DOCSLIB.ORG

Mouse Ppef1 Knockout Project (CRISPR/Cas9)

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Mouse Ppef1 Knockout Project (CRISPR/Cas9) https://www.alphaknockout.com Mouse Ppef1 Knockout Project (CRISPR/Cas9) Objective: To create a Ppef1 knockout Mouse model (C57BL/6J) by CRISPR/Cas-mediated genome engineering. Strategy summary: The Ppef1 gene (NCBI Reference Sequence: NM_011147 ; Ensembl: ENSMUSG00000062168 ) is located on Mouse chromosome X. 16 exons are identified, with the ATG start codon in exon 1 and the TAA stop codon in exon 16 (Transcript: ENSMUST00000071204). Exon 2~4 will be selected as target site. Cas9 and gRNA will be co-injected into fertilized eggs for KO Mouse production. The pups will be genotyped by PCR followed by sequencing analysis. Note: Homozygous null female and hemizygous null male mice are viable, fertile and display no overt abnormalities. Exon 2 starts from about 2.41% of the coding region. Exon 2~4 covers 18.41% of the coding region. The size of effective KO region: ~10105 bp. The KO region does not have any other known gene. Page 1 of 8 https://www.alphaknockout.com Overview of the Targeting Strategy Wildtype allele 5' gRNA region gRNA region 3' 1 2 3 4 16 Legends Exon of mouse Ppef1 Knockout region Page 2 of 8 https://www.alphaknockout.com Overview of the Dot Plot (up) Window size: 15 bp Forward Reverse Complement Sequence 12 Note: The 2000 bp section upstream of Exon 2 is aligned with itself to determine if there are tandem repeats. No significant tandem repeat is found in the dot plot matrix. So this region is suitable for PCR screening or sequencing analysis. Overview of the Dot Plot (down) Window size: 15 bp Forward Reverse Complement Sequence 12 Note: The 2000 bp section downstream of Exon 4 is aligned with itself to determine if there are tandem repeats. No significant tandem repeat is found in the dot plot matrix. So this region is suitable for PCR screening or sequencing analysis. Page 3 of 8 https://www.alphaknockout.com Overview of the GC Content Distribution (up) Window size: 300 bp Sequence 12 Summary: Full Length(2000bp) | A(26.6% 532) | C(21.85% 437) | T(32.1% 642) | G(19.45% 389) Note: The 2000 bp section upstream of Exon 2 is analyzed to determine the GC content. No significant high GC-content region is found. So this region is suitable for PCR screening or sequencing analysis. Overview of the GC Content Distribution (down) Window size: 300 bp Sequence 12 Summary: Full Length(2000bp) | A(25.35% 507) | C(17.15% 343) | T(41.9% 838) | G(15.6% 312) Note: The 2000 bp section downstream of Exon 4 is analyzed to determine the GC content. No significant high GC-content region is found. So this region is suitable for PCR screening or sequencing analysis. Page 4 of 8 https://www.alphaknockout.com BLAT Search Results (up) QUERY SCORE START END QSIZE IDENTITY CHROM STRAND START END SPAN ----------------------------------------------------------------------------------------------- browser details YourSeq 2000 1 2000 2000 100.0% chrX - 160693615 160695614 2000 browser details YourSeq 345 47 460 2000 92.9% chr10 + 63563113 63563531 419 browser details YourSeq 344 48 460 2000 90.9% chrX - 20524959 20525361 403 browser details YourSeq 344 66 455 2000 94.2% chr1 - 189592053 189592442 390 browser details YourSeq 342 45 460 2000 91.4% chr14 - 103006245 103006661 417 browser details YourSeq 339 47 461 2000 90.1% chr5 + 72819370 72819782 413 browser details YourSeq 339 47 456 2000 92.5% chr1 + 150376871 150377281 411 browser details YourSeq 338 66 456 2000 93.4% chr1 + 43638403 43638812 410 browser details YourSeq 337 48 456 2000 91.1% chrX + 113388176 113388582 407 browser details YourSeq 336 47 460 2000 89.9% chr6 - 74629636 74630039 404 browser details YourSeq 336 68 456 2000 93.3% chr16 - 59705165 59705553 389 browser details YourSeq 336 46 456 2000 90.3% chr1 + 16403509 16403911 403 browser