YTT-April Yoga Teaching Methodology Reading from the Manual

Total Page：16

File Type：pdf, Size：1020Kb

YTT-April Yoga Teaching Methodology Reading from the Manual In preparation for the next YTT weekend please read over the following in order to prepare for holding safe space for one another. Please review the information on communication and providing feedback during partner or group teaching activities. Training Community Section Pages 1-3 to 1-7 ● Learning Environment Guidelines ● Conscious Communication Yoga Philosophy--in order to review what we covered last weekend and to prepare for the next training weekend please read the following: Yoga Philosophy Section Pages 2-1 to 2-15 ● Yoga Philosophy Introduction ● Classical Yoga Teachings ● The Subtle Body ● The Koshas ● Patanjali’s Yoga Sutras and the Eight Limbed Path of Yoga ○ Yama and Niyama ● Brief Outline of Yoga History and Historical Texts Teaching Yoga--in order to review what we covered last weekend and to prepare for the next training weekend please read the following: Teaching Yoga Section Pages Read the Following Sections ● Teaching Yoga Introduction Page 3-1 to 3-2 ● Dynamic Language and Cueing Page 3-5 to 3-8 ● Create Body Awareness 3-9 to 3-10 ● Art of Demonstration 3-12 to 3-14 Posture Clinics--In order to review what we covered last weekend and to prepare for the next training weekend please read the following: Asana Section Review the postures from Weekend 1 ● Tadasana \ Mountain ● Utkatasana | Awkward ● Virabhadrasana Dvi | Warrior II ● Utthita Parsvakonasana | Lateral Angle ● Sukasana | Easy ● Baddha Konasana | Bound Angle Read the following postures in preparation for Weekend II ● Virabhadrasana eka | Warrior I ● Anjaneyasana | Low Lunge ● Prasarita Padottanasana | Standing Wide Angle ● Uttanasana | Forward Fold ● TBD Tuesday -2 additional postures Pranayama Section Read 6-1 to 6-5 ● Pranayama Introduction ● Respiration Anatomy ● Teaching Pranayama ● Dirgha Pranayama .

Copy Link

Recommended publications

I on an Empty Stomach After Evacuating the Bladder and Bowels
• I on a Tllt' Bi11lr· ol' \lodt•nJ Yoga-It� Philo�opl1� and Prad il't' -hv thr: World" s Fon-·mo �l 'l'r·ar·lwr B • I< . S . IYENGAR \\ it h compldc· dt·!wription� and illustrations of all tlw po �tun·� and bn·athing techniqn··� With More than 600 Photographs Positioned Next to the Exercises "For the serious student of Hatha Yoga, this is as comprehensive a handbook as money can buy." -ATLANTA JOURNAL-CONSTITUTION "The publishers calls this 'the fullest, most practical, and most profusely illustrated book on Yoga ... in English'; it is just that." -CHOICE "This is the best book on Yoga. The introduction to Yoga philosophy alone is worth the price of the book. Anyone wishing to know the techniques of Yoga from a master should study this book." -AST RAL PROJECTION "600 pictures and an incredible amount of detailed descriptive text as well as philosophy .... Fully revised and photographs illustrating the exercises appear right next to the descriptions (in the earlier edition the photographs were appended). We highly recommend this book." -WELLNESS LIGHT ON YOGA § 50 Years of Publishing 1945-1995 Yoga Dipika B. K. S. IYENGAR Foreword by Yehudi Menuhin REVISED EDITION Schocken Books New 1:'0rk First published by Schocken Books 1966 Revised edition published by Schocken Books 1977 Paperback revised edition published by Schocken Books 1979 Copyright© 1966, 1968, 1976 by George Allen & Unwin (Publishers) Ltd. All rights reserved under International and Pan-American Copyright Conventions. Published in the United States by Schocken Books Inc., New York. Distributed by Pantheon Books, a division of Random House, Inc., New York.
