DOCSLIB.ORG

Omics Profile Interpretation on Molecular Interaction

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Omics Profile Interpretation on Molecular Interaction Die approbierte Originalversion dieser Dissertation ist an der Hauptbibliothek der Technischen Universität Wien aufgestellt (http://www.ub.tuwien.ac.at). The approved original version of this thesis is available at the main library of the Vienna University of Technology (http://www.ub.tuwien.ac.at/englweb/). Omics profile interpretation on molecular interaction graphs DISSERTATION zur Erlangung des akademischen Grades Doktor der technischen Wissenschaften eingereicht von Raul Fechete Matrikelnummer 0225871 an der Fakultät für Informatik der Technischen Universität Wien Betreuung: Univ.-Prof. Dr. Rudolf Freund Univ.-Doz. Dr. Bernd Mayer Diese Dissertation haben begutachtet: (Univ.-Prof. Dr. Rudolf Freund) (Univ.-Doz. Dr. Bernd Mayer) Wien, 01.10.2012 (Raul Fechete) Technische Universität Wien A-1040 Wien Karlsplatz 13 Tel. +43-1-58801-0 www.tuwien.ac.at Omics profile interpretation on molecular interaction graphs DISSERTATION submitted in partial fulfillment of the requirements for the degree of Doktor der technischen Wissenschaften by Raul Fechete Registration Number 0225871 to the Faculty of Informatics at the Vienna University of Technology Advisors: Univ.-Prof. Dr. Rudolf Freund Univ.-Doz. Dr. Bernd Mayer The dissertation has been reviewed by: (Univ.-Prof. Dr. Rudolf Freund) (Univ.-Doz. Dr. Bernd Mayer) Wien, 01.10.2012 (Raul Fechete) Technische Universität Wien A-1040 Wien Karlsplatz 13 Tel. +43-1-58801-0 www.tuwien.ac.at Erklärung zur Verfassung der Arbeit Raul Fechete Pilgerimgasse 25/13, 1150 Wien Hiermit erkläre ich, dass ich diese Arbeit selbständig verfasst habe, dass ich die verwende- ten Quellen und Hilfsmittel vollständig angegeben habe und dass ich die Stellen der Arbeit - einschließlich Tabellen, Karten und Abbildungen -, die anderen Werken oder dem Internet im Wortlaut oder dem Sinn nach entnommen sind, auf jeden Fall unter Angabe der Quelle als Ent- lehnung kenntlich gemacht habe. (Ort, Datum) (Unterschrift Verfasser) i Acknowledgements I would like to thank my mentors Bernd Mayer and Rudolf Freund for their guidance and expert advice, as well as all my colleagues from emergentec for the great working environment of the past five years. Thank you. iii Abstract Molecular interaction networks are a core concept in Life Sciences - a field of study with the specific focus on integrative information analysis - and an ideal tool for modeling cellular pro- cesses. On the molecular level, cellular processes are the direct cause of phenotype, whether healthy or diseased, and all observable properties of a cell can be traced back to one or more processes. One of today’s main challenges in research is the variability of disease on the process level, meaning similar phenotypes often have different causes. With the advent of the Omics revo- lution, an enormous amount of data relevant in this context has become available, much of it, however, still pending meaningful interpretation. Here we demonstrate two approaches to tackle heterogeneity on the process level, based on Omics data integration on molecular interaction graphs. The first one uses a synthetic lethality network to address heterogeneity in cancer, while the second one uses an extended protein- protein interaction network for overcoming variance towards patient stratification. Our first method demonstrates both in neuroblastoma cell-lines and in human tissue how to find synthetic lethal hubs the knock-down of which would lead to the death of malignant cells. We generalize this method for three additional tumor types and identify relevant hubs including drugs for targeting them. In our second method we propose a novel interaction network holding