
Mouse anti-Human POLR2J monoclonal antibody, clone 2B21 (CABT-B11040) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Immunogen POLR2J (AAH24165, 1 a.a. ~ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype IgG1 Source/Host Mouse Species Reactivity Human Clone 2B21 Conjugate Unconjugated Applications WB,sELISA,ELISA Sequence Similarities MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPL EHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE* Format Liquid Size 100 μg Buffer In 1x PBS, pH 7.2 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. BACKGROUND Introduction This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene exists as a heterodimer with another polymerase subunit; together they form a core subassembly unit of the polymerase. Two similar genes are located nearby on chromosome 7q22.1 and a pseudogene is found on chromosome 7p13. [provided by RefSeq, Jul 2008] Keywords POLR2J; polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa; RPB11; RPB11A; RPB11m; hRPB14; POLR2J1; DNA-directed RNA polymerase II subunit RPB11-a; RNA 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved polymerase II subunit B11-a; RNA polymerase II 13.3 kDa subunit; DNA-directed RNA polymerase II subunit J-1; GENE INFORMATION Entrez Gene ID 5439 UniProt ID P52435 Pathway Abortive elongation of HIV-1 transcript in the absence of Tat, organism-specific biosystem; DNA Repair, organism-specific biosystem; Dual incision reaction in TC-NER, organism-specific biosystem; Eukaryotic Transcription Initiation, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem Function DNA binding; DNA-directed RNA polymerase activity; LRR domain binding; protein binding; protein dimerization activity; contributes_to protein kinase activity 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages2 Page
-
File Size-