SLC15A2 Rabbit Polyclonal Antibody – TA333731 | Origene

Total Page：16

File Type：pdf, Size：1020Kb

SLC15A2 Rabbit Polyclonal Antibody – TA333731 | Origene

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA333731 SLC15A2 Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for Anti-SLC15A2 Antibody: synthetic peptide directed towards the middle region of human SLC15A2. Synthetic peptide located within the following region: GNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHSV Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Affinity Purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 82 kDa Gene Name: solute carrier family 15 member 2 Database Link: NP_066568 Entrez Gene 6565 Human Q16348 Background: SLC15A2 belongs to the PTR2/POT transporter (TC 2.A.17) family. It is a multi-pass membrane protein. The expression/activity of PEPT2 (SLC15A2) may be a critical factor in the modulation of opioidergic neurotransmission in vivo. Synonyms: PEPT2 Note: Immunogen sequence homology: Human: 100%; Horse: 93%; Rabbit: 93%; Pig: 86%; Bovine: 86%; Dog: 83%; Rat: 79%; Mouse: 79%; Guinea pig: 79% This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 SLC15A2 Rabbit Polyclonal Antibody – TA333731 Protein Families: Transmembrane Product images: WB Suggested Anti-SLC15A2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: MCF7 cell lysateSLC15A2 is supported by BioGPS gene expression data to be expressed in MCF7 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 2.

Copy Link

Recommended publications

A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
[Show full text]
Taqman® Openarray® Pharmacogenomics (Pgx) Panel
PRODUCT OVERVIEW TaqMan® OpenArray® Pharmacogenomics (PGx) Panel TaqMan® OpenArray® Pharmacogenomics (PGx) Panel Genotyping analysis of drug metabolism enzymes and associated transport proteins The TaqMan® OpenArray® Trusted TaqMan® performance samples, studies, and labs. Assays Pharmacogenomics (PGx) Panel is Each TaqMan® DME Genotyping were selected for optimal relevance a powerful tool to help researchers Assay contains two allele-specific to current pharmacogenomics study human genetic variation probes and a primer pair to detect studies and organized for a simplified in relation to drug action and its the specific SNP target. Both the workflow. potential application to medical probes and primers uniquely align ® ® treatment. within the genome, enabling the The TaqMan OpenArray PGx TaqMan® genotyping technology to Panel provides valuable data for ® ® The TaqMan OpenArray PGx provide superior specificity. It is this the study of drug interactions in Panel was developed for quick and specificity that allows these assays several research areas. Targeted easy screening of known high- to detect targets residing in highly genes relate to areas of study such value target genes associated with homologous gene families that may as cardiovascular (CYP2D6, CYP2C19, drug metabolism enzymes and include pseudogenes. TaqMan® Drug NAT1, NAT2), analgesics (CYP2C9, associated transport proteins. Metabolism Enzyme Genotyping CYP2D6), rheumatology (CYP2C9, The panel consists of 158 drug Assays were developed using a high TPMT), neurology (CYP2C19, CYP2D6), metabolism enzyme (DME) assays level of bioinformatics and wet-lab and musculoskeletal (CYP2C19). A derived from the PharmaADME stringency. All assays have passed total of 29 genes are covered across Core Marker Set (Table 1). The performance tests involving 180 158 unique assays.
[Show full text]
Screening of Genetic Variations of SLC15A2, SLC22A1, SLC22A2 and SLC22A6 Genes
Journal of Human Genetics (2011) 56, 666–670 & 2011 The Japan Society of Human Genetics All rights reserved 1434-5161/11 $32.00 www.nature.com/jhg ORIGINAL ARTICLE Screening of genetic variations of SLC15A2, SLC22A1, SLC22A2 and SLC22A6 genes Hyun Sub Cheong1,4, Hae Deun Kim2,4, Han Sung Na2,JiOnKim1, Lyoung Hyo Kim1, Seung Hee Kim2, Joon Seol Bae3, Myeon Woo Chung2 and Hyoung Doo Shin1,3 A growing list of membrane-spanning proteins involved in the transport of a large variety of drugs has been recognized and characterized to include peptide and organic anion/cation transporters. Given such an important role of transporter genes in drug disposition process, the role of single-nucleotide polymorphisms (SNPs) in such transporters as potential determinants of interindividual variability in drug disposition and pharmacological response has been investigated. To deﬁne the distribution of transporter gene SNPs across ethnic groups, we screened 450 DNAs in cohorts of 250 Korean, 50 Han Chinese, 50 Japanese, 50 African-American and 50 European-American ancestries for 64 SNPs in four transporter genes encoding proteins of the solute carrier family (SLC15A2, SLC22A1, SLC22A2 and SLC22A6). Of the 64 SNPs, 19 were core pharmacogenetic variants and 45 were HapMap tagging SNPs. Polymorphisms were genotyped using the golden gate genotyping assay. After genetic variability, haplotype structures and ethnic diversity were analyzed, we observed that the distributions of SNPs in a Korean population were similar to other Asian groups (Chinese and Japanese), and signiﬁcantly different from African-American and European-American cohorts. Findings from this study would be valuable for further researches, including pharmacogenetic studies for drug responses.