details YourSeq 335 45 456 2000 92.3% chr10 - 9217848 9218270 423 browser details YourSeq 335 45 456 2000 89.9% chr12 + 28354431 28354835 405 browser details YourSeq 334 68 456 2000 93.1% chrX - 10092007 10092396 390 browser details YourSeq 334 52 456 2000 90.2% chr4 + 85541322 85541718 397 browser details YourSeq 333 49 456 2000 90.0% chr5 - 5813440 5813839 400 browser details YourSeq 332 47 456 2000 90.7% chr3 - 68978834 68979244 411 browser details YourSeq 332 48 452 2000 92.1% chr2 - 90798654 90799060 407 browser details YourSeq 332 53 456 2000 92.0% chr18 - 74915569 74915977 409 Note: The 2000 bp section upstream of Exon 2 is BLAT searched against the genome. No significant similarity is found. BLAT Search Results (down) QUERY SCORE START END QSIZE IDENTITY CHROM STRAND START END SPAN ----------------------------------------------------------------------------------------------- browser details YourSeq 2000 1 2000 2000 100.0% chrX - 160683170 160685169 2000 browser details YourSeq 151 506 670 2000 96.4% chr11 + 94599432 94599609 178 browser details YourSeq 149 506 673 2000 94.7% chr8 - 85006434 85006601 168 browser details YourSeq 149 514 686 2000 95.2% chr11 - 63433813 63433988 176 browser details YourSeq 147 506 684 2000 90.2% chr5 + 131037140 131037316 177 browser details YourSeq 147 510 682 2000 94.1% chr18 + 12169974 12170146 173 browser details YourSeq 146 507 690 2000 92.0% chr2 - 92900791 92900984 194 browser details YourSeq 146 508 686 2000 93.5% chr15 - 103249746 103249927 182 browser details YourSeq 146 511 673 2000 95.1% chr9 + 72378238 72378401 164 browser details YourSeq 146 463 670 2000 94.6% chr4 + 48535228 48535485 258 browser details YourSeq 146 506 672 2000 94.0% chr1 + 91461179 91461366 188 browser details YourSeq 145 506 666 2000 95.7% chr19 - 4694940 4695137 198 browser details YourSeq 143 500 666 2000 95.0% chr1 - 56798758 56798935 178 browser details YourSeq 142 522 688 2000 93.3% chr3 - 127582033 127582204 172 browser details YourSeq 141 518 689 2000 93.8% chr2 - 59500937 59501113 177 browser details YourSeq 141 510 673 2000 91.4% chr12 + 83704558 83704719 162 browser details YourSeq 139 518 670 2000 95.5% chr16 + 31752739 31752891 153 browser details YourSeq 139 518 673 2000 94.9% chr13 + 29863861 29864019 159 browser details YourSeq 139 521 676 2000 94.9% chr10 + 22711434 22711595 162 browser details YourSeq 138 518 670 2000 95.5% chr19 - 38842373 38842536 164 Note: The 2000 bp section downstream of Exon 4 is BLAT searched against the genome. No significant similarity is found. Page 5 of 8 https://www.alphaknockout.com Gene and protein information: Ppef1 protein phosphatase with EF hand calcium-binding domain 1 [ Mus musculus (house mouse) ] Gene ID: 237178, updated on 3-Sep-2019 Gene summary Official Symbol Ppef1 provided by MGI Official Full Name protein phosphatase with EF hand calcium-binding domain 1 provided by MGI Primary source MGI:MGI:1097157 See related Ensembl:ENSMUSG00000062168 Gene type protein coding RefSeq status VALIDATED Organism Mus musculus Lineage Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus Also known as PPEF-1 Expression Biased expression in testis adult (RPKM 1.6), CNS E14 (RPKM 0.1) and 1 other tissue See more Orthologs human all Genomic context Location: X F4; X 73.95 cM See Ppef1 in Genome Data Viewer Exon count: 20 Annotation release Status Assembly Chr Location 108 current GRCm38.p6 (GCF_000001635.26) X NC_000086.7 (160622419..160751290, complement) Build 37.2 previous assembly MGSCv37 (GCF_000001635.18) X NC_000086.6 (157061026..157157904, complement) Chromosome X - NC_000086.7 Page 6 of 8 https://www.alphaknockout.com Transcript information: This gene has 3 transcripts Gene: Ppef1 ENSMUSG00000062168 Description protein phosphatase with EF hand calcium-binding domain 1 [Source:MGI Symbol;Acc:MGI:1097157] Gene Synonyms Dres10, PPEF 1, PPEF-1 Location Chromosome X: 