Product Datasheet Recombinant Human ATP-citRate synthase(ACLY),partial Catalog No: #AP74325 Orders: [email protected] Package Size: #AP74325-1 20ug #AP74325-2 100ug #AP74325-3 1mg Support: [email protected] Description Product Name Recombinant Human ATP-citRate synthase(ACLY),partial Brief Description Recombinant Protein Host Species E.coli Purification Greater than 90% as determined by SDS-PAGE. Immunogen Description Expression Region:4-265aaSequence Info:Partial Other Names ATP-citrate (pro-S-)-lyase Short name:ACL Citrate cleavage enzyme Accession No. P53396 Calculated MW 45.5 kDa Tag Info N-terminal 6xHis-SUMO-tagged Target Sequence KAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLT LDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKA QKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATA DYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLK Formulation Tris-based buffer50% glycerol Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. Images Address: 8400 Baltimore Ave., Suite 302, College Park, MD 20740, USA http://www.sabbiotech.com 1 Background ATP citrate-lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. Has a central role in de novo lipid synthesis. In nervous tissue it may be involved in the biosynthesis of acetylcholine. References "Cloning and expression of a human ATP-citrate lyase cDNA."Elshourbagy N.A., Near J.C., Kmetz P.J., Wells T.N.C., Groot P.H.E., Saxty B.A., Hughes S.A., Franklin M., Gloger I.S.Eur. J. Biochem. 204:491-499(1992)Research Topic:Metabolism Note: This product is for in vitro research use only and is not intended for use in humans or animals. Address: 8400 Baltimore Ave., Suite 302, College Park, MD 20740, USA http://www.sabbiotech.com 2.