validated protein- protein interactions and edges additionally inferred from high quality pathway, ontology and domain data. We use this network to investigate diabetic nephropathy from a clinical perspective based on literature, drug, clinical trial and patent information. Subsequently, we introduce the concept of units towards identifying multi-biomarker panels for patient stratification. Our results demonstrate that it is possible through information integration to address biolog- ical variability issues while at the same improving causative interpretability. We assert that the methods presented in this thesis expand the set of available treatment approaches and will prove in the midterm to be a valuable stepping stone towards Systems Medicine. v Kurzfassung Molekulare Interaktionsetzwerke stellen ein Kernkonzept in Life Sciences - ein Forschungs- gebiet dessen Hauptaugenmerk auf der integrativen Informationsanalyse liegt - dar und sind gleichzeitig ein optimales Werkzeug für die Modellierung von zellulären Prozessen. Auf mole- kularer Ebene stellen solche Abläufe die Ursache für den Phänotyp dar und alle Merkmale eines Organismus lassen sich zu einem oder mehreren solchen Prozessen zurückverfolgen. Eine der größten Herausforderungen der heutigen Forschung ist die Variabilität der Erkran- kung auf Prozessebene, dh ähnliche Phänotypen haben oft verschiedene Ursachen. Mit dem Advent der Omics Revolution, ist eine Lawine an relevanten Daten verfügbar geworden, denen jedoch zum Großteil noch eine sinnvolle Interpretation fehlt. In dieser Arbeit werden zwei Ansätze zur Bekämpfung von Heterogenität auf Prozessebene präsentiert, welche auf Omics Datenintegration auf molekularen Interaktionsgraphen basieren. Der erste Ansatz benutzt ein Netzwerk von synthetischen letalen Interaktionen um die Hete- rogenität in der Krebstherapie in den Griff zu bekommen, während der zweite ein erweitertes Protein-Protein Interaktionsnetzwerk verwendet um biologischer Varianz hinsichtlich Patienten- stratifizierung entgegen zu wirken. Die Ergebnisse der ersten Methode zeigen, dass es möglich ist sowohl in Neuroblastom Zell- linien als auch im menschlichen Gewebe synthetisch letale Hubs zu identifizieren, der Knock- down welcher den Tod maligner Zellen herbeiführen würde. Diese Methode wird anschließend für drei weitere Tumorarten verallgemeinert und relevante Hubs und Medikamente werden iden- tifiziert. In der zweiten Methode wird ein neues Interaktionsnetzwerk präsentiert, das einerseits vali- dierte Protein-Protein Interaktionen und andererseits aus hochqualitativen Pathway-, Ontologie- und Domänendaten abgeleitete Kanten enthält. Das Netzwerk wird benutzt um die diabetische Nephropathie aus klinischer Sicht zu durchleuchten. Ein Units-Konzept zur Identifikation von Biomarker Kombinationen zwecks Patientenstratifizierung wird abschließend exemplifiziert. Die Ergebnisse zeigen, dass es durch Informationsintegration möglich ist die biologische Variabilität bei gleichzeitiger Verbesserung der Interpretierbarkeit in den Griff zu bekommen. Wir behaupten, dass die Methoden, die in dieser Arbeit präsentiert wurden, die derzeit verfüg- baren Behandlungsansätze erweitern und sich mittelfristig als wertvoller Schritt in Richtung Systemmedizin erweisen werden. vii Contents 1 Introduction 1 1.1 The Omics revolution: from association to causality . 1 1.2 Biological networks: a step towards causality . 2 General network concepts . 3 Genetic interaction networks . 4 Protein interaction networks . 4 Molecular pathways . 5 Omics integration approaches . 5 1.3 Systems Medicine: are we there yet? . 6 1.4 Thesis scope and goals . 7 2 Genetic interaction networks: synthetic lethality 9 2.1 Why synthetic lethality? . 9 2.2 A synlet-based approach to tackling vincristine resistant neuroblastoma . 12 Concept outline and goals . 