI DUAN, ZHIQIN TANG, HONG MU and GUOJUN ZHANG Clinical Laboratory, Tianjin First Center Hospital, Tianjin 300192, P.R. China Received October 9, 2015; Accepted May 31, 2016 DOI: 10.3892/ijmm.2016.2635 Abstract. Bel1, a transactivator of the prototype foamy PFV promoters, LTR and IP (7-9). Similar to most typical virus (PFV), plays pivotal roles in the replication of PFV. transcriptional activators, nuclear localization is required for Previous studies have demonstrated that Bel1 bears a nuclear the transactivation activity of Bel1 (10). Bel1 bears a putative localization signal (NLS); however, its amino acid sequence nuclear localization signal (NLS) in the central highly basic remains unclear and the corresponding adaptor importins have region (11,12). Earlier studies have indicated that peptide 211-225 not yet been identified. In this study, we inserted various frag- and/or 209-226 are necessary and sufficient for Bel1 nuclear ments of Bel1 into an EGFP-GST fusion protein and investigated localization (13-15). Later studies demonstrated that another their subcellular localization by fluorescence microscopy. We two basic amino acids, R199H200, also regulate Bel1 nuclear found that the 215PRQKRPR221 fragment, which accords with localization, which suggests that Bel1 carries a bipartite NLS the consensus sequence K(K/R)X(K/R) of the monopartite consisting of residues 199-200 and residues 211-223 (10,16). NLS, directed the nuclear translocation of Bel1. Point mutation However, Ma et al further found that residues R221R222R223, experiments revealed that K218, R219 and R221 were essential for but not R199H200, are essential for the nuclear distribution of the nuclear localization of Bel1.
[Show full text]
Supp Data.Pdf
Supplementary Methods Verhaak sub-classification The Verhaak called tumor subtype was assigned as determined in the Verhaak et al. manuscript, for those TCGA tumors that were included at the time. TCGA data for expression (Affymetrix platform, level 1) and methylation (Infinium platform level 3) were downloaded from the TCGA portal on 09/29/2011. Affymetrix data were processed using R and Biocondutor with a RMA algorithm using quantile normalization and custom CDF. Level 3 methylation data has already been processed and converted to a beta-value. The genes that make up the signature for each of the 4 Verhaak groups (i.e. Proneural, Neural, Mesenchymal, and Classical) were downloaded. For each tumor, the averaged expression of the 4 genes signatures was calculated generating 4 ‘metagene’ scores, one for each subtype, (Colman et al.2010) for every tumor. Then each subtype metagene score was z-score corrected to allow comparison among the 4 metagenes. Finally, for each tumor the subtype with the highest metagene z-score among the four was used to assign subtype. Thus by this method, a tumor is assigned to the group to which it has the strongest expression signature. The shortcoming is that if a tumor has a ‘dual personality’ – for instance has strong expression of both classical and mesenchymal signature genes, there is some arbitrariness to the tumor’s assignment. Western Blot Analysis and cell fractionation Western blot analysis was performed using standard protocols. To determine protein expression we used the following antibodies: TAZ (Sigma and BD Biosciences), YAP (Santa Cruz Biotechnology), CD44 (Cell Signaling), FN1 (BD Biosciences), TEAD1, TEAD2, TEAD3, TEAD4 (Santa Cruz Biotechnology), MST1, p-MST1, MOB1, LATS1, LATS2, 14-3-3-, 1 ACTG2, (Cell Signaling), p-LATS1/2 (Abcam), Flag (Sigma Aldrich), Actin (Calbiochem), CAV2 (BD Biosciences), CTGF (Santa Cruz), RUNX2 (Sigma Aldrich), Cylin A, Cyclin E, Cyclin B1, p-cdk1, p-cdk4 (Cell Signaling Technologies).
[Show full text]
Inhibition of Karyopherin-Α2 Augments Radiation-Induced Cell Death by Perturbing BRCA1-Mediated DNA Repair
International Journal of Molecular Sciences Article Inhibition of Karyopherin-α2 Augments Radiation-Induced Cell Death by Perturbing BRCA1-Mediated DNA Repair Kyung-Hee Song 1,2 , Seung-Youn Jung 1, Jeong-In Park 1, Jiyeon Ahn 1, Jong Kuk Park 1, Hong-Duck Um 1, In-Chul Park 1, Sang-Gu Hwang 1, Hunjoo Ha 2,* and Jie-Young Song 1,* 1 Division of Radiation Biomedical Research, Korea Institute of Radiological & Medical Sciences, Seoul 01812, Korea; [email protected] (K.-H.S.); [email protected] (S.-Y.J.); [email protected] (J.-I.P.); [email protected] (J.A.); [email protected] (J.K.P.); [email protected] (H.-D.U.); [email protected] (I.-C.P.); [email protected] (S.-G.H.) 2 Graduate School of Pharmaceutical Sciences, College of Pharmacy, Ewha Womans University, Seoul 03760, Korea * Correspondence: [email protected] (H.H.); [email protected] (J.-Y.S.); Tel.: +82-232-774-075 (H.H.); +82-2970-1308 (J.-Y.S.) Received: 3 May 2019; Accepted: 11 June 2019; Published: 11 June 2019 Abstract: Ionizing radiation (IR) has been widely used in the treatment of cancer. Radiation-induced DNA damage triggers the DNA damage response (DDR), which can confer radioresistance and early local recurrence by activating DNA repair pathways. Since karyopherin-α2 (KPNA2), playing an important role in nucleocytoplasmic transport, was signiﬁcantly increased by IR in our previous study, we aimed to determine the function of KPNA2 with regard to DDR. Exposure to radiation upregulated KPNA2 expression in human colorectal cancer HT29 and HCT116 cells and breast carcinoma MDA-MB-231 cells together with the increased expression of DNA repair protein BRCA1.