[Show full text]
The Genetic Landscape of the Human Solute Carrier (SLC) Transporter Superfamily
Human Genetics (2019) 138:1359–1377 https://doi.org/10.1007/s00439-019-02081-x ORIGINAL INVESTIGATION The genetic landscape of the human solute carrier (SLC) transporter superfamily Lena Schaller1 · Volker M. Lauschke1 Received: 4 August 2019 / Accepted: 26 October 2019 / Published online: 2 November 2019 © The Author(s) 2019 Abstract The human solute carrier (SLC) superfamily of transporters is comprised of over 400 membrane-bound proteins, and plays essential roles in a multitude of physiological and pharmacological processes. In addition, perturbation of SLC transporter function underlies numerous human diseases, which renders SLC transporters attractive drug targets. Common genetic polymorphisms in SLC genes have been associated with inter-individual diferences in drug efcacy and toxicity. However, despite their tremendous clinical relevance, epidemiological data of these variants are mostly derived from heterogeneous cohorts of small sample size and the genetic SLC landscape beyond these common variants has not been comprehensively assessed. In this study, we analyzed Next-Generation Sequencing data from 141,456 individuals from seven major human populations to evaluate genetic variability, its functional consequences, and ethnogeographic patterns across the entire SLC superfamily of transporters. Importantly, of the 204,287 exonic single-nucleotide variants (SNVs) which we identifed, 99.8% were present in less than 1% of analyzed alleles. Comprehensive computational analyses using 13 partially orthogonal algorithms that predict the functional impact of genetic variations based on sequence information, evolutionary conserva- tion, structural considerations, and functional genomics data revealed that each individual genome harbors 29.7 variants with putative functional efects, of which rare variants account for 18%. Inter-ethnic variability was found to be extensive, and 83% of deleterious SLC variants were only identifed in a single population.
[Show full text]
Novel Copy-Number Variations in Pharmacogenes Contribute to Interindividual Differences in Drug Pharmacokinetics
ORIGINAL RESEARCH ARTICLE © American College of Medical Genetics and Genomics Novel copy-number variations in pharmacogenes contribute to interindividual differences in drug pharmacokinetics María Santos, MSc1, Mikko Niemi, PhD2, Masahiro Hiratsuka, PhD3, Masaki Kumondai, BSc3, Magnus Ingelman-Sundberg, PhD4, Volker M. Lauschke, PhD4 and Cristina Rodríguez-Antona, PhD1,5 Purpose: Variability in pharmacokinetics and drug response is of the genes studied. We experimentally confirmed novel deletions shaped by single-nucleotide variants (SNVs) as well as copy- in CYP2C19, CYP4F2, and SLCO1B3 by Sanger sequencing and number variants (CNVs) in genes with importance for drug validated their allelic frequencies in selected populations. absorption, distribution, metabolism, and excretion (ADME). Conclusion: CNVs are an additional source of pharmacogenetic While SNVs have been extensively studied, a systematic assessment variability with important implications for drug response and of the CNV landscape in ADME genes is lacking. personalized therapy. This, together with the important contribu- Methods: We integrated data from 2,504 whole genomes from the tion of rare alleles to the variability of pharmacogenes, emphasizes 1000 Genomes Project and 59,898 exomes from the Exome the necessity of comprehensive next-generation sequencing–based Aggregation Consortium to identify CNVs in 208 relevant genotype identification for an accurate prediction of the genetic pharmacogenes. variability of drug pharmacokinetics. Results: We describe novel exonic deletions
[Show full text]
Frontiersin.Org 1 April 2015 | Volume 9 | Article 123 Saunders Et Al