12 Materials and methods . 14 Results . 17 Discussion and conclusion . 29 2.3 A generic synlet-based approach to tackling chemoresistance in tumor . 33 Concept outline and goals . 33 Materials and methods . 35 Results and discussion . 39 2.4 Summary of genetic interaction networks . 42 3 Protein interaction networks 43 3.1 A new model for protein interaction networks: omicsNET . 43 Concept outline and goals . 43 Materials and methods . 45 Results . 47 Discussion and conclusion . 54 3.2 A new platform for visualizing molecular information: BIO . 57 Concept outline and goals . 57 Architecture and implementation . 57 ix Summary and outlook . 66 3.3 A network-based in-silico analysis of diabetic nephropathy . 66 Concept outline and goals . 67 Materials and methods . 69 Results . 72 Discussion and conclusion . 78 3.4 A units-based in-silico approach exemplified for diabetic nephropathy . 83 Concept outline and goals . 84 Materials and methods . 86 Results and discussion . 92 3.5 Summary of protein interaction networks . 94 4 Discussion and conclusion 97 Bibliography 99 A Curriculum vitae 121 B Publication list 123 x CHAPTER 1 Introduction 1.1 The Omics revolution: from association to causality The discovery of the deoxyribonucleic acid (DNA) 1953 by Watson and Crick [1] proved to be a major milestone that would revolutionize biology for the years to come. In time, our under- standing of genetics deepened as more became known of the cell. Ribonucleic acids (RNA) and proteins were discovered and the transcription / translation principle of the protein formation was brought to paper. The initial hypothesis of the DNA being a phenotype (the composite of an organism’s ob- servable characteristics) blueprint was validated and with increasing knowledge it became evi- dent that the phenotype was a result of both intrinsic factors such as complex interactions be- tween DNA, RNA, proteins and other compounds in the cell as well as extrinsic, i.e. environ- mental factors. The discovery of the link between cellular processes and phenotype opened new avenues in biological
Load more

Recommended publications
  • Screening and Identification of Key Biomarkers in Clear Cell Renal Cell Carcinoma Based on Bioinformatics Analysis
    bioRxiv preprint doi: https://doi.org/10.1101/2020.12.21.423889; this version posted December 23, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Screening and identification of key biomarkers in clear cell renal cell carcinoma based on bioinformatics analysis Basavaraj Vastrad1, Chanabasayya Vastrad*2 , Iranna Kotturshetti 1. Department of Biochemistry, Basaveshwar College of Pharmacy, Gadag, Karnataka 582103, India. 2. Biostatistics and Bioinformatics, Chanabasava Nilaya, Bharthinagar, Dharwad 580001, Karanataka, India. 3. Department of Ayurveda, Rajiv Gandhi Education Society`s Ayurvedic Medical College, Ron, Karnataka 562209, India. * Chanabasayya Vastrad [email protected] Ph: +919480073398 Chanabasava Nilaya, Bharthinagar, Dharwad 580001 , Karanataka, India bioRxiv preprint doi: https://doi.org/10.1101/2020.12.21.423889; this version posted December 23, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Abstract Clear cell renal cell carcinoma (ccRCC) is one of the most common types of malignancy of the urinary system. The pathogenesis and effective diagnosis of ccRCC have become popular topics for research in the previous decade. In the current study, an integrated bioinformatics analysis was performed to identify core genes associated in ccRCC. An expression dataset (GSE105261) was downloaded from the Gene Expression Omnibus database, and included 26 ccRCC and 9 normal kideny samples. Assessment of the microarray dataset led to the recognition of differentially expressed genes (DEGs), which was subsequently used for pathway and gene ontology (GO) enrichment analysis.
