DOCSLIB.ORG

Species Commonname Accession Seqstart Seqcomment Class Order

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Species Commonname Accession Seqstart Seqcomment Class Order Species CommonName Accession SeqStart SeqComment Class Order Annotation Anabas testudineus climbing perch XP_026222100.1 MSRRKQAKPRSVKAVEEGESSECGGTWDESTVQTEVPASMSRRK has wide phylogeny Actinopterygii Anabantiformes zinc finger protein 423 Gouania willdenowi blunt-snouted clingfish XP_028305499.1 MSRRKQAKPRSVKVEEGESSECGGTWDESTLQTEVPVMSRRK has wide phylogeny Actinopterygii Blenniiformes zinc finger protein 423 isoform X2 Salarias fasciatus jewelled blenny XP_029952236.1 MSRRKQAKPRSVKVEEGESSECGGTWDESTVQTDVLASMSRRK has wide phylogeny Actinopterygii Blenniiformes zinc finger protein 423 isoform X2 Echeneis naucrates live sharksucker XP_029379029.1 MSRRKQAKPRSVKAVEEGESSECGGTWDESTVQTEVPASMSRRK has wide phylogeny Actinopterygii Carangiformes zinc finger protein 423 Astyanax meXicanus blind cave fish XP_007249250.1 MSRRKQAKPRSVKAVEEADSAEFTGSWDSTTAADAAVMSRRK has wide phylogeny Actinopterygii Characiformes PREDICTED: zinc finger protein 423 isoform X2 Pygocentrus nattereri red piranha XP_017546794.1 MSRRKQAKPRSVKAVDEAESAEFTSSWDSSAPADVAVMSRRK has wide phylogeny Actinopterygii Characiformes PREDICTED: zinc finger protein 423 isoform X3 Astatotilapia calliptera eastern happy XP_026032600.1 MSRRKQAKPRSVKAVEEGESSECGGTWDGSTVQTDVAAMSRRK has wide phylogeny Actinopterygii Cichliformes zinc finger protein 423 isoform X1 Haplochromis burtoni Burton's mouthbrooder XP_005945132.1 MSRRKQAKPRSVKAVEEGESSECGGTWDGSTVQTDVAAMSRRK has wide phylogeny Actinopterygii Cichliformes PREDICTED: zinc finger protein 423 isoform X2 Maylandia zebra Malawi blue cichlid XP_004569239.1 MSRRKQAKPRSVKAVEEGESSECGGTWDGSTVQTDVAAMSRRK has wide phylogeny Actinopterygii Cichliformes PREDICTED: zinc finger protein 423 isoform X2 Oreochromis niloticus Nile tilapia XP_005463110.1 MSRRKQAKPRSVKAVEEGESSECGGTWDGSTVQTDIVAMSRRK has wide phylogeny Actinopterygii Cichliformes PREDICTED: zinc finger protein 423 isoform X2 Pundamilia nyererei cichlid XP_005752889.1 MSRRKQAKPRSVKAVEEGESSECGGTWDGSTVQTDVAAMSRRK has wide phylogeny Actinopterygii Cichliformes PREDICTED: zinc finger protein 423 isoform X2 Clupea harengus Atlantic herring XP_012674128.1 MKTSPVEEGETSTEFAGSWDSSSVQTDVPAQOutlier - dubious first eXon Actinopterygii Clupeiformes PREDICTED: zinc finger protein 423 Denticeps clupeoides denticle herring XP_028813434.1 MSRRKQAKPRSVKAVEEGETSEFTGTWDSSSVQTDVPAPMSRRK has wide phylogeny Actinopterygii Clupeiformes zinc finger protein 423 isoform X4 Carassius auratus goldfish XP_026143205.1 MSRRKQAKPRSVKAVEEAESTECASGWDSSVQTDAAVMSRRK has wide phylogeny Actinopterygii Cypriniformes zinc finger protein 423 isoform X2 Danio rerio zebra fish NP_001073499 MSRRKQAKPRSVKAVEEAESTECASGWDSSVQTDAAVMSRRK has wide phylogeny Actinopterygii Cypriniformes zinc finger protein 423 Sinocyclocheilus rhinocerous cavefish XP_016406056.1 MSRRKQAKPRSVKAVEEAESTECASGWDSSVHTDAAVMSRRK has wide phylogeny Actinopterygii Cypriniformes PREDICTED: zinc finger protein 423 isoform X2 Austrofundulus limnaeus killifish XP_013883935.1 MSRRKQAKPRSVKAVEEGESLECGGTWEEAAVHTVPTSMSRRK has wide phylogeny Actinopterygii Cyprinodontiformes PREDICTED: zinc finger protein 423 Nothobranchius furzeri turquoise killifish XP_015820603.1 MSRRKQAKPRSVKAVEEGESLECGGTWEKSAVQTEVPAMSRRK