[Show full text]
Computational Simulations to Predict Creatine Kinase-Associated Factors: Protein-Protein Interaction Studies of Brain and Muscle Types of Creatine Kinases
SAGE-Hindawi Access to Research Enzyme Research Volume 2011, Article ID 328249, 12 pages doi:10.4061/2011/328249 Research Article Computational Simulations to Predict Creatine Kinase-Associated Factors: Protein-Protein Interaction Studies of Brain and Muscle Types of Creatine Kinases Wei-Jiang Hu,1 Sheng-Mei Zhou,2 Joshua SungWoo Yang,3, 4 and Fan-Guo Meng1 1 Zhejiang Provincial Key Laboratory of Applied Enzymology, Yangtze Delta Region Institute of Tsinghua University, Jiaxing 314006, China 2 College of Biology and Chemical Engineering, Jiaxing University, Jiaxing 314001, China 3 Korean Bioinformation Center (KOBIC), Korea Research Institute of Bioscience & Biotechnology (KRIBB), Daejeon 305-806, Republic of Korea 4 Department of Bioinformatics, University of Sciences & Technology, Daejeon 205-305, Republic of Korea Correspondence should be addressed to Fan-Guo Meng, [email protected] Received 17 May 2011; Accepted 26 May 2011 Academic Editor: Jun-Mo Yang Copyright © 2011 Wei-Jiang Hu et al. This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Creatine kinase (CK; EC 2.7.3.2) is related to several skin diseases such as psoriasis and dermatomyositis. CK is important in skin energy homeostasis because it catalyzes the reversible transfer of a phosphoryl group from MgATP to creatine. In this study, we predicted CK binding proteins via the use of bioinformatic tools such as protein-protein interaction (PPI) mappings and suggest the putative hub proteins for CK interactions. We obtained 123 proteins for brain type CK and 85 proteins for muscle type CK in the interaction networks.
[Show full text]
Cytosolic Calcium Regulates Cytoplasmic Accumulation of TDP-43 Through Calpain-A and Importin A3
RESEARCH ARTICLE Cytosolic calcium regulates cytoplasmic accumulation of TDP-43 through Calpain-A and Importin a3 Jeong Hyang Park1,2†, Chang Geon Chung1,2†, Sung Soon Park1,2, Davin Lee1,2, Kyung Min Kim1,3, Yeonjin Jeong1,2, Eun Seon Kim1,4, Jae Ho Cho1,2, Yu-Mi Jeon4, C-K James Shen5, Hyung-Jun Kim4, Daehee Hwang3*, Sung Bae Lee1,2,4* 1Department of Brain & Cognitive Sciences, DGIST, Daegu, Republic of Korea; 2Protein dynamics-based proteotoxicity control laboratory, Basic research lab, DGIST, Daegu, Republic of Korea; 3School of Biological Sciences, Seoul National University, Seoul, Republic of Korea; 4Dementia research group, Korea Brain Research Institute (KBRI), Daegu, Republic of Korea; 5Taipei Medical University/ Institute of Molecular Biology, Academia Sinica, Taipei, Taiwan Abstract Cytoplasmic accumulation of TDP-43 in motor neurons is the most prominent pathological feature in amyotrophic lateral sclerosis (ALS). A feedback cycle between nucleocytoplasmic transport (NCT) defect and TDP-43 aggregation was shown to contribute to accumulation of TDP-43 in the cytoplasm. However, little is known about cellular factors that can control the activity of NCT, thereby affecting TDP-43 accumulation in the cytoplasm. Here, we identified via FRAP and optogenetics cytosolic calcium as a key cellular factor controlling NCT of TDP-43. Dynamic and reversible changes in TDP-43 localization were observed in Drosophila sensory neurons during development. Genetic and immunohistochemical analyses identified the *For correspondence: cytosolic calcium-Calpain-A-Importin a3 pathway as a regulatory mechanism underlying NCT of [email protected] (DH); TDP-43. In C9orf72 ALS fly models, upregulation of the pathway activity by increasing cytosolic [email protected] (SBL) calcium reduced cytoplasmic accumulation of TDP-43 and mitigated behavioral defects.
[Show full text]