[Show full text]
Yoga and the Five Prana Vayus CONTENTS
Breath of Life Yoga and the Five Prana Vayus CONTENTS Prana Vayu: 4 The Breath of Vitality Apana Vayu: 9 The Anchoring Breath Samana Vayu: 14 The Breath of Balance Udana Vayu: 19 The Breath of Ascent Vyana Vayu: 24 The Breath of Integration By Sandra Anderson Yoga International senior editor Sandra Anderson is co-author of Yoga: Mastering the Basics and has taught yoga and meditation for over 25 years. Photography: Kathryn LeSoine, Model: Sandra Anderson; Wardrobe: Top by Zobha; Pant by Prana © 2011 Himalayan International Institute of Yoga Science and Philosophy of the U.S.A. All rights reserved. Reproduction or use of editorial or pictorial content in any manner without written permission is prohibited. Introduction t its heart, hatha yoga is more than just flexibility or strength in postures; it is the management of prana, the vital life force that animates all levels of being. Prana enables the body to move and the mind to think. It is the intelligence that coordinates our senses, and the perceptible manifestation of our higher selves. By becoming more attentive to prana—and enhancing and directing its flow through the Apractices of hatha yoga—we can invigorate the body and mind, develop an expanded inner awareness, and open the door to higher states of consciousness. The yoga tradition describes five movements or functions of prana known as the vayus (literally “winds”)—prana vayu (not to be confused with the undivided master prana), apana vayu, samana vayu, udana vayu, and vyana vayu. These five vayus govern different areas of the body and different physical and subtle activities.
[Show full text]
• Principles of Dynamic Mindfulness
1st Module EARTH Philosophy, History, Anatomy and the Subtle Body We start by diving into the history and philosophy of Yoga and Buddhism, in order to find out how are these ancient teachings and practices relevant in the context of our contemporary lives. We will put the teachings into practice through a lab sequence and an introduction to meditation. These will be complemented by a thorough exploration of the anatomy of the physical and energetic bodies. By the time you complete Module 1, your yoga practice will feel far more comprehensive and supported by the knowledge and techniques you have learned. You will be ready to approach teaching with wisdom and grounded confidence. Module 1 is also an incredible experience for those wanting to explore their own practice on a new level, even if you do not intend to become a teacher. • Opening: Perspectives on the Body: East/West • History & Evolution of Yoga • Introduction to Yoga Philosophy: Patanjali’s Yoga Sutras • What did Buddha teach ? • Applied Buddhist Psychology • Chinese Spiritual Heritage • Anatomy for Yoga Teachers • Subtle Body Anatomy • Principles of Dynamic Mindfulness • Introduction to Meditation • Sequence Lab • Western Somatics – Practices of Embodiment 2nd Module WATER Basic Asanas, Alignment & Adjustments The second module builds on the knowledge of anatomy and the subtle body from Module 1 and expands into sequencing a dynamic and intelligent class based on your knowledge of how the asanas and the body function together. You will learn a comprehensive list of yoga asanas (poses), healthy alignment and safe, helpful adjustments. By the end of Segment 2 you will be able to teach your fellow trainees a simple, challenging and effective yoga class with a focus on breath, sequencing and alignment.
[Show full text]
Using Props to Achieve Stability and Ease in Yoga Poses
Using PROPS to Achieve STABILITY and EASE in YOGA Poses by Tricia Fiske and Marianne Woods Cirone Photographs by Sachiko Eubanks From Alignment to Enlightenment: Using Props to Achieve Stability and Ease in Yoga Poses Tricia Fiske Marianne Woods Cirone Satya Publishing St. Charles, Illinois FROM ALIGNMENT TO ENLIGHTENMENT: Using Props to Achieve Stability and Ease in Yoga Poses 2 Copyright © 2019 by Tricia Fiske and Marianne Woods Cirone All rights reserved. No part of this book may be reproduced or used in any manner without written permission of the copyright owner except for the use of quotations in a book review. For more information, contact [email protected] First e-book edition June 2019 Photography by Sachiko Eubanks Book design by Motomi Naito ISBN 978-1-7331298-0-0 (e-book) ISBN 978-1-7331298-1-7 (paperback) www.triciafiske.com www.mariannecirone.com FROM ALIGNMENT TO ENLIGHTENMENT: Using Props to Achieve Stability and Ease in Yoga Poses 3 EWCOMERS, experienced students of yoga and teachers of yoga are in capable hands with my dear friend, Tricia Fiske as their guide. In her Praise for Nbook, From Alignment to Enlightenment, Tricia shares her wisdom and many insights on the vital concept of alignment From Alignment in practice and the energetics of asana. to Enlightenment: With the use of props to support the understanding of proper, safe form within the postures as the foundation, Tricia has Using Props created a clear, smart and important manual that will be to Achieve of immense value to anyone looking to build a foundation or deepen their practice of yoga asana.
[Show full text]
The Subtle Body: Religious, Spiritual, Health-Related, Or All Three?