has wide phylogeny Actinopterygii Cyprinodontiformes PREDICTED: zinc finger protein 423 isoform X3 Poecilia formosa Amazon molly XP_007553223.1 MSRRKQAKPRSVKAVEEGESSDFAGNWDSSSIQTDAPVMSRRK has wide phylogeny Actinopterygii Cyprinodontiformes PREDICTED: zinc finger protein 423 isoform X2 Esox luciu northern pike XP_012994471.1 MSRRKQAKPRSVKAVEEGESSDFAGNWDSSSIQTDAPVMSRRK has wide phylogeny Actinopterygii Esociformes PREDICTED: zinc finger protein 423 Gadus morhua Atlantic cod XP_030222816.1 MSRRKQAKPRSVKVEDGESSECGGTWDESNVQTDVPAAMSRRK has wide phylogeny Actinopterygii Gadiformes zinc finger protein 423 isoform X2 Sphaeramia orbicularis orbiculate cardinalfish XP_029992001.1 MSRRKQAKPRSVKAVEEGESSECAGTWDESTVQTEVPASMSRRK has wide phylogeny Actinopterygii Kurtiformes zinc finger protein 423 isoform X1 Labrus bergylta ballan wrasse XP_020496130.1 MSRRKQAKPRSVKAVEEGESSECGGAWDESTVQTEVQASMSRRK has wide phylogeny Actinopterygii Labriformes zinc finger protein 423 isoform X1 Paramormyrops kingsleyae elephantfish (Mormyridae) XP_023683078.1 MSRRKQAKPRSVKVEEGESSEFAGTWESSSAHTDVPGMSRRK has wide phylogeny Actinopterygii Osteoglossiformes zinc finger protein 423 isoform X2 Scleropages formosus Asian bonytongue XP_018582161.1 MSRRKQAKPRSVKAVEEGQSSEFAGNWESSSVHTDVPGMSRRK has wide phylogeny Actinopterygii Osteoglossiformes PREDICTED: zinc finger protein 423 isoform X1 Cottoperca gobio Channel bull blenny XP_029289573.1 MSRRKQAKPRSVKAVEEGESSECRGTWDESTVQTEVPASMSRRK has wide phylogeny Actinopterygii Perciformes zinc finger protein 423 isoform X8 Lates calcarifer barramundi perch XP_018559066.1 MSRRKQAKPRSVKAVEEGESSECGGTWDESTVQTEVPASMSRRK has wide phylogeny Actinopterygii Perciformes PREDICTED: zinc finger protein 423 isoform X2 Perca flavescens yellow perch XP_028441398.1 MSRRKQAKPRSVKAVEEGESSECGGTWDESTVQTDVPAAMSRRK has wide phylogeny Actinopterygii Perciformes zinc finger protein 423 Sander lucioperca pike-perch XP_031150672.1 MSRRKQAKPRSVKAVEEGESSECGGTWDESTVQTDVPAAMSRRK has wide phylogeny Actinopterygii Perciformes zinc finger protein 423 isoform X2 Cynoglossus semilaevis tongue sole XP_008309482.1 MSRRKQAKPRSVKAVEEGESSECGGTWEESTVQTEVPASMSRRK has wide phylogeny Actinopterygii Pleuronectiformes PREDICTED: zinc finger protein 423 isoform X2 Oncorhynchus kisutch coho salmon XP_020336239.1 MSRRKQAKPRSVKAVEEGESSEFAGNWDSSSAQTDAPAVMSRRK has wide phylogeny Actinopterygii Salmoniformes zinc finger protein 423 Salmo salar Atlantic salmon XP_014004474.1 MSRRKQAKPRSVKAVEEGESSEFAGNWDSSSAQTDVPAVMSRRK has wide phylogeny Actinopterygii Salmoniformes PREDICTED: zinc finger protein 423 isoform X2 Lepisosteus oculatus spotted gar XP_015223950.1 MSRRKQAKPRSVKVEEGESSEFTGSWESSAVQTDVPGMSRRK has wide phylogeny Actinopterygii Semionotiformes PREDICTED: zinc finger protein 423 isoform X2 Ictalurus punctatus channel catfish XP_017322066.1 MSRRKQAKPRSVKAVEEADSAECAGSWDSSAPAAAVMSRRK has wide phylogeny Actinopterygii Siluriformes PREDICTED: zinc finger protein 423 isoform X1 Pangasianodon hypophthalmus striped catfish XP_026782950.1 MSRRKQAKPRSVKVEEADSAECAGSWDSSAPAGMSRRK has wide phylogeny Actinopterygii Siluriformes zinc finger protein 423 isoform X2 Tachysurus fulvidraco yellow catfish XP_027017463.1 MSRRKQAKPRSVKVEEADSAECTGSWDSSAPAAGMSRRK has wide phylogeny Actinopterygii Siluriformes zinc finger protein 423 isoform X2 Monopterus albus swamp eel XP_020459993.1 MSRRKQAKPRSVKAVEEGESSACGGAWDESSVQTEVPASMSRRK