    [Show full text]
  • Applied Category Theory for Genomics – an Initiative
    Applied Category Theory for Genomics { An Initiative Yanying Wu1,2 1Centre for Neural Circuits and Behaviour, University of Oxford, UK 2Department of Physiology, Anatomy and Genetics, University of Oxford, UK 06 Sept, 2020 Abstract The ultimate secret of all lives on earth is hidden in their genomes { a totality of DNA sequences. We currently know the whole genome sequence of many organisms, while our understanding of the genome architecture on a systematic level remains rudimentary. Applied category theory opens a promising way to integrate the humongous amount of heterogeneous informations in genomics, to advance our knowledge regarding genome organization, and to provide us with a deep and holistic view of our own genomes. In this work we explain why applied category theory carries such a hope, and we move on to show how it could actually do so, albeit in baby steps. The manuscript intends to be readable to both mathematicians and biologists, therefore no prior knowledge is required from either side. arXiv:2009.02822v1 [q-bio.GN] 6 Sep 2020 1 Introduction DNA, the genetic material of all living beings on this planet, holds the secret of life. The complete set of DNA sequences in an organism constitutes its genome { the blueprint and instruction manual of that organism, be it a human or fly [1]. Therefore, genomics, which studies the contents and meaning of genomes, has been standing in the central stage of scientific research since its birth. The twentieth century witnessed three milestones of genomics research [1]. It began with the discovery of Mendel's laws of inheritance [2], sparked a climax in the middle with the reveal of DNA double helix structure [3], and ended with the accomplishment of a first draft of complete human genome sequences [4].
    [Show full text]
  • 1 Long-Read Genome Sequencing for the Diagnosis Of
    bioRxiv preprint doi: https://doi.org/10.1101/2020.07.02.185447; this version posted September 14, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-ND 4.0 International license. Long-read genome sequencing for the diagnosis of neurodevelopmental disorders Susan M. Hiatt1, James M.J. Lawlor1, Lori H. Handley1, Ryne C. Ramaker1, Brianne B. Rogers1,2, E. Christopher Partridge1, Lori Beth Boston1, Melissa Williams1, Christopher B. Plott1, Jerry Jenkins1, David E. Gray1, James M. Holt1, Kevin M. Bowling1, E. Martina Bebin3, Jane Grimwood1, Jeremy Schmutz1, Gregory M. Cooper1* 1HudsonAlpha Institute for Biotechnology, Huntsville, AL, USA, 35806 2Department of Genetics, University of Alabama at Birmingham, Birmingham, AL, USA, 35924 3Department of Neurology, University of Alabama at Birmingham, Birmingham, AL, USA, 35924 *[email protected], 256-327-9490 Conflicts of Interest The authors all declare no conflicts of interest. 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.07.02.185447; this version posted September 14, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-ND 4.0 International license. Abstract Purpose Exome and genome sequencing have proven to be effective tools for the diagnosis of neurodevelopmental disorders (NDDs), but large fractions of NDDs cannot be attributed to currently detectable genetic variation. This is likely, at least in part, a result of the fact that many genetic variants are difficult or impossible to detect through typical short-read sequencing approaches.
    [Show full text]
  • Mouse Ppef1 Knockout Project (CRISPR/Cas9)
    https://www.alphaknockout.com Mouse Ppef1 Knockout Project (CRISPR/Cas9) Objective: To create a Ppef1 knockout Mouse model (C57BL/6J) by CRISPR/Cas-mediated genome engineering. Strategy summary: The Ppef1 gene (NCBI Reference Sequence: NM_011147 ; Ensembl: ENSMUSG00000062168 ) is located on Mouse chromosome X. 16 exons are identified, with the ATG start codon in exon 1 and the TAA stop codon in exon 16 (Transcript: ENSMUST00000071204). Exon 2~4 will be selected as target site. Cas9 and gRNA will be co-injected into fertilized eggs for KO Mouse production. The pups will be genotyped by PCR followed by sequencing analysis. Note: Homozygous null female and hemizygous null male mice are viable, fertile and display no overt abnormalities. Exon 2 starts from about 2.41% of the coding region. Exon 2~4 covers 18.41% of the coding region. The size of effective KO region: ~10105 bp. The KO region does not have any other known gene. Page 1 of 8 https://www.alphaknockout.com Overview of the Targeting Strategy Wildtype allele 5' gRNA region gRNA region 3' 1 2 3 4 16 Legends Exon of mouse Ppef1 Knockout region Page 2 of 8 https://www.alphaknockout.com Overview of the Dot Plot (up) Window size: 15 bp Forward Reverse Complement Sequence 12 Note: The 2000 bp section upstream of Exon 2 is aligned with itself to determine if there are tandem repeats. No significant tandem repeat is found in the dot plot matrix. So this region is suitable for PCR screening or sequencing analysis. Overview of the Dot Plot (down) Window size: 15 bp Forward Reverse Complement Sequence 12 Note: The 2000 bp section downstream of Exon 4 is aligned with itself to determine if there are tandem repeats.