160,623,094-160,735,765 reverse strand. GRCm38:CM001013.2 About this gene This gene has 3 transcripts (splice variants), 215 orthologues, 12 paralogues, is a member of 1 Ensembl protein family and is associated with 1 phenotype. Transcripts Name Transcript ID bp Protein Translation ID Biotype CCDS UniProt Flags Ppef1-201 ENSMUST00000071204.11 2483 650aa ENSMUSP00000071191.5 Protein coding CCDS41200 O35655 TSL:2 GENCODE basic APPRIS P1 Ppef1-202 ENSMUST00000135856.1 1064 237aa ENSMUSP00000123408.1 Protein coding - Q3UQZ5 CDS 3' incomplete TSL:1 Ppef1-203 ENSMUST00000136888.1 252 56aa ENSMUSP00000121692.1 Protein coding - B7ZCG2 CDS 3' incomplete TSL:5 132.67 kb Forward strand 160.62Mb 160.64Mb 160.66Mb 160.68Mb 160.70Mb 160.72Mb 160.74Mb Genes Gm15244-201 >processed pseudogene (Comprehensive set... Contigs AL732450.5 > AL669939.9 > Genes (Comprehensive set... < Ppef1-201protein coding < Ppef1-202protein coding < Ppef1-203protein coding < Gm15242-201processed pseudogene Regulatory Build 160.62Mb 160.64Mb 160.66Mb 160.68Mb 160.70Mb 160.72Mb 160.74Mb Reverse strand 132.67 kb Regulation Legend CTCF Open Chromatin Gene Legend Protein Coding merged Ensembl/Havana Ensembl protein coding Non-Protein Coding pseudogene Page 7 of 8 https://www.alphaknockout.com Transcript: ENSMUST00000071204 < Ppef1-201protein coding Reverse strand 96.88 kb ENSMUSP00000071... MobiDB lite Low complexity (Seg) Superfamily SSF56300 EF-hand domain pair SMART Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatase IQ motif, EF-hand binding site EF-hand domain Prints Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatase Pfam PPP domain Calcineurin-like phosphoesterase domain, ApaH type EF-hand domain PROSITE profiles EF-hand domain PROSITE patterns Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatase EF-Hand 1, calcium-binding site PIRSF Serine/threonine-protein phosphatase with EF-hands PANTHER PTHR45668:SF1 PTHR45668 Gene3D Metallo-dependent phosphatase-like 1.10.238.10 CDD cd07420 EF-hand domain All sequence SNPs/i... Sequence variants (dbSNP and all other sources) Variant Legend inframe deletion missense variant synonymous variant Scale bar 0 60 120 180 240 300 360 420 480 540 650 We wish to acknowledge the following valuable scientific information resources: Ensembl, MGI, NCBI, UCSC.
Load more

Recommended publications
  • 1 Long-Read Genome Sequencing for the Diagnosis Of
    bioRxiv preprint doi: https://doi.org/10.1101/2020.07.02.185447; this version posted September 14, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-ND 4.0 International license. Long-read genome sequencing for the diagnosis of neurodevelopmental disorders Susan M. Hiatt1, James M.J. Lawlor1, Lori H. Handley1, Ryne C. Ramaker1, Brianne B. Rogers1,2, E. Christopher Partridge1, Lori Beth Boston1, Melissa Williams1, Christopher B. Plott1, Jerry Jenkins1, David E. Gray1, James M. Holt1, Kevin M. Bowling1, E. Martina Bebin3, Jane Grimwood1, Jeremy Schmutz1, Gregory M. Cooper1* 1HudsonAlpha Institute for Biotechnology, Huntsville, AL, USA, 35806 2Department of Genetics, University of Alabama at Birmingham, Birmingham, AL, USA, 35924 3Department of Neurology, University of Alabama at Birmingham, Birmingham, AL, USA, 35924 *[email protected], 256-327-9490 Conflicts of Interest The authors all declare no conflicts of interest. 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.07.02.185447; this version posted September 14, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-ND 4.0 International license. Abstract Purpose Exome and genome sequencing have proven to be effective tools for the diagnosis of neurodevelopmental disorders (NDDs), but large fractions of NDDs cannot be attributed to currently detectable genetic variation. This is likely, at least in part, a result of the fact that many genetic variants are difficult or impossible to detect through typical short-read sequencing approaches.