has wide phylogeny Actinopterygii Synbranchiformes zinc finger protein 423 isoform X1 Hippocampus comes Tiger tail seahorse XP_019712613.1 MSRRKQAKPRSVKAVEEGESSECGGASDESAVQTEVPASVMSRRK has wide phylogeny Actinopterygii Syngnathiformes PREDICTED: zinc finger protein 423 isoform Nanorana parkeri High Himalaya frog XP_018421247.1 MSRRKQAKPRSVKVEDSDDYSLNWDASLNQTGMSRRK has wide phylogeny Amphibia Anura PREDICTED: zinc finger protein 423 isoform X1 Xenopus laevis African clawed frog ACX34053.1 MSRRKQAKPRSVKVEDAEDFGLNWESTVNQTGMSRRK has wide phylogeny Amphibia Anura zinc finger protein 423 Xenopus tropicalis tropical clawed frog XP_002937417.2 MSRRKQAKPRSVKVEDSEDFGLNWESTVTQAGMSRRK has wide phylogeny Amphibia Anura PREDICTED: zinc finger protein 423 isoform X1 Rhinatrema bivittatum two-lined caecilian XP_029464349.1 MSRRKQAKPRSVKVEEGESSEFTLTWDSSLAQSAGLGMSRRK has wide phylogeny Amphibia Gymnophiona zinc finger protein 423 isoform X1 Aquila chrysaetos canadensis Golden eagle XP_011572356.1 MEDESIYTCDNCQQDFD Starts in consensus eXon 3 Aves Accipitriformes PREDICTED: zinc finger protein 423 isoform X1 Haliaeetus leucocephalus bald eagle XP_010583329.1 MEDESIYTCDNCQQDFD Starts in consensus eXon 3 Aves Accipitriformes PREDICTED: zinc finger protein 423 Anas platyrhynchos mallard XP_027322993.1 MSRRKQAKPRSVKVEEGESSDFALNWVSSVTQSGMSRRK has wide phylogeny Aves Anseriformes zinc finger protein 423 isoform X1 Anser cygnoides domesticus swan goose XP_013042328.1 MLTEIPVDVGGPRASLVEEGESSDFALNWDSSVTQSGOutlier - dubious first eXon Aves Anseriformes PREDICTED: zinc finger protein 423 isoform X3 Calypte anna Anna's hummingbird XP_030313813.1 MSRRKQAKPRSVKVEEGESSDFGLTWDSSVTQSGMSRRK has wide phylogeny Aves Apodiformes zinc finger protein 423 isoform X1 Chaetura pelagica chimney swift XP_009995757.1 MEDESIYTCDNCQQDFD Starts in consensus eXon 3 Aves Apodiformes PREDICTED: zinc finger protein 423 ApteryX australis mantelli kiwi XP_013796535.1 MEDESIYTCDNCQQDFD Starts in consensus eXon 3 Aves Apterygiformes PREDICTED: zinc finger protein 423 isoform X3 Calidris pugnax ruff XP_014797662.1 MEDESIYTCDNCQQDFD Starts in consensus eXon 3 Aves Charadriiformes PREDICTED: zinc finger protein 423 isoform X1 Charadrius vociferus killdeer XP_009883374.1 MEDESIYTCDNCQQDFD Starts in consensus eXon 3 Aves Charadriiformes PREDICTED: zinc finger protein 423 Cuculus canorus common cuckoo XP_009569503.1 MEDESIYTCDNCQQDFD Starts in consensus eXon 3 Aves Cuculiformes PREDICTED: zinc finger protein 423 Falco cherrug Saker falcon XP_005444663.1 MEDESIYTCDNCQQDFD Starts in consensus eXon 3 Aves Falconiformes zinc finger protein 423 isoform X2 CoturniX japonica Japanese quail XP_015728976.1 MSRRKQAKPRSVKVEEGESSDFALNWDSSVTQSGMSRRK has wide phylogeny Aves Galliformes PREDICTED: zinc finger protein 423 isoform X3 Gallus gallus chicken XP_414103.3 MSRRKQAKPRSVKVEEGESSDFALNWDSSVTQSGMSRRK has wide phylogeny Aves Galliformes PREDICTED: zinc finger protein 423 isoform X3 Numida meleagris
Load more

Recommended publications
  • European Anchovy Engraulis Encrasicolus (Linnaeus, 1758) From