ORIGINAL RESEARCH published: 28 April 2015 doi: 10.3389/fnins.2015.00123 Influx mechanisms in the embryonic and adult rat choroid plexus: a transcriptome study Norman R. Saunders 1*, Katarzyna M. Dziegielewska 1, Kjeld Møllgård 2, Mark D. Habgood 1, Matthew J. Wakefield 3, Helen Lindsay 4, Nathalie Stratzielle 5, Jean-Francois Ghersi-Egea 5 and Shane A. Liddelow 1, 6 1 Department of Pharmacology and Therapeutics, University of Melbourne, Parkville, VIC, Australia, 2 Department of Cellular and Molecular Medicine, University of Copenhagen, Copenhagen, Denmark, 3 Walter and Eliza Hall Institute of Medical Research, Parkville, VIC, Australia, 4 Institute of Molecular Life Sciences, University of Zurich, Zurich, Switzerland, 5 Lyon Neuroscience Research Center, INSERM U1028, Centre National de la Recherche Scientifique UMR5292, Université Lyon 1, Lyon, France, 6 Department of Neurobiology, Stanford University, Stanford, CA, USA The transcriptome of embryonic and adult rat lateral ventricular choroid plexus, using a combination of RNA-Sequencing and microarray data, was analyzed by functional groups of influx transporters, particularly solute carrier (SLC) transporters. RNA-Seq Edited by: Joana A. Palha, was performed at embryonic day (E) 15 and adult with additional data obtained at University of Minho, Portugal intermediate ages from microarray analysis. The largest represented functional group Reviewed by: in the embryo was amino acid transporters (twelve) with expression levels 2–98 times Fernanda Marques, University of Minho, Portugal greater than in the adult. In contrast, in the adult only six amino acid transporters Hanspeter Herzel, were up-regulated compared to the embryo and at more modest enrichment levels Humboldt University, Germany (<5-fold enrichment above E15).
[Show full text]
Supporting Information
Supporting Information Table S1. List of confirmed SLC transporters represented in Canine GeneChip. SLC family Members detected Members not detected SLC1: The high affinity glutamate and neutral amino acid SLC1A1 SLC1A2, SLC1A3, SLC1A6 transporter family SLC2: The facilitative GLUT transporter family SLC2A1, SLC2A8 SLC2A3, SLC2A9 SLC3: The heavy subunits of the heteromeric amino acid SLC3A1 transporters SLC4: The bicarbonate transporter family SLC4A11 SLC4A4, SLC4A8 SLC5: The sodium glucose cotransporter family SLC5A6 SLC5A3, SLC5A10, SLC5A12 SLC6: The sodium- and chloride- dependent SLC6A6, SLC6A12 SLCA18 neurotransmitter transporter family SLC7: The cationic amino acid transporter/glycoprotein- NR associated family SLC8: The Na+/Ca2+ exchanger family SLC8A1 SLC9: The Na+/H+ exchanger family SLC9A1, SLC9A6, SLC9A9 SLC10: The sodium bile salt cotransport family SLC10A2 SLC11: The proton coupled metal ion transporter family NR SLC12: The electroneutral cation-Cl cotransporter family SLC12A3, SLC12A6, SLC12A8 SLC13: The human Na+-sulfate/carboxylate cotransporter SLC13A2 family SLC14: The urea transporter family NR SLC15: The proton oligopeptide cotransporter family SLC15A2, SLC15A4 SLC15A1 SLC16: The monocarboxylate transporter family SLC16A13 SLC16A4 SLC17: The vesicular glutamate transporter family SLC17A3, SLC17A7 SLC18: The vesicular amine transporter family NR SLC19: The folate/thiamine transporter family NR SLC20: The type III Na+-phosphate cotransporter family NR SLC21/SLCO: The organic anion transporting family SLC21A3, SLC21A8,
[Show full text]
Embryonic Periventricular Endothelial Cells Demonstrate a Unique Pro
www.nature.com/scientificreports OPEN Embryonic periventricular endothelial cells demonstrate a unique pro‑neurodevelopment and anti‑infammatory gene signature Franciele Cristina Kipper1,5,7, Cleide Angolano2,5,7, Ravi Vissapragada1,4, Mauricio A. Contreras3, Justin Moore1,7, Manoj Bhasin6, Christiane Ferran2,3,5,7,8 & Ajith J. Thomas1,5,7,8* Brain embryonic periventricular endothelial cells (PVEC) crosstalk with neural progenitor cells (NPC) promoting mutual proliferation, formation of tubular‑like structures in the former and maintenance of stemness in the latter. To better characterize this interaction, we conducted a comparative transcriptome analysis of mouse PVEC vs. adult brain endothelial cells (ABEC) in mono‑culture or NPC co‑culture. We identifed > 6000 diferentially expressed genes (DEG), regardless of culture condition. PVEC exhibited a 30‑fold greater response to NPC than ABEC (411 vs. 13 DEG). Gene