    [Show full text]
  • UNIVERSITY of CALIFORNIA SAN DIEGO Making Sense of Microbial
    UNIVERSITY OF CALIFORNIA SAN DIEGO Making sense of microbial populations from representative samples A dissertation submitted in partial satisfaction of the requirements for the degree Doctor of Philosophy in Computer Science by James T. Morton Committee in charge: Professor Rob Knight, Chair Professor Pieter Dorrestein Professor Rachel Dutton Professor Yoav Freund Professor Siavash Mirarab 2018 Copyright James T. Morton, 2018 All rights reserved. The dissertation of James T. Morton is approved, and it is acceptable in quality and form for publication on microfilm and electronically: Chair University of California San Diego 2018 iii DEDICATION To my friends and family who paved the road and lit the journey. iv EPIGRAPH The ‘paradox’ is only a conflict between reality and your feeling of what reality ‘ought to be’ —Richard Feynman v TABLE OF CONTENTS Signature Page . iii Dedication . iv Epigraph . .v Table of Contents . vi List of Abbreviations . ix List of Figures . .x List of Tables . xi Acknowledgements . xii Vita ............................................. xiv Abstract of the Dissertation . xvii Chapter 1 Methods for phylogenetic analysis of microbiome data . .1 1.1 Introduction . .2 1.2 Phylogenetic Inference . .4 1.3 Phylogenetic Comparative Methods . .6 1.4 Ancestral State Reconstruction . .9 1.5 Analysis of phylogenetic variables . 11 1.6 Using Phylogeny-Aware Distances . 15 1.7 Challenges of phylogenetic analysis . 18 1.8 Discussion . 19 1.9 Acknowledgements . 21 Chapter 2 Uncovering the horseshoe effect in microbial analyses . 23 2.1 Introduction . 24 2.2 Materials and Methods . 34 2.3 Acknowledgements . 35 Chapter 3 Balance trees reveal microbial niche differentiation . 36 3.1 Introduction .
    [Show full text]
  • Identification of Conserved Genes Triggering Puberty in European Sea
    Blázquez et al. BMC Genomics (2017) 18:441 DOI 10.1186/s12864-017-3823-2 RESEARCHARTICLE Open Access Identification of conserved genes triggering puberty in European sea bass males (Dicentrarchus labrax) by microarray expression profiling Mercedes Blázquez1,2* , Paula Medina1,2,3, Berta Crespo1,4, Ana Gómez1 and Silvia Zanuy1* Abstract Background: Spermatogenesisisacomplexprocesscharacterized by the activation and/or repression of a number of genes in a spatio-temporal manner. Pubertal development in males starts with the onset of the first spermatogenesis and implies the division of primary spermatogonia and their subsequent entry into meiosis. This study is aimed at the characterization of genes involved in the onset of puberty in European sea bass, and constitutes the first transcriptomic approach focused on meiosis in this species. Results: European sea bass testes collected at the onset of puberty (first successful reproduction) were grouped in stage I (resting stage), and stage II (proliferative stage). Transition from stage I to stage II was marked by an increase of 11ketotestosterone (11KT), the main fish androgen, whereas the transcriptomic study resulted in 315 genes differentially expressed between the two stages. The onset of puberty induced 1) an up-regulation of genes involved in cell proliferation, cell cycle and meiosis progression, 2) changes in genes related with reproduction and growth, and 3) a down-regulation of genes included in the retinoic acid (RA) signalling pathway. The analysis of GO-terms and biological pathways showed that cell cycle, cell division, cellular metabolic processes, and reproduction were affected, consistent with the early events that occur during the onset of puberty.