    European anchovy Engraulis encrasicolus (Linnaeus, 1758) from the Gulf of Annaba, east Algeria: age, growth, spawning period, condition factor and mortality Nadira Benchikh, Assia Diaf, Souad Ladaimia, Fatma Z. Bouhali, Amina Dahel, Abdallah B. Djebar Laboratory of Ecobiology of Marine and Littoral Environments, Department of Marine Science, Faculty of Science, University of Badji Mokhtar, Annaba, Algeria. Corresponding author: N. Benchikh, [email protected] Abstract. Age, growth, spawning period, condition factor and mortality were determined in the European anchovy Engraulis encrasicolus populated the Gulf of Annaba, east Algeria. The age structure of the total population is composed of 59.1% females, 33.5% males and 7.4% undetermined. The size frequency distribution method shows the existence of 4 cohorts with lengths ranging from 8.87 to 16.56 cm with a predominance of age group 3 which represents 69.73% followed by groups 4, 2 and 1 with respectively 19.73, 9.66 and 0.88%. The VONBIT software package allowed us to estimate the growth parameters: asymptotic length L∞ = 17.89 cm, growth rate K = 0.6 year-1 and t0 = -0.008. The theoretical maximum age or tmax is 4.92 years. The height-weight relationship shows that growth for the total population is a major allometry. Spawning takes place in May, with a gonado-somatic index (GSI) of 4.28% and an annual mean condition factor (K) of 0.72. The total mortality (Z), natural mortality (M) and fishing mortality (F) are 2.31, 0.56 and 1.75 year-1 respectively, with exploitation rate E = F/Z is 0.76 is higher than the optimal exploitation level of 0.5.
    [Show full text]
  • CAT Vertebradosgt CDC CECON USAC 2019
    Catálogo de Autoridades Taxonómicas de vertebrados de Guatemala CDC-CECON-USAC 2019 Centro de Datos para la Conservación (CDC) Centro de Estudios Conservacionistas (Cecon) Facultad de Ciencias Químicas y Farmacia Universidad de San Carlos de Guatemala Este documento fue elaborado por el Centro de Datos para la Conservación (CDC) del Centro de Estudios Conservacionistas (Cecon) de la Facultad de Ciencias Químicas y Farmacia de la Universidad de San Carlos de Guatemala. Guatemala, 2019 Textos y edición: Manolo J. García. Zoólogo CDC Primera edición, 2019 Centro de Estudios Conservacionistas (Cecon) de la Facultad de Ciencias Químicas y Farmacia de la Universidad de San Carlos de Guatemala ISBN: 978-9929-570-19-1 Cita sugerida: Centro de Estudios Conservacionistas [Cecon]. (2019). Catálogo de autoridades taxonómicas de vertebrados de Guatemala (Documento técnico). Guatemala: Centro de Datos para la Conservación [CDC], Centro de Estudios Conservacionistas [Cecon], Facultad de Ciencias Químicas y Farmacia, Universidad de San Carlos de Guatemala [Usac]. Índice 1. Presentación ............................................................................................ 4 2. Directrices generales para uso del CAT .............................................. 5 2.1 El grupo objetivo ..................................................................... 5 2.2 Categorías taxonómicas ......................................................... 5 2.3 Nombre de autoridades .......................................................... 5 2.4 Estatus taxonómico
    [Show full text]
  • Phylogeny Classification Additional Readings Clupeomorpha and Ostariophysi
