Mouse Anti-Human POLR2J Monoclonal Antibody, Clone 2B21 (CABT-B11040) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Mouse anti-Human POLR2J monoclonal antibody, clone 2B21 (CABT-B11040) This product is for research use only and is not intended for diagnostic use.

PRODUCT INFORMATION

Immunogen POLR2J (AAH24165, 1 a.a. ~ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Isotype IgG1

Source/Host Mouse

Species Reactivity Human

Clone 2B21

Conjugate Unconjugated

Applications WB,sELISA,ELISA

Sequence Similarities MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPL EHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE*

Format Liquid

Size 100 μg

Buffer In 1x PBS, pH 7.2

Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

BACKGROUND

Introduction This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene exists as a heterodimer with another polymerase subunit; together they form a core subassembly unit of the polymerase. Two similar genes are located nearby on chromosome 7q22.1 and a pseudogene is found on chromosome 7p13. [provided by RefSeq, Jul 2008]

Keywords POLR2J; polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa; RPB11; RPB11A; RPB11m; hRPB14; POLR2J1; DNA-directed RNA polymerase II subunit RPB11-a; RNA

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]

GENE INFORMATION

Entrez Gene ID 5439

UniProt ID P52435

Pathway Abortive elongation of HIV-1 transcript in the absence of Tat, organism-specific biosystem; DNA Repair, organism-specific biosystem; Dual incision reaction in TC-NER, organism-specific biosystem; Eukaryotic Transcription Initiation, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem

Function DNA binding; DNA-directed RNA polymerase activity; LRR domain binding; protein binding; protein dimerization activity; contributes_to protein kinase activity

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]