    [Show full text]
  • Standardised Benchmarking in the Quest for Orthologs
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Harvard University - DASH Standardised Benchmarking in the Quest for Orthologs The Harvard community has made this article openly available. Please share how this access benefits you. Your story matters Citation Altenhoff, A. M., B. Boeckmann, S. Capella-Gutierrez, D. A. Dalquen, T. DeLuca, K. Forslund, J. Huerta-Cepas, et al. 2016. “Standardised Benchmarking in the Quest for Orthologs.” Nature methods 13 (5): 425-430. doi:10.1038/nmeth.3830. http://dx.doi.org/10.1038/ nmeth.3830. Published Version doi:10.1038/nmeth.3830 Citable link http://nrs.harvard.edu/urn-3:HUL.InstRepos:29408292 Terms of Use This article was downloaded from Harvard University’s DASH repository, and is made available under the terms and conditions applicable to Other Posted Material, as set forth at http:// nrs.harvard.edu/urn-3:HUL.InstRepos:dash.current.terms-of- use#LAA HHS Public Access Author manuscript Author ManuscriptAuthor Manuscript Author Nat Methods Manuscript Author . Author manuscript; Manuscript Author available in PMC 2016 October 04. Published in final edited form as: Nat Methods. 2016 May ; 13(5): 425–430. doi:10.1038/nmeth.3830. Standardised Benchmarking in the Quest for Orthologs Adrian M. Altenhoff1,2, Brigitte Boeckmann3, Salvador Capella-Gutierrez4,5,6, Daniel A. Dalquen7, Todd DeLuca8, Kristoffer Forslund9, Jaime Huerta-Cepas9, Benjamin Linard10, Cécile Pereira11,12, Leszek P. Pryszcz4, Fabian Schreiber13, Alan Sousa da Silva13, Damian Szklarczyk14,15, Clément-Marie Train1, Peer Bork9,16,17, Odile Lecompte18, Christian von Mering14,15, Ioannis Xenarios3,19,20, Kimmen Sjölander21, Lars Juhl Jensen22, Maria J.
    [Show full text]
  • Molecular Effects of Isoflavone Supplementation Human Intervention Studies and Quantitative Models for Risk Assessment
    Molecular effects of isoflavone supplementation Human intervention studies and quantitative models for risk assessment Vera van der Velpen Thesis committee Promotors Prof. Dr Pieter van ‘t Veer Professor of Nutritional Epidemiology Wageningen University Prof. Dr Evert G. Schouten Emeritus Professor of Epidemiology and Prevention Wageningen University Co-promotors Dr Anouk Geelen Assistant professor, Division of Human Nutrition Wageningen University Dr Lydia A. Afman Assistant professor, Division of Human Nutrition Wageningen University Other members Prof. Dr Jaap Keijer, Wageningen University Dr Hubert P.J.M. Noteborn, Netherlands Food en Consumer Product Safety Authority Prof. Dr Yvonne T. van der Schouw, UMC Utrecht Dr Wendy L. Hall, King’s College London This research was conducted under the auspices of the Graduate School VLAG (Advanced studies in Food Technology, Agrobiotechnology, Nutrition and Health Sciences). Molecular effects of isoflavone supplementation Human intervention studies and quantitative models for risk assessment Vera van der Velpen Thesis submitted in fulfilment of the requirements for the degree of doctor at Wageningen University by the authority of the Rector Magnificus Prof. Dr M.J. Kropff, in the presence of the Thesis Committee appointed by the Academic Board to be defended in public on Friday 20 June 2014 at 13.30 p.m. in the Aula. Vera van der Velpen Molecular effects of isoflavone supplementation: Human intervention studies and quantitative models for risk assessment 154 pages PhD thesis, Wageningen University, Wageningen, NL (2014) With references, with summaries in Dutch and English ISBN: 978-94-6173-952-0 ABSTRact Background: Risk assessment can potentially be improved by closely linked experiments in the disciplines of epidemiology and toxicology.