    Teleostei - AccessScience from McGraw-Hill Education http://www.accessscience.com/content/teleostei/680400 (http://www.accessscience.com/) Article by: Boschung, Herbert Department of Biological Sciences, University of Alabama, Tuscaloosa, Alabama. Gardiner, Brian Linnean Society of London, Burlington House, Piccadilly, London, United Kingdom. Publication year: 2014 DOI: http://dx.doi.org/10.1036/1097-8542.680400 (http://dx.doi.org/10.1036/1097-8542.680400) Content Morphology Euteleostei Bibliography Phylogeny Classification Additional Readings Clupeomorpha and Ostariophysi The most recent group of actinopterygians (rayfin fishes), first appearing in the Upper Triassic (Fig. 1). About 26,840 species are contained within the Teleostei, accounting for more than half of all living vertebrates and over 96% of all living fishes. Teleosts comprise 517 families, of which 69 are extinct, leaving 448 extant families; of these, about 43% have no fossil record. See also: Actinopterygii (/content/actinopterygii/009100); Osteichthyes (/content/osteichthyes/478500) Fig. 1 Cladogram showing the relationships of the extant teleosts with the other extant actinopterygians. (J. S. Nelson, Fishes of the World, 4th ed., Wiley, New York, 2006) 1 of 9 10/7/2015 1:07 PM Teleostei - AccessScience from McGraw-Hill Education http://www.accessscience.com/content/teleostei/680400 Morphology Much of the evidence for teleost monophyly (evolving from a common ancestral form) and relationships comes from the caudal skeleton and concomitant acquisition of a homocercal tail (upper and lower lobes of the caudal fin are symmetrical). This type of tail primitively results from an ontogenetic fusion of centra (bodies of vertebrae) and the possession of paired bracing bones located bilaterally along the dorsal region of the caudal skeleton, derived ontogenetically from the neural arches (uroneurals) of the ural (tail) centra.
    [Show full text]
  • Blenniiformes, Tripterygiidae) from Taiwan
    A peer-reviewed open-access journal ZooKeys 216: 57–72 (2012) A new species of the genus Helcogramma from Taiwan 57 doi: 10.3897/zookeys.216.3407 RESEARCH articLE www.zookeys.org Launched to accelerate biodiversity research A new species of the genus Helcogramma (Blenniiformes, Tripterygiidae) from Taiwan Min-Chia Chiang1,†, I-Shiung Chen1,2,‡ 1 Institute of Marine Biology, National Taiwan Ocean University, Keelung 202, Taiwan, ROC 2 Center for Mari- ne Bioenvironment and Biotechnology (CMBB), National Taiwan Ocean University, Keelung 202, Taiwan, ROC † urn:lsid:zoobank.org:author:D82C98B9-D9AA-46E1-83F7-D8BB74776122 ‡ urn:lsid:zoobank.org:author:6094BBA6-5EE6-420F-BAA5-F52D44F11F14 Corresponding author: I-Shiung Chen ([email protected]) Academic editor: Carole Baldwin | Received 19 May 2012 | Accepted 13 August 2012 | Published 21 August 2012 urn:lsid:zoobank.org:pub:2D3E6BCC-171E-4702-B759-E7D7FCEA88DB Citation: Chiang M-C, Chen I-S (2012) A new species of the genus Helcogramma (Blenniiformes, Tripterygiidae) from Taiwan. ZooKeys 216: 57–72. doi: 10.3897/zookeys.216.3407 Abstract A new species of triplefin fish (Blenniiformes: Tripterygiidae), Helcogramma williamsi, is described from six specimens collected from southern Taiwan. This species is well distinguished from its congeners by possess- ing 13 second dorsal-fin spines; third dorsal-fin rays modally 11; anal-fin rays modally 19; pored scales in lateral line 22-24; dentary pore pattern modally 5+1+5; lobate supraorbital cirrus; broad, serrated or pal- mate nasal cirrus; first dorsal fin lower in height than second; males with yellow mark extending from ante- rior tip of upper lip to anterior margin of eye and a whitish blue line extending from corner of mouth onto preopercle.