University of Mary Washington Eagle Scholar Student Research Submissions Spring 4-20-2020 The Subtle Body: Religious, Spiritual, Health-Related, or All Three? Kathryn Heislup Follow this and additional works at: https://scholar.umw.edu/student_research Part of the Religion Commons Recommended Citation Heislup, Kathryn, "The Subtle Body: Religious, Spiritual, Health-Related, or All Three?" (2020). Student Research Submissions. 325. https://scholar.umw.edu/student_research/325 This Honors Project is brought to you for free and open access by Eagle Scholar. It has been accepted for inclusion in Student Research Submissions by an authorized administrator of Eagle Scholar. For more information, please contact [email protected]. The Subtle Body: Religious, Spiritual, Health-Related, or All Three? A Look Into the Subtle Physiology of Traditional and Modern Forms of Yoga Kathryn E. Heislup RELG 401: Senior Thesis Submitted in Partial Fulfillment of the Major in Religion University of Mary Washington April 20, 2020 2 Notions of subtle body systems have migrated and changed throughout India and Tibet over many years with much controversy; the movement of these ideas to the West follows a similar controversial path, and these developments in both Asia and the West exemplify how one cannot identify a singular, legitimate, “subtle body”. Asserting that there is only one legitimate teaching, practice, and system of the subtle body is problematic and inappropriate. The subtle body refers to assumed energy points within the human body that cannot be viewed by the naked eye, but is believed by several traditions to be part of our physical existence. Indo-Tibetan notions of a subtle body do include many references to similar ideas when it comes to this type of physiology, but there has never been one sole agreement on a legitimate identification or intended use.
[Show full text]
Asana Pranayama Mudra Bandha
Asana Pranayama Mudra Bandha Swami Satyananda Saraswati 'og.t Pubhcatlons J ntst, Mungct, B1h.u, JndJ.J Asana Pranayama Mudra Bandha With kind regards, \!a and prem �!{,�A*- Asana Pranayama Mudra Bandha Swami Satyananda Saraswati Yoga Publications Trust, Munger, Bihar, India © Bihar School of Yoga 1969, 1973, 1996, 2008 All rights resetved. No part of this publication may be reproduced, transmitted or stored in a retrieval system, in any form or by any means, without permission in writing fromYoga Publications Trust. The terms Satyananda YogaGD and Bihar YogaGD are registered trademarks owned by International Yoga Fellowship Movement (IYFM). The use of the same in this book is with permission and should not in any way be taken as affecting the validity of the marks. Published by Bihar School of Yoga First edition 1969 Reprinted 1971 Second edition 1973 Reprinted 1977, 1980, 1983, 1989, 1993, 1995, 1996 Third (revised) edition 1996 (by Bihar Yoga Bharati with permission of Bihar School of Yoga) Reprinted 1997, 1999 Published by Yoga Publications Trust Reprinted 2002, 2004 (twice), 2005, 2006 Fourth (revised) edition 2008 Reprinted 2008, 2009 ISBN: 978-81-86336-14-4 Publisher and distributor: Yoga Publications Trust, Ganga Darshan, Munger, Bihar, India. Website: www.biharyoga.net www rikh. iapeeth.net Printed at Thomson Press (India) Limited, New Delhi, 110001 lV Dedication In humility we offer this dedication to Swami Sivananda Saraswati, who initiated Swami Satyananda Sarnswati into the secrets of yoga. Contents Preface zx Introduction
[Show full text]
The Subtle Energy Body : the Complete Guide / Maureen Lockhart
?30 >@-?70 090=2D -:/D This page intentionally left blank. ?30 >@-?70 090=2D -:/D K_\:fdgc\k\>l`[\ DXli\\eCfZb_Xik#G_%;% Inner Traditions Rochester, Vermont r Toronto, Canada Inner Traditions One Park Street Rochester, Vermont 05767 www.InnerTraditions.com Copyright © 2010 by Maureen Lockhart All rights reserved. No part of this book may be reproduced or utilized in any form or by any means, electronic or mechanical, including photocopying, recording, or by any information storage and retrieval system, without permission in writing from the publisher. Library of Congress Cataloging-in-Publication Data Lockhart, Maureen. The subtle energy body : the complete guide / Maureen Lockhart. p. cm. Includes bibliographical references and index. ebook ISBN 978-1-59477-654-0 print ISBN 978-1-59477-339-6 (pbk.) 1. Spirituality—Miscellanea. 2. Energy medicine. I. Title. BL624.L64 2010 128'.6—dc22 2010032075 Printed and bound in the United States by P. A. Hutchison 10 9 8 7 6 5 4 3 2 1 Text design and layout by Priscilla Baker This book was typeset in Garamond Premier Pro with Elegans Script and Agenda used as display typefaces Color plates 4, 11, 32, 33, and 35 and images on pages 21, 29, 43 (right-hand image), 48 (left- hand image), 77, 90, 93, 94, 107, 127, 166, 171, 195, 200, 201, 202, 208, 209, 215, 243, 273, 274, 290, 307, and 333 copyright ¢ by Eric Franklin To send correspondence to the author of this book, mail a first-class letter to the author c/o *OOFS5SBEJUJPOTr#FBS$PNQBOZ 0OF1BSL4USFFU 3PDIFTUFS 75 BOEXFXJMM forward the communication.