    [Show full text]
  • Testing for Differentially Expressed Genes and Key Biological Categories in DNA Microarray Analysis
    UNIVERSITY OF CINCINNATI Date:___________________ I, _________________________________________________________, hereby submit this work as part of the requirements for the degree of: in: It is entitled: This work and its defense approved by: Chair: _______________________________ _______________________________ _______________________________ _______________________________ _______________________________ Testing for Differentially Expressed Genes and Key Biological Categories in DNA Microarray Analysis A dissertation submitted to the Graduate School of the University of Cincinnati In partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY in the Department of Environmental Health of the College of Medicine 2007 By Maureen A. Sartor Masters in Biomathematics, North Carolina State University, August 2000 B.S., Xavier University, Cincinnati, Ohio, 1998 Committee Chair: Dr. Mario Medvedovic ABSTRACT DNA microarrays are a revolutionary technology able to measure the expression levels of thousands of genes simultaneously, providing a snapshot in time of a tissue or cell culture‟s transcriptome. Although microarrays have been in existence for several years now, research is yet ongoing for how to best analyze the data, at least partly due to the combination of small sample sizes (few replicates) with large numbers of genes. Several challenges remain in maximizing the amount of biological information attainable from a microarray experiment. The key components of microarray analysis where these challenges lie are experimental design, preprocessing, statistical inference, identifying expression patterns, and understanding biological relevance. In this dissertation we aim to improve the analysis and interpretation of microarray data by concentrating on two key steps in microarray analysis: obtaining accurate estimates of significance when testing for differentially expressed genes, and identifying key biological functions and cellular pathways affected by the experimental conditions.
    [Show full text]
  • PPEF1 Monoclonal Antibody (M01), Clone 1F6-1A5
    PPEF1 monoclonal antibody (M01), clone 1F6-1A5 Catalog # : H00005475-M01 規格 : [ 100 ug ] List All Specification Application Image Product Mouse monoclonal antibody raised against a full length recombinant Western Blot (Transfected lysate) Description: PPEF1. Immunogen: PPEF1 (AAH36026, 1 a.a. ~ 653 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: MGCSSSSTKTRRSDTSLRAALIIQNWYRGYKARLKARQHYALTIFQSIEY ADEQGQMQLSTFFSFMLENYTHIHKEELELRNQSLESEQDMRDRWDYV DSIDVPDSYNGPRLQFPLTCTDIDLLLEAFKEQQILHAHYVLEVLFETKKV enlarge LKQMPNFTHIQTSPSKEVTICGDLHGKLDDLFLIFYKNGLPSERNPYVFNG Western Blot (Recombinant DFVDRGKNSIEILMILCVSFLVYPNDLHLNRGNHEDFMMNLRYGFTKEILH protein) KYKLHGKRILQILEEFYAWLPIGTIVDNEILVIHGGISETTDLNLLHRVERNK MKSVLIPPTETNRDHDTDSKHNKVGVTFNAHGRIKTNGSPTEHLTEHEWE ELISA QIIDILWSDPRGKNGCFPNTCRGGGCYFGPDVTSKILNKYQLKMLIRSHE CKPEGYEICHDGKVVTIFSASNYYEEGSNRGAYIKLCSGTTPRFFQYQVT RNAi Knockdown (Antibody KATCFQPLRQRVDTMENSAIKILRERVISRKSDLTRAFQLQDHRKSGKLS validated) VSQWAFCMENILGLNLPWRSLSSNLVNIDQNGNVEYMSSFQNIRIEKPVQ EAHSTLVETLYRYRSDLEIIFNAIDTDHSGLISVEEFRAMWKLFSSHYNVHI DDSQVNKLANIMDLNKDGSIDFNEFLKAFYVVHRYEDLMKPDVTNLG Host: Mouse Reactivity: Human enlarge Isotype: IgG1 Kappa Quality Control Antibody Reactive Against Recombinant Protein. Testing: Western Blot detection against Immunogen (97.57 KDa) . Storage Buffer: In 1x PBS, pH 7.4 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: MSDS: Download Datasheet: Download Applications Page 1 of 3 2016/5/21 Western Blot (Transfected lysate)
    [Show full text]
  • Transketolase-Like 1 Expression Is Modulated During Colorectal Cancer Progression and Metastasis Formation