    [Show full text]
  • Morphomertical and Gonadal Studies of a Thretened Fish, Anabas
    International Journal of Fisheries and Aquaculture Sciences. ISSN 2248-9975 Volume 6, Number 1 (2016), pp. 7-14 © International Research Publication House http://www.irphouse.com morphometrical and Gonadal Studies of A Threatened Fish, Anabas testudineus with Respect to Seasonal Cycle Golam Ziauddin1, Samarendra Behera2, Sanjeev Kumar2*, Rinku Gogoi2, Olik Jomang2 and Snigdha Baksi2 1SMS Fishery Science KVKCRIJAF, ICAR Budbud, Burdwan - 713403, India. 2*Department of Fisheries Resource Management, Faculty of Fishery Sciences, West Bengal University of Animal and Fishery Sciences, 5, Budherhat Road, Chakgaria, P.O. Panchasayar, Kolkata-700094, India. Abstract The study was conducted in the laboratory to understand the morphometrical measurement and relationship among fecundity to length and weight of fish, length and weight of ovary and volume of ovary as well as relationship among ovary weight of fish to total length and total weight of fish for reproductive biology of Anabas testudineus. Adult of A. testudineus ranging from the length of 110 to 170 mm and weight of 30 to 60 gm were collected from local market and acclimatized in the laboratory conditions with artificial feed. The length of the testis in different body size varied from 12.0 to 22.7 mm. The weight of testis showed decreasing trend from 0.252 gm in September and 0.236 gm in October. The Gonadosomatic index (GnSI) of testis varied from 0.494 to 0.668. The length of the ovary in different body size varied from 11.0 to 16.2 mm. The Gonado somatic index of ovary varied from to 0.271 to 0.880.
    [Show full text]
  • Table S1.Xlsx
    Bone type Bone type Taxonomy Order/series Family Valid binomial Outdated binomial Notes Reference(s) (skeletal bone) (scales) Actinopterygii Incertae sedis Incertae sedis Incertae sedis †Birgeria stensioei cellular this study †Birgeria groenlandica cellular Ørvig, 1978 †Eurynotus crenatus cellular Goodrich, 1907; Schultze, 2016 †Mimipiscis toombsi †Mimia toombsi cellular Richter & Smith, 1995 †Moythomasia sp. cellular cellular Sire et al., 2009; Schultze, 2016 †Cheirolepidiformes †Cheirolepididae †Cheirolepis canadensis cellular cellular Goodrich, 1907; Sire et al., 2009; Zylberberg et al., 2016; Meunier et al. 2018a; this study Cladistia Polypteriformes Polypteridae †Bawitius sp. cellular Meunier et al., 2016 †Dajetella sudamericana cellular cellular Gayet & Meunier, 1992 Erpetoichthys calabaricus Calamoichthys sp. cellular Moss, 1961a; this study †Pollia suarezi cellular cellular Meunier & Gayet, 1996 Polypterus bichir cellular cellular Kölliker, 1859; Stéphan, 1900; Goodrich, 1907; Ørvig, 1978 Polypterus delhezi cellular this study Polypterus ornatipinnis cellular Totland et al., 2011 Polypterus senegalus cellular Sire et al., 2009 Polypterus sp. cellular Moss, 1961a †Scanilepis sp. cellular Sire et al., 2009 †Scanilepis dubia cellular cellular Ørvig, 1978 †Saurichthyiformes †Saurichthyidae †Saurichthys sp. cellular Scheyer et al., 2014 Chondrostei †Chondrosteiformes †Chondrosteidae †Chondrosteus acipenseroides cellular this study Acipenseriformes Acipenseridae Acipenser baerii cellular Leprévost et al., 2017 Acipenser gueldenstaedtii
    [Show full text]
  • Updated Checklist of Marine Fishes (Chordata: Craniata) from Portugal and the Proposed Extension of the Portuguese Continental Shelf
    European Journal of Taxonomy 73: 1-73 ISSN 2118-9773 http://dx.doi.org/10.5852/ejt.2014.73 www.europeanjournaloftaxonomy.eu 2014 · Carneiro M. et al. This work is licensed under a Creative Commons Attribution 3.0 License. Monograph urn:lsid:zoobank.org:pub:9A5F217D-8E7B-448A-9CAB-2CCC9CC6F857 Updated checklist of marine fishes (Chordata: Craniata) from Portugal and the proposed extension of the Portuguese continental shelf Miguel CARNEIRO1,5, Rogélia MARTINS2,6, Monica LANDI*,3,7 & Filipe O. COSTA4,8 1,2 DIV-RP (Modelling and Management Fishery Resources Division), Instituto Português do Mar e da Atmosfera, Av. Brasilia 1449-006 Lisboa, Portugal. E-mail: [email protected], [email protected] 3,4 CBMA (Centre of Molecular and Environmental Biology), Department of Biology, University of Minho, Campus de Gualtar, 4710-057 Braga, Portugal. E-mail: [email protected], [email protected] * corresponding author: [email protected] 5 urn:lsid:zoobank.org:author:90A98A50-327E-4648-9DCE-75709C7A2472 6 urn:lsid:zoobank.org:author:1EB6DE00-9E91-407C-B7C4-34F31F29FD88 7 urn:lsid:zoobank.org:author:6D3AC760-77F2-4CFA-B5C7-665CB07F4CEB 8 urn:lsid:zoobank.org:author:48E53CF3-71C8-403C-BECD-10B20B3C15B4 Abstract. The study of the Portuguese marine ichthyofauna has a long historical tradition, rooted back in the 18th Century. Here we present an annotated checklist of the marine fishes from Portuguese waters, including the area encompassed by the proposed extension of the Portuguese continental shelf and the Economic Exclusive Zone (EEZ). The list is based on historical literature records and taxon occurrence data obtained from natural history collections, together with new revisions and occurrences.