[Show full text]
Century Britain: the Lived Experience of Yoga Practitioners
Yoga Practice in 21 st Century Britain: The Lived Experience of Yoga Practitioners Chizuko Hunt Thesis submitted to De Montfort University in partial fulfilment for the degree of Doctor of Philosophy in Health Study 2010 Abstract Yoga Practice in 21 st Century Britain: The Lived Experience of Yoga Practitioners This thesis investigates the nature of ‘the self’ modern yoga practitioners cultivate. This ontological question is further divided into three sub-questions to find the answer step- by-step. They are: (1) How yoga practice influences practitioners' health and well- being; (2) How yoga practice influences the management of life crises; (3) How yoga practice influences the ‘sense of self’. Modern yoga in the West has been expanding rapidly after the Second World War, and the last 15 years in particular show an exponential growth. Although the numbers are hard to estimate, there were reportedly over 2.5 million practitioners in Britain alone in 2004 (Singleton, 2008). Similar numbers of yoga practitioners were reported in other countries (Strauss, 2004). However, the modern form of yoga practiced in Britain is not the same as the Indian traditional form of yoga. In Britain, the British Wheel of Yoga (BWY) officially represents the majority of the yoga population. This study has used hermeneutic phenomenology, chiefly that of Heidegger and of Merleau-Ponty, as a research methodology, because it enabled the researcher to understand the subjective lived experiences of modern yoga practitioners. For data collection, 15 in-depth interviews of BWY members, selected using the snowballing and theoretical methods, were carried out. Through analysis, six major themes emerged.
[Show full text]
Bibliography Acri, Andrea
© Copyright, Princeton University Press. No part of this book may be distributed, posted, or reproduced in any form by digital or mechanical means without prior written permission of the publisher. Bibliography Acri, Andrea. 2011. “Dharma Patanjala: A Saiva Scripture from Ancient Java: Studied in the Light of Related Old Javanese and Sanskrit Texts.” PhD diss., Leiden University. Agni Purana. See Upadhyaya 1966. Aithal, Parameswara. 1972. Descriptive Catalogue of Sanskrit Manuscripts. Vol. 8, Samkhya, Yoga, Vaisesika, and Nyaya. Chennai: Adyar Library and Research Centre. Aiyangar, K. V. Rangaswami. 1945. Krtyakalpataru of Bhatta Laksmidhara. Vol. 14. Vadodara: Oriental Institute. Albanese, Catherine. 2007. A Republic of Mind and Spirit: A Cultural History of American Metaphysical Religion. New Haven, CT: Yale University Press. Alles, Gregory D. 2002. “The Science of Religions in a Fascist State: Rudolf Otto and Jakob Wilhelm Hauer during the Third Reich.” Religion 32 (3): 177–204. Alter, Joseph S. 2004. Yoga in Modern India: The Body between Science and Philosophy. Princeton, NJ: Princeton University Press. ———. 2007. “Endpiece.” Asian Medicine: Tradition and Modernity, Special Yoga Issue, edited by Mark Singleton, 3 (1): 177–88. ———. 2011. Moral Materialism: Sex and Masculinity in Modern India. New Delhi: Penguin Books. Angot, Michel. 2008. Le Yoga-Sutra de Patanjali. Le Yoga-Bhasya de Vyasa avec des extraits du Yoga-Varttika de Vijnana-Bhiksu. Paris: Les Belles Lettres. Apte, Hari Narayana, ed. 1903. Apararkaparabhidhaparadityaviracitatikasameta Yajnavalkyasmrtih. Vol. 1. Pune: Anandashrama. ———. 1905. Vayu Purana. Pune: Anandashrama. Aranya, Swami Hariharananda. 1963, 1981, 1983. Yoga Philosophy of Patanjali, edited by Paresh Nath Mukherji. Kolkata: University of Kolkata (1963 and 1981 editions); Albany: State University of New York Press (1983 cited edition).