    [Show full text]
  • Identification of Conserved Genes Triggering Puberty in European Sea
    Blázquez et al. BMC Genomics (2017) 18:441 DOI 10.1186/s12864-017-3823-2 RESEARCHARTICLE Open Access Identification of conserved genes triggering puberty in European sea bass males (Dicentrarchus labrax) by microarray expression profiling Mercedes Blázquez1,2* , Paula Medina1,2,3, Berta Crespo1,4, Ana Gómez1 and Silvia Zanuy1* Abstract Background: Spermatogenesisisacomplexprocesscharacterized by the activation and/or repression of a number of genes in a spatio-temporal manner. Pubertal development in males starts with the onset of the first spermatogenesis and implies the division of primary spermatogonia and their subsequent entry into meiosis. This study is aimed at the characterization of genes involved in the onset of puberty in European sea bass, and constitutes the first transcriptomic approach focused on meiosis in this species. Results: European sea bass testes collected at the onset of puberty (first successful reproduction) were grouped in stage I (resting stage), and stage II (proliferative stage). Transition from stage I to stage II was marked by an increase of 11ketotestosterone (11KT), the main fish androgen, whereas the transcriptomic study resulted in 315 genes differentially expressed between the two stages. The onset of puberty induced 1) an up-regulation of genes involved in cell proliferation, cell cycle and meiosis progression, 2) changes in genes related with reproduction and growth, and 3) a down-regulation of genes included in the retinoic acid (RA) signalling pathway. The analysis of GO-terms and biological pathways showed that cell cycle, cell division, cellular metabolic processes, and reproduction were affected, consistent with the early events that occur during the onset of puberty.
    [Show full text]
  • PPEF1 Monoclonal Antibody (M01), Clone 1F6-1A5
    PPEF1 monoclonal antibody (M01), clone 1F6-1A5 Catalog # : H00005475-M01 規格 : [ 100 ug ] List All Specification Application Image Product Mouse monoclonal antibody raised against a full length recombinant Western Blot (Transfected lysate) Description: PPEF1. Immunogen: PPEF1 (AAH36026, 1 a.a. ~ 653 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: MGCSSSSTKTRRSDTSLRAALIIQNWYRGYKARLKARQHYALTIFQSIEY ADEQGQMQLSTFFSFMLENYTHIHKEELELRNQSLESEQDMRDRWDYV DSIDVPDSYNGPRLQFPLTCTDIDLLLEAFKEQQILHAHYVLEVLFETKKV enlarge LKQMPNFTHIQTSPSKEVTICGDLHGKLDDLFLIFYKNGLPSERNPYVFNG Western Blot (Recombinant DFVDRGKNSIEILMILCVSFLVYPNDLHLNRGNHEDFMMNLRYGFTKEILH protein) KYKLHGKRILQILEEFYAWLPIGTIVDNEILVIHGGISETTDLNLLHRVERNK MKSVLIPPTETNRDHDTDSKHNKVGVTFNAHGRIKTNGSPTEHLTEHEWE ELISA QIIDILWSDPRGKNGCFPNTCRGGGCYFGPDVTSKILNKYQLKMLIRSHE CKPEGYEICHDGKVVTIFSASNYYEEGSNRGAYIKLCSGTTPRFFQYQVT RNAi Knockdown (Antibody KATCFQPLRQRVDTMENSAIKILRERVISRKSDLTRAFQLQDHRKSGKLS validated) VSQWAFCMENILGLNLPWRSLSSNLVNIDQNGNVEYMSSFQNIRIEKPVQ EAHSTLVETLYRYRSDLEIIFNAIDTDHSGLISVEEFRAMWKLFSSHYNVHI DDSQVNKLANIMDLNKDGSIDFNEFLKAFYVVHRYEDLMKPDVTNLG Host: Mouse Reactivity: Human enlarge Isotype: IgG1 Kappa Quality Control Antibody Reactive Against Recombinant Protein. Testing: Western Blot detection against Immunogen (97.57 KDa) . Storage Buffer: In 1x PBS, pH 7.4 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: MSDS: Download Datasheet: Download Applications Page 1 of 3 2016/5/21 Western Blot (Transfected lysate)
    [Show full text]
  • Frequent Loss of Heterozygosity Targeting the Inactive X Chromosome in Melanoma