    Transketolase-Like 1 Expression Is Modulated during Colorectal Cancer Progression and Metastasis Formation Santiago Diaz-Moralli1, Miriam Tarrado-Castellarnau1, Cristina Alenda2, Antoni Castells3, Marta Cascante1* 1 Departament de Bioquimica i Biologia Molecular, Facultat de Biologia, Institut de Biomedicina at Universitat de Barcelona IBUB and IDIBAPS-Hospital Clinic, University of Barcelona, Barcelona, Spain, 2 Pathology Department, Hospital General Universitario de Alicante, Alicante, Spain, 3 Gastroenterology Department, Hospital Clı´nic, IDIBAPS, CIBEREHD, University of Barcelona, Barcelona, Spain Abstract Background: Transketolase-like 1 (TKTL1) induces glucose degradation through anaerobic pathways, even in presence of oxygen, favoring the malignant aerobic glycolytic phenotype characteristic of tumor cells. As TKTL1 appears to be a valid biomarker for cancer prognosis, the aim of the current study was to correlate its expression with tumor stage, probability of tumor recurrence and survival, in a series of colorectal cancer patients. Methodolody/Principal Findings: Tumor tissues from 63 patients diagnosed with colorectal cancer at different stages of progression were analyzed for TKTL1 by immunohistochemistry. Staining was quantified by computational image analysis, and correlations between enzyme expression, local growth, lymph-node involvement and metastasis were assessed. The highest values for TKTL1 expression were detected in the group of stage III tumors, which showed significant differences from the other groups (Kruskal-Wallis test, P = 0.000008). Deeper analyses of T, N and M classifications revealed a weak correlation between local tumor growth and enzyme expression (Mann-Whitney test, P = 0.029), a significant association of the enzyme expression with lymph-node involvement (Mann-Whitney test, P = 0.0014) and a significant decrease in TKTL1 expression associated with metastasis (Mann-Whitney test, P = 0.0004).
    [Show full text]
  • Multiscale Modeling in Systems Biology
    Digital Comprehensive Summaries of Uppsala Dissertations from the Faculty of Science and Technology 2051 Multiscale Modeling in Systems Biology Methods and Perspectives ADRIEN COULIER ACTA UNIVERSITATIS UPSALIENSIS ISSN 1651-6214 ISBN 978-91-513-1225-5 UPPSALA URN urn:nbn:se:uu:diva-442412 2021 Dissertation presented at Uppsala University to be publicly examined in 2446 ITC, Lägerhyddsvägen 2, Uppsala, Friday, 10 September 2021 at 10:15 for the degree of Doctor of Philosophy. The examination will be conducted in English. Faculty examiner: Professor Mark Chaplain (University of St Andrews). Abstract Coulier, A. 2021. Multiscale Modeling in Systems Biology. Methods and Perspectives. Digital Comprehensive Summaries of Uppsala Dissertations from the Faculty of Science and Technology 2051. 60 pp. Uppsala: Acta Universitatis Upsaliensis. ISBN 978-91-513-1225-5. In the last decades, mathematical and computational models have become ubiquitous to the field of systems biology. Specifically, the multiscale nature of biological processes makes the design and simulation of such models challenging. In this thesis we offer a perspective on available methods to study and simulate such models and how they can be combined to handle biological processes evolving at different scales. The contribution of this thesis is threefold. First, we introduce Orchestral, a multiscale modular framework to simulate multicellular models. By decoupling intracellular chemical kinetics, cell-cell signaling, and cellular mechanics by means of operator-splitting, it is able to combine existing software into one massively parallel simulation. Its modular structure makes it easy to replace its components, e.g. to adjust the level of modeling details. We demonstrate the scalability of our framework on both high performance clusters and in a cloud environment.
    [Show full text]