Recombinant Human ATP-Citrate Synthase(ACLY),Partial

Product Datasheet

Recombinant Human ATP-citRate synthase(ACLY),partial

Catalog No: #AP74325

Orders: [email protected] Package Size: #AP74325-1 20ug #AP74325-2 100ug #AP74325-3 1mg Support: [email protected]

Description

Product Name Recombinant Human ATP-citRate synthase(ACLY),partial

Brief Description Recombinant Protein

Host Species E.coli

Purification Greater than 90% as determined by SDS-PAGE.

Immunogen Description Expression Region:4-265aaSequence Info:Partial

Other Names ATP-citrate (pro-S-)-lyase

Short name:ACL

Citrate cleavage enzyme

Accession No. P53396

Calculated MW 45.5 kDa

Tag Info N-terminal 6xHis-SUMO-tagged

Target Sequence KAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLT

LDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKA

QKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATA

DYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLK

Formulation Tris-based buffer50% glycerol

Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability

of the protein itself.

Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months

at -20°C,-80°C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for

up to one week.

Images

Address: 8400 Baltimore Ave., Suite 302, College Park, MD 20740, USA http://www.sabbiotech.com 1 Background

ATP citrate-lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. Has a central role in de novo lipid synthesis. In nervous tissue it may be involved in the biosynthesis of acetylcholine.

References

"Cloning and expression of a human ATP-citrate lyase cDNA."Elshourbagy N.A., Near J.C., Kmetz P.J., Wells T.N.C., Groot P.H.E., Saxty B.A., Hughes S.A., Franklin M., Gloger I.S.Eur. J. Biochem. 204:491-499(1992)Research Topic:Metabolism

Note: This product is for in vitro research use only and is not intended for use in humans or animals.

Address: 8400 Baltimore Ave., Suite 302, College Park, MD 20740, USA http://www.sabbiotech.com 2