    [Show full text]
  • View/Download
    CICHLIFORMES: Cichlidae (part 3) · 1 The ETYFish Project © Christopher Scharpf and Kenneth J. Lazara COMMENTS: v. 6.0 - 30 April 2021 Order CICHLIFORMES (part 3 of 8) Family CICHLIDAE Cichlids (part 3 of 7) Subfamily Pseudocrenilabrinae African Cichlids (Haplochromis through Konia) Haplochromis Hilgendorf 1888 haplo-, simple, proposed as a subgenus of Chromis with unnotched teeth (i.e., flattened and obliquely truncated teeth of H. obliquidens); Chromis, a name dating to Aristotle, possibly derived from chroemo (to neigh), referring to a drum (Sciaenidae) and its ability to make noise, later expanded to embrace cichlids, damselfishes, dottybacks and wrasses (all perch-like fishes once thought to be related), then beginning to be used in the names of African cichlid genera following Chromis (now Oreochromis) mossambicus Peters 1852 Haplochromis acidens Greenwood 1967 acies, sharp edge or point; dens, teeth, referring to its sharp, needle-like teeth Haplochromis adolphifrederici (Boulenger 1914) in honor explorer Adolf Friederich (1873-1969), Duke of Mecklenburg, leader of the Deutsche Zentral-Afrika Expedition (1907-1908), during which type was collected Haplochromis aelocephalus Greenwood 1959 aiolos, shifting, changing, variable; cephalus, head, referring to wide range of variation in head shape Haplochromis aeneocolor Greenwood 1973 aeneus, brazen, referring to “brassy appearance” or coloration of adult males, a possible double entendre (per Erwin Schraml) referring to both “dull bronze” color exhibited by some specimens and to what
    [Show full text]
  • Jlb Smith Institute of Ichthyology
    ISSN 0075-2088 J.L.B. SMITH INSTITUTE OF ICHTHYOLOGY GRAHAMSTOWN, SOUTH AFRICA SPECIAL PUBLICATION No. 56 SCIENTIFIC AND COMMON NAMES OF SOUTHERN AFRICAN FRESHWATER FISHES by Paul H. Skelton November 1993 SERIAL PUBLICATIONS o f THE J.L.B. SMITH INSTITUTE OF ICHTHYOLOGY The Institute publishes original research on the systematics, zoogeography, ecology, biology and conservation of fishes. Manuscripts on ancillary subjects (aquaculture, fishery biology, historical ichthyology and archaeology pertaining to fishes) will be considered subject to the availability of publication funds. Two series are produced at irregular intervals: the Special Publication series and the Ichthyological Bulletin series. Acceptance of manuscripts for publication is subject to the approval of reviewers from outside the Institute. Priority is given to papers by staff of the Institute, but manuscripts from outside the Institute will be considered if they are pertinent to the work of the Institute. Colour illustrations can be printed at the expense of the author. Publications of the Institute are available by subscription or in exchange for publi­ cations of other institutions. Lists of the Institute’s publications are available from the Publications Secretary at the address below. INSTRUCTIONS TO AUTHORS Manuscripts shorter than 30 pages will generally be published in the Special Publications series; longer papers will be considered for the Ichthyological Bulletin series. Please follow the layout and format of a recent Bulletin or Special Publication. Manuscripts must be submitted in duplicate to the Editor, J.L.B. Smith Institute of Ichthyology, Private Bag 1015, Grahamstown 6140, South Africa. The typescript must be double-spaced throughout with 25 mm margins all round.