[Show full text]
Rethinking Our Thinking About Asanas
RETHINKING OUR THINKING ABOUT ASANAS By Garry Appel I. Prologue. Asanas are one of the eight limbs of Yoga. Yoga is a vast and enormous subject, one I am just beginning to learn. Even the smaller topic of asanas and asana practice is itself multifaceted and quite broad. My aim here is modest – to propose a new way to think about the factors we typically use to associate one asana with another – that is, to categorize the poses. Thus, the work is of limited scope. It does not deal directly with how individual asana are performed or taught, although it may have implications in that direction that I will touch on later. Also, while I recognize the physical body is just a part of the asana practice, I am not sufficiently knowledgeable or experienced to convey any useful knowledge or insights about the subtle body aspects of this topic, although I will touch on this topic in the last section of this work. Finally, this work does not deal with how to arrange asanas together in a sequence or flow; although, again, it may have implications in that direction. When we are experienced in a subject, we inevitably bring our biases and prejudices – our attachments and aversions – to other’s ideas about the subject. Sometimes, the more experienced we are, the more entrenched our ideas become and the more resistant we become to thinking about things in a new way. It is therefore perfectly normal (and often useful) to view ideas critically and with skepticism. Recognizing that, I ask you to consider what I have to say with an open mind, a beginner’s mind.
[Show full text]
Proceedings of the Yoga & Psyche Conference
Proceedings of the Yoga & Psyche Conference (2014) Proceedings of the Yoga & Psyche Conference (2014) Edited by Mariana Caplan and Gabriel Axel Proceedings of the Yoga & Psyche Conference (2014) Edited by Mariana Caplan and Gabriel Axel This book first published 2015 Cambridge Scholars Publishing Lady Stephenson Library, Newcastle upon Tyne, NE6 2PA, UK British Library Cataloguing in Publication Data A catalogue record for this book is available from the British Library Copyright © 2015 by Mariana Caplan, Gabriel Axel and contributors All rights for this book reserved. No part of this book may be reproduced, stored in a retrieval system, or transmitted, in any form or by any means, electronic, mechanical, photocopying, recording or otherwise, without the prior permission of the copyright owner. ISBN (10): 1-4438-8117-1 ISBN (13): 978-1-4438-8117-3 TABLE OF CONTENTS Preface ....................................................................................................... vii Mariana Caplan Introduction ................................................................................................. 1 Gabriel Axel Invocation .................................................................................................... 7 Rama Jyoti Vernon Establishing Yoga Studies ......................................................................... 11 Christopher Key Chapple Yoga Psychotherapy: The Integration of Western Psychological Theory and Ancient Yogic Wisdom .......................................................... 23 Mariana Caplan,
[Show full text]
Kannur University PG*Diploma in Yoga Education Syllabus.Pdf
KANNut{ -V- u*,r"*art" ( A bst racl) post Craduate Diploma in Yoga Education under the School of Physical Education and Sporls Sciences,Mangattuparamba Campus - Regulation, Scheme, Syllabus and Model question papers th effect from 2018 adniission - Orders issued. ACADEM]C 'C' SECTION U.O. No. Acad/C4ll l98l/2018 Civil Station dated I l-07 -2018 I l.Minuies of the meeting of the Syndicate vide item No 2017.143 Dated 141031201'l . 2.Minutes of the meeting of the BOS in Pliysical Education(Cd) Dated 14109/2017 ll.tJ.O.No.Acad.A I 11 421212017. Dated I 1/06/201 8. 4.Letter No. Nil Dated. 26106/20 i 8 liom Dr.P.T.Joseph, Former Chairman,BOS in Physical Education(Cd). ORDER I . As per the paper read ( I ) above, the Syndicate of the University considergd the pi'oposal 1br sta$ing Post Graduate Diploma Coune in Yoga Education under School oi' Physical Education & Sports Sciences, l(annur University, Mangattuparamba campus and resolved to grant permission for the same. 2. The meeting of the Board of Studies in Physical Education (Cd) held on l4ftgll7, along with subject experts, prepaled the draft Scheme and Syllabus for the Posl Graduare Diploma in Yoga Education Course vide paper read(2 ) above .The Board further authorized the Chairman to submit the Regulation, Scheme and Syllabus of the course, to the university, for approval. 3. As per the reference (3), sanction was accorded to start Post Graduate Diploma iirYoga Education Course ofone year duration, with an intake of25 students under the School of Physical Education & Spofis Sciences , Mangatruparamba Campus froln the rcuJcrnic year 201 8-20 I 9.
[Show full text]