Anti-KPNA1 (aa 293-472) polyclonal antibody (DPABH-12265) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non- classical NLS. Immunogen Recombinant fragment corresponding to Human SRP1 aa 293-472. (BC002374).Sequence: IDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQS LLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTA EFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQV ALNGLENILRLGEQEAKRNG Isotype IgG Source/Host Rabbit Species Reactivity Mouse, Human Purification Immunogen affinity purified Conjugate Unconjugated Applications WB, IHC-P Format Liquid Size 100 μg Buffer pH: 7.20; Constituents: 98% PBS, 1% BSA Preservative 0.01% Sodium Azide 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved Storage Shipped at 4°C. Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. GENE INFORMATION Gene Name KPNA1 karyopherin alpha 1 (importin alpha 6) [ Homo sapiens ] Official Symbol KPNA1 Synonyms KPNA1; karyopherin alpha 1 (importin alpha 5); RCH2; SRP1; IPOA5; NPI-1; importin subunit alpha-5; SRP1-beta; importin alpha 5; importin-alpha-S1; RAG cohort protein 2; importin subunit alpha-1; nucleoprotein interactor 1; karyopherin subunit alpha-1; recombination activating gene cohort 2; Entrez Gene ID 3836 Protein Refseq NP_002255.3 UniProt ID P52294 Pathway Activation of DNA fragmentation factor; Apoptosis; Apoptotic execution phase; Cytokine Signaling in Immune system Function nuclear localization sequence binding; protein binding; protein transporter activity; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.