    [Show full text]
  • The Reproductive Cycle of Female Ballan Wrasse Labrus Bergylta in High Latitude, Temperate Waters
    Journal of Fish Biology (2010) doi:10.1111/j.1095-8649.2010.02691.x, available online at www.interscience.wiley.com The reproductive cycle of female Ballan wrasse Labrus bergylta in high latitude, temperate waters S. Muncaster*†‡§, E. Andersson*, O. S. Kjesbu*, G. L. Taranger*, A. B. Skiftesvik† and B. Norberg† *Institute of Marine Research, P.O. Box 187, Nordnes, N-5817 Bergen, Norway, †Institute of Marine Research, Austevoll Research Station, N-5392 Storebø, Norway and ‡Department of Biology, University of Bergen, N-5020 Bergen, Norway (Received 13 August 2009, Accepted 11 April 2010) This 2 year study examined the reproductive cycle of wild female Ballan wrasse Labrus bergylta in western Norway as a precursor to captive breeding trials. Light microscopy of ovarian histol- ogy was used to stage gonad maturity and enzyme-linked immuno-absorbent assay (ELISA) to measure plasma concentrations of the sex steroids testosterone (T) and 17β-oestradiol (E2). Ovar- ian recrudescence began in late autumn to early winter with the growth of previtellogenic oocytes and the formation of cortical alveoli. Vitellogenic oocytes developed from January to June and ovaries containing postovulatory follicles (POF) were present between May and June. These POF occurred simultaneously among other late maturity stage oocytes. Plasma steroid concentration and organo-somatic indices increased over winter and spring. Maximal (mean ± s.e.) values of −1 −1 plasma T (0·95 ± 0·26 ng ml ), E2 (1·75 ± 0·43 ng ml ) and gonado-somatic index (IG;10·71 ± 0·81) occurred in April and May and decreased greatly in July when only postspawned fish with atretic ovaries occurred.
    [Show full text]
  • Ecography ECOG-05049 Marques, V., Guérin, P.-É., Rocle, M., Valentini, A., Manel, S., Mouillot, D
    Ecography ECOG-05049 Marques, V., Guérin, P.-É., Rocle, M., Valentini, A., Manel, S., Mouillot, D. and Dejean, T. 2020. Blind assessment of vertebrate taxonomic diversity across spatial scales by clustering environmental DNA metabarcoding sequences. – Ecography doi: 10.1111/ ecog.05049 Supplementary material Appendix 1 Fig. A1 Sampling map for the 196 samples, in 103 distinct sites, with a mean of 2 samples per site. family Frequency Frequency 0 10 20 30 40 50 0 10000 20000 30000 40000 0 10 20 30 40 50 60 70 0 20 40 60 80 intrasapecific distance intersapecific distance genus 100 150 Frequency Frequency 50 0 0e+00 1e+05 2e+05 3e+05 0 10 20 30 40 50 60 70 0 20 40 60 80 intrasapecific distance intersapecific distance species 15 10 Frequency Frequency 5 0 0e+00 2e+05 4e+05 6e+05 8e+05 1e+06 0 1 2 3 4 5 0 20 40 60 80 intrasapecific distance intersapecific distance Fig. A2 Fish genetic distance depending on taxa level using the 12S teleo primer, from an in silico PCR on all available sequences in the European Nucleotide Archive. Fig. A3 Effects of LULU parameters (minimum percentage of similarity and co-occurrence) on the number of discarded MOTUs with A) making only the similarity percentage vary between 80 and 100% and a co-occurrence value of 95% and B) making both co-occurrence and identity percentage vary. Table A1: The 12 species detected only with the European Nucleotide Archive (ENA) at 100% similarity, with their main country location compared to its assignment using the local reference database and associated location.
    [Show full text]
  • Summary Report of Freshwater Nonindigenous Aquatic Species in U.S
    Summary Report of Freshwater Nonindigenous Aquatic Species in U.S. Fish and Wildlife Service Region 4—An Update April 2013 Prepared by: Pam L. Fuller, Amy J. Benson, and Matthew J. Cannister U.S. Geological Survey Southeast Ecological Science Center Gainesville, Florida Prepared for: U.S. Fish and Wildlife Service Southeast Region Atlanta, Georgia Cover Photos: Silver Carp, Hypophthalmichthys molitrix – Auburn University Giant Applesnail, Pomacea maculata – David Knott Straightedge Crayfish, Procambarus hayi – U.S. Forest Service i Table of Contents Table of Contents ...................................................................................................................................... ii List of Figures ............................................................................................................................................ v List of Tables ............................................................................................................................................ vi INTRODUCTION ............................................................................................................................................. 1 Overview of Region 4 Introductions Since 2000 ....................................................................................... 1 Format of Species Accounts ...................................................................................................................... 2 Explanation of Maps ................................................................................................................................
    [Show full text]