    6476 Vol. 9, 6476–6482, December 15, 2003 Clinical Cancer Research Frequent Loss of Heterozygosity Targeting the Inactive X Chromosome in Melanoma James O. Indsto,1 Najah T. Nassif,2 INTRODUCTION Richard F. Kefford,1 and Graham J. Mann1 Chromosomal deletions and amplification events are fre- 1Westmead Institute for Cancer Research, University of Sydney at quent in advanced neoplasms and provide evidence for the Westmead Millennium Institute, Westmead, New South Wales, existence and location of putative tumor suppressor genes Australia, and 2Department of Cell and Molecular Biology, University (TSGs) and oncogenes. In melanoma, 9p and 10q deletions are of Technology, Sydney, New South Wales, Australia most frequent, and losses on 6q, 11q, 1p, 15p, 17q, and 18q are also frequently found (1, 2). However, no studies have focused on the X chromosome. In the human female, random inactiva- ABSTRACT tion of one copy of an X chromosome by hypermethylation is an After previous preliminary observations of paradoxical early event in embryogenesis, resulting in most tissues being a deletion events affecting the inactive X chromosome in mel- mosaic in terms of X inactivation status. Neoplasms, being anoma, we have surveyed the X chromosome for deletions clonal expansions of single precursor cells, usually share a using 23 polymorphic microsatellite markers in 28 inform- common X inactivation status. This can be conveniently assayed ative (female XX) metastatic melanomas. Ten tumors (36%) using the methylation-sensitive restriction enzyme HpaII, which showed at least one loss of heterozygosity (LOH) event, and has a recognition site within the highly polymorphic exon 1 in two cases an entire chromosome showed LOH at all CAG repeat (ARTR) in the androgen receptor (AR) gene.
    [Show full text]
  • Comparative Transcriptome Profiling of the Human and Mouse Dorsal Root Ganglia: an RNA-Seq-Based Resource for Pain and Sensory Neuroscience Research
    bioRxiv preprint doi: https://doi.org/10.1101/165431; this version posted October 13, 2017. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Title: Comparative transcriptome profiling of the human and mouse dorsal root ganglia: An RNA-seq-based resource for pain and sensory neuroscience research Short Title: Human and mouse DRG comparative transcriptomics Pradipta Ray 1, 2 #, Andrew Torck 1 , Lilyana Quigley 1, Andi Wangzhou 1, Matthew Neiman 1, Chandranshu Rao 1, Tiffany Lam 1, Ji-Young Kim 1, Tae Hoon Kim 2, Michael Q. Zhang 2, Gregory Dussor 1 and Theodore J. Price 1, # 1 The University of Texas at Dallas, School of Behavioral and Brain Sciences 2 The University of Texas at Dallas, Department of Biological Sciences # Corresponding authors Theodore J Price Pradipta Ray School of Behavioral and Brain Sciences School of Behavioral and Brain Sciences The University of Texas at Dallas The University of Texas at Dallas BSB 14.102G BSB 10.608 800 W Campbell Rd 800 W Campbell Rd Richardson TX 75080 Richardson TX 75080 972-883-4311 972-883-7262 [email protected] [email protected] Number of pages: 27 Number of figures: 9 Number of tables: 8 Supplementary Figures: 4 Supplementary Files: 6 Word count: Abstract = 219; Introduction = 457; Discussion = 1094 Conflict of interest: The authors declare no conflicts of interest Patient anonymity and informed consent: Informed consent for human tissue sources were obtained by Anabios, Inc. (San Diego, CA). Human studies: This work was approved by The University of Texas at Dallas Institutional Review Board (MR 15-237).