Ontology (GO) analysis of DEG that were higher or lower in PVEC vs. ABEC identifed “Nervous system development” and “Response to Stress” as the top signifcantly diferent biological process, respectively. Enrichment in canonical pathways included HIF1A, FGF/stemness, WNT signaling, interferon signaling and complement. Solute carriers (SLC) and ABC transporters represented an important subset of DEG, underscoring PVEC’s implication in blood–brain barrier formation and maintenance of nutrient‑rich/ non‑toxic environment. Our work characterizes the gene signature of PVEC and their important partnership with NPC, underpinning their unique role in maintaining a healthy neurovascular niche, and in supporting brain development. This information may pave the way for additional studies to explore their therapeutic potential in neuro‑degenerative diseases, such as Alzheimer’s and Parkinson’s disease.
[Show full text]
A Pharmacogenetic Study of Docetaxel and Thalidomide in Patients with Castration-Resistant Prostate Cancer Using the DMET Genotyping Platform
The Pharmacogenomics Journal (2010) 10, 191–199 & 2010 Nature Publishing Group All rights reserved 1470-269X/10 www.nature.com/tpj ORIGINAL ARTICLE A pharmacogenetic study of docetaxel and thalidomide in patients with castration-resistant prostate cancer using the DMET genotyping platform JF Deeken1, T Cormier2, The anticancer agent docetaxel shows significant inter-individual variation in 3 3 its pharmacokinetic and toxicity profile. Thalidomide is an active anticancer DK Price , TM Sissung , agent and also shows wide pharmacological variation. Past pharmacogenetic 4 2 SM Steinberg , K Tran , research has not explained this variation. Patients with prostate cancer DJ Liewehr4, WL Dahut3, enrolled in a randomized phase II trial using docetaxel and thalidomide X Miao2 and WD Figg3 versus docetaxel alone were genotyped using the Affymetrix DMET 1.0 platform, which tests for 1256 genetic variations in 170 drug disposition 1Lombardi Cancer Center, Georgetown University genes. Genetic polymorphisms were analyzed for associations with clinical Medical Center, Washington, DC, USA; response and toxicity. In all, 10 single-nucleotide polymorphisms (SNPs) in 2 3 Affymetrix, Inc., Santa Clara, CA, USA; Medical three genes were potentially associated with response to therapy: peroxisome Oncology Branch, National Cancer Institute, NIH, Bethesda, MD, USA and 4Biostatistics and Data proliferator-activated receptor-d (PPAR-d), sulfotransferase family, cytosolic, 1C, Management Section, National Cancer Institute, member 2 (SULT1C2) and carbohydrate (chondroitin
[Show full text]
Induction of Therapeutic Tissue Tolerance Foxp3 Expression Is
Downloaded from http://www.jimmunol.org/ by guest on October 2, 2021 is online at: average * The Journal of Immunology , 13 of which you can access for free at: 2012; 189:3947-3956; Prepublished online 17 from submission to initial decision 4 weeks from acceptance to publication September 2012; doi: 10.4049/jimmunol.1200449 http://www.jimmunol.org/content/189/8/3947 Foxp3 Expression Is Required for the Induction of Therapeutic Tissue Tolerance Frederico S. Regateiro, Ye Chen, Adrian R. Kendal, Robert Hilbrands, Elizabeth Adams, Stephen P. Cobbold, Jianbo Ma, Kristian G. Andersen, Alexander G. Betz, Mindy Zhang, Shruti Madhiwalla, Bruce Roberts, Herman Waldmann, Kathleen F. Nolan and Duncan Howie J Immunol cites 35 articles Submit online. Every submission reviewed by practicing scientists ? is published twice each month by Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts http://jimmunol.org/subscription http://www.jimmunol.org/content/suppl/2012/09/17/jimmunol.120044 9.DC1 This article http://www.jimmunol.org/content/189/8/3947.full#ref-list-1 Information about subscribing to The JI No Triage! Fast Publication! Rapid Reviews! 30 days* Why • • • Material References Permissions Email Alerts Subscription Supplementary The Journal of Immunology The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2012 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. This information is current as of October 2, 2021.