    [Show full text]
  • Identification of Selection Signatures Involved In
    Almeida et al. BMC Genomics (2019) 20:449 https://doi.org/10.1186/s12864-019-5811-1 RESEARCHARTICLE Open Access Identification of selection signatures involved in performance traits in a paternal broiler line Octávio Augusto Costa Almeida1, Gabriel Costa Monteiro Moreira1, Fernanda Marcondes Rezende2, Clarissa Boschiero3, Jane de Oliveira Peixoto4, Adriana Mercia Guaratini Ibelli4, Mônica Corrêa Ledur4, Francisco José de Novais1 and Luiz Lehmann Coutinho1* Abstract Background: Natural and artificial selection leads to changes in certain regions of the genome resulting in selection signatures that can reveal genes associated with the selected traits. Selection signatures may be identified using different methodologies, of which some are based on detecting contiguous sequences of homozygous identical-by- descent haplotypes, called runs of homozygosity (ROH), or estimating fixation index (FST) of genomic windows that indicates genetic differentiation. This study aimed to identify selection signatures in a paternal broiler TT line at generations 7th and 16th of selection and to investigate the genes annotated in these regions as well as the biological pathways involved. For such purpose, ROH and FST-based analysis were performed using whole genome sequence of twenty-eight chickens from two different generations. Results: ROH analysis identified homozygous regions of short and moderate size. Analysis of ROH patterns revealed regions commonly shared among animals and changes in ROH abundance and size between the two generations. Results also suggest that whole genome sequencing (WGS) outperforms SNPchip data avoiding overestimation of ROH size and underestimation of ROH number; however, sequencing costs can limited the number of animals analyzed. FST- based analysis revealed genetic differentiation in several genomic windows.
    [Show full text]
  • Comparative Transcriptome Profiling of the Human and Mouse Dorsal Root
    Research Paper Comparative transcriptome profiling of the human and mouse dorsal root ganglia: an RNA-seq–based resource for pain and sensory neuroscience research a,b a a a a a 07/20/2018 on BhDMf5ePHKav1zEoum1tQfN4a+kJLhEZgbsIHo4XMi0hCywCX1AWnYQp/IlQrHD3mH5nK33R3Qh4f27oe7zFUUf7ZAUK5aCsyqAeT54jiDxP7ZjumT3TrA== by https://journals.lww.com/pain from Downloaded Pradipta Ray , Andrew Torck , Lilyana Quigley , Andi Wangzhou , Matthew Neiman , Chandranshu Rao , Downloaded Tiffany Lama, Ji-Young Kima, Tae Hoon Kimb, Michael Q. Zhangb, Gregory Dussora, Theodore J. Pricea,* from https://journals.lww.com/pain Abstract Molecular neurobiological insight into human nervous tissues is needed to generate next-generation therapeutics for neurological disorders such as chronic pain. We obtained human dorsal root ganglia (hDRG) samples from organ donors and performed RNA- sequencing (RNA-seq) to study the hDRG transcriptional landscape, systematically comparing it with publicly available data from by BhDMf5ePHKav1zEoum1tQfN4a+kJLhEZgbsIHo4XMi0hCywCX1AWnYQp/IlQrHD3mH5nK33R3Qh4f27oe7zFUUf7ZAUK5aCsyqAeT54jiDxP7ZjumT3TrA== a variety of human and orthologous mouse tissues, including mouse DRG (mDRG). We characterized the hDRG transcriptional profile in terms of tissue-restricted gene coexpression patterns and putative transcriptional regulators, and formulated an information-theoretic framework to quantify DRG enrichment. Relevant gene families and pathways were also analyzed, including transcription factors, G-protein-coupled receptors, and ion channels. Our analyses reveal an hDRG-enriched protein-coding gene set (;140), some of which have not been described in the context of DRG or pain signaling. Most of these show conserved enrichment in mDRG and were mined for known drug–gene product interactions. Conserved enrichment of the vast majority of transcription factors suggests that the mDRG is a faithful model system for studying hDRG, because of evolutionarily conserved regulatory programs.
    [Show full text]
  • Clinically Annotated Breast, Ovarian and Pancreatic Cancer
    www.nature.com/scientificreports OPEN MetaGxData: Clinically Annotated Breast, Ovarian and Pancreatic Cancer Datasets and their Use in Received: 19 November 2018 Accepted: 31 May 2019 Generating a Multi-Cancer Gene Published: xx xx xxxx Signature Deena M. A. Gendoo 1, Michael Zon2,4, Vandana Sandhu2, Venkata S. K. Manem2,3,5, Natchar Ratanasirigulchai2, Gregory M. Chen2, Levi Waldron 6 & Benjamin Haibe- Kains2,3,7,8,9 A wealth of transcriptomic and clinical data on solid tumours are under-utilized due to unharmonized data storage and format. We have developed the MetaGxData package compendium, which includes manually-curated and standardized clinical, pathological, survival, and treatment metadata across breast, ovarian, and pancreatic cancer data. MetaGxData is the largest compendium of curated transcriptomic data for these cancer types to date, spanning 86 datasets and encompassing 15,249 samples. Open access to standardized metadata across cancer types promotes use of their transcriptomic and clinical data in a variety of cross-tumour analyses, including identifcation of common biomarkers, and assessing the validity of prognostic signatures. Here, we demonstrate that MetaGxData is a fexible framework that facilitates meta-analyses by using it to identify common prognostic genes in ovarian and breast cancer. Furthermore, we use the data compendium to create the frst gene signature that is prognostic in a meta-analysis across 3 cancer types. These fndings demonstrate the potential of MetaGxData to serve as an important resource in oncology research, and provide a foundation for future development of cancer-specifc compendia. Ovarian, breast and pancreatic cancers are among the leading causes of cancer deaths among women, and recent studies have identifed biological and molecular commonalities between them1–4.
    [Show full text]
  • Data-Driven Analysis of Age, Sex, and Tissue Effects on Gene Expression Variability in Alzheimer’S Disease Lavida R.K
    bioRxiv preprint doi: https://doi.org/10.1101/498527; this version posted December 17, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC 4.0 International license. 1 Data-Driven Analysis of Age, Sex, and Tissue Effects on Gene Expression Variability in Alzheimer’s Disease Lavida R.K. Brooks 1, George I. Mias,2;∗ 1 Institute for Quantitative Health Science and Engineering, Michigan State University, Microbiology and Molecular Genetics, East Lansing, 48824, USA 2 Institute for Quantitative Health Science and Engineering, Michigan State University, Biochemistry and Molecular Biology, East Lansing, 48824, USA Correspondence*: George I. Mias [email protected] 2 ABSTRACT 3 Alzheimer’s disease (AD) has been categorized by the Centers for Disease Control and 4 Prevention (CDC) as the 6th leading cause of death in the United States. AD is a significant 5 health-care burden because of its increased occurrence (specifically in the elderly population) 6 and the lack of effective treatments and preventive methods. With an increase in life expectancy, 7 the CDC expects AD cases to rise to 15 million by 2060. Aging has been previously associated 8 with susceptibility to AD, and there are ongoing efforts to effectively differentiate between normal 9 and AD age-related brain degeneration and memory loss. AD targets neuronal function and can 10 cause neuronal loss due to the buildup of amyloid-beta plaques and intracellular neurofibrillary 11 tangles. 12 Our study aims to identify temporal changes within gene expression profiles of healthy controls 13 and AD subjects.
    [Show full text]
  • 1 Novel Expression Signatures Identified by Transcriptional Analysis
    ARD Online First, published on October 7, 2009 as 10.1136/ard.2009.108043 Ann Rheum Dis: first published as 10.1136/ard.2009.108043 on 7 October 2009. Downloaded from Novel expression signatures identified by transcriptional analysis of separated leukocyte subsets in SLE and vasculitis 1Paul A Lyons, 1Eoin F McKinney, 1Tim F Rayner, 1Alexander Hatton, 1Hayley B Woffendin, 1Maria Koukoulaki, 2Thomas C Freeman, 1David RW Jayne, 1Afzal N Chaudhry, and 1Kenneth GC Smith. 1Cambridge Institute for Medical Research and Department of Medicine, Addenbrooke’s Hospital, Hills Road, Cambridge, CB2 0XY, UK 2Roslin Institute, University of Edinburgh, Roslin, Midlothian, EH25 9PS, UK Correspondence should be addressed to Dr Paul Lyons or Prof Kenneth Smith, Department of Medicine, Cambridge Institute for Medical Research, Addenbrooke’s Hospital, Hills Road, Cambridge, CB2 0XY, UK. Telephone: +44 1223 762642, Fax: +44 1223 762640, E-mail: [email protected] or [email protected] Key words: Gene expression, autoimmune disease, SLE, vasculitis Word count: 2,906 The Corresponding Author has the right to grant on behalf of all authors and does grant on behalf of all authors, an exclusive licence (or non-exclusive for government employees) on a worldwide basis to the BMJ Publishing Group Ltd and its Licensees to permit this article (if accepted) to be published in Annals of the Rheumatic Diseases and any other BMJPGL products to exploit all subsidiary rights, as set out in their licence (http://ard.bmj.com/ifora/licence.pdf). http://ard.bmj.com/ on September 29, 2021 by guest. Protected copyright. 1 Copyright Article author (or their employer) 2009.
    [Show full text]
  • Primepcr™Assay Validation Report
    PrimePCR™Assay Validation Report Gene Information Gene Name protein phosphatase, EF-hand calcium binding domain 1 Gene Symbol PPEF1 Organism Human Gene Summary This gene encodes a member of the serine/threonine protein phosphatase with EF-hand motif family. The protein contains a protein phosphatase catalytic domain and at least two EF-hand calcium-binding motifs in its C terminus. Although its substrate(s) is unknown the encoded protein has been suggested to play a role in specific sensory neuron function and/or development. This gene shares high sequence similarity with the Drosophila retinal degeneration C (rdgC) gene. Several alternatively spliced transcript variants each encoding a distinct isoform have been described. Gene Aliases PP7, PPEF, PPP7C, PPP7CA RefSeq Accession No. NC_000023.10, NG_012519.1, NT_167197.1 UniGene ID Hs.211589 Ensembl Gene ID ENSG00000086717 Entrez Gene ID 5475 Assay Information Unique Assay ID qHsaCEP0049810 Assay Type Probe - Validation information is for the primer pair using SYBR® Green detection Detected Coding Transcript(s) ENST00000361511, ENST00000470157, ENST00000359763, ENST00000349874, ENST00000543630, ENST00000544635 Amplicon Context Sequence ACTTTAATGAGTTTTTAAAGGCTTTCTATGTAGTGCATAGATATGAAGACTTGATG AAACCTGATGTCACCAACCTTGGCTAAACACAAATGAGAGCTTCCCTC Amplicon Length (bp) 74 Chromosome Location X:18845523-18845626 Assay Design Exonic Purification Desalted Validation Results Efficiency (%) 97 R2 0.9997 cDNA Cq 28.22 Page 1/5 PrimePCR™Assay Validation Report cDNA Tm (Celsius) 78 gDNA Cq 25.76 Specificity
    [Show full text]
  • Functional Genomics Approach Identifies Novel Signaling Regulators of Tgfa Ectodomain Shedding
    Published OnlineFirst October 10, 2017; DOI: 10.1158/1541-7786.MCR-17-0140 Signal Transduction Molecular Cancer Research Functional Genomics Approach Identifies Novel Signaling Regulators of TGFa Ectodomain Shedding Jennifer L. Wilson1, Eirini Kefaloyianni2, Lauren Stopfer1, Christina Harrison3, Venkata S. Sabbisetti4, Ernest Fraenkel1,5, Douglas A. Lauffenburger1, and Andreas Herrlich2 Abstract Ectodomain shedding of cell-surface precursor proteins by shRNA genomic screen, computational network analysis, and metalloproteases generates important cellular signaling molecules. dedicated validation tests succeeded in identifying several key Of importance for disease is the release of ligands that activate the signaling pathways as novel regulators of TGFa shedding in cancer EGFR, such as TGFa, which is mostly carried out by ADAM17 [a cells. Most notably, a cluster of genes with NFkBpathwayregu- member of the A-disintegrin and metalloprotease (ADAM) latory functions was found to strongly influence TGFa release, domain family]. EGFR ligand shedding has been linked to many albeit independent of their NFkB regulatory functions. Inflamma- diseases, in particular cancer development, growth and metastasis, tory regulators thus also govern cancer cell growth–promoting as well as resistance to cancer therapeutics. Excessive EGFR ligand ectodomain cleavage, lending mechanistic understanding to the release can outcompete therapeutic EGFR inhibition or the inhi- well-known connection between inflammation and cancer. bition of other growth factor pathways by providing bypass signaling via EGFR activation. Drugging metalloproteases directly Implications: Using genomic screens and network analysis, this have failed clinically because it indiscriminately affected shedding study defines targets that regulate ectodomain shedding and of numerous substrates. It is therefore essential to identify regu- suggests new treatment opportunities for EGFR-driven cancers.
    [Show full text]