[Show full text]
RNA-Seq Reveals Conservation of Function Among the Yolk Sacs Of
RNA-seq reveals conservation of function among the PNAS PLUS yolk sacs of human, mouse, and chicken Tereza Cindrova-Daviesa, Eric Jauniauxb, Michael G. Elliota,c, Sungsam Gongd,e, Graham J. Burtona,1, and D. Stephen Charnock-Jonesa,d,e,1,2 aCentre for Trophoblast Research, Department of Physiology, Development and Neuroscience, University of Cambridge, Cambridge, CB2 3EG, United Kingdom; bElizabeth Garret Anderson Institute for Women’s Health, Faculty of Population Health Sciences, University College London, London, WC1E 6BT, United Kingdom; cSt. John’s College, University of Cambridge, Cambridge, CB2 1TP, United Kingdom; dDepartment of Obstetrics and Gynaecology, University of Cambridge, Cambridge, CB2 0SW, United Kingdom; and eNational Institute for Health Research, Cambridge Comprehensive Biomedical Research Centre, Cambridge, CB2 0QQ, United Kingdom Edited by R. Michael Roberts, University of Missouri-Columbia, Columbia, MO, and approved May 5, 2017 (received for review February 14, 2017) The yolk sac is phylogenetically the oldest of the extraembryonic yolk sac plays a critical role during organogenesis (3–5, 8–10), membranes. The human embryo retains a yolk sac, which goes there are limited data to support this claim. Obtaining experi- through primary and secondary phases of development, but its mental data for the human is impossible for ethical reasons, and importance is controversial. Although it is known to synthesize thus we adopted an alternative strategy. Here, we report RNA proteins, its transport functions are widely considered vestigial. sequencing (RNA-seq) data derived from human and murine yolk Here, we report RNA-sequencing (RNA-seq) data for the human sacs and compare them with published data from the yolk sac of and murine yolk sacs and compare those data with data for the the chicken.
[Show full text]
Brown and White Adipose Tissues: Intrinsic Differences in Gene Expression and Response to Cold Exposure in Mice
Am J Physiol Endocrinol Metab 306: E945–E964, 2014. First published February 18, 2014; doi:10.1152/ajpendo.00473.2013. Brown and white adipose tissues: intrinsic differences in gene expression and response to cold exposure in mice Meritxell Rosell,1 Myrsini Kaforou,2 Andrea Frontini,3 Anthony Okolo,1 Yi-Wah Chan,4 Evanthia Nikolopoulou,1 Steven Millership,5 Matthew E. Fenech,6 David MacIntyre,1 Jeremy O. Turner,6 Jonathan D. Moore,4 Edith Blackburn,7 William J. Gullick,7 Saverio Cinti,3 Giovanni Montana,8 Malcolm G. Parker,1 and Mark Christian9 1Institute of Reproductive and Developmental Biology, Department of Surgery and Cancer, Imperial College London, London, United Kingdom; 2Section of Paediatrics, Division of Infectious Diseases, Department of Medicine, Imperial College London, London, United Kingdom; 3Department of Experimental and Clinical Medicine, Obesity Center, United Hospitals-University of Ancona (Politecnica delle Marche), Ancona, Italy; 4Warwick Systems Biology Centre, University of Warwick, Coventry, United Kingdom; 5Metabolic Signalling Group, Medical Research Council Clinical Sciences Centre, Imperial College London, London, United Kingdom; 6Norwich Medical School, University of East Anglia, Norwich, United Kingdom; 7School of Biosciences at the University of Kent, Canterbury, Kent, United Kingdom; 8Department of Mathematics, Statistics Section, Imperial College London, London, United Kingdom; and 9Division of Metabolic and Vascular Health, Warwick Medical School, University of Warwick, Coventry, United Kingdom Submitted 29 August 2013; accepted in ﬁnal form 14 February 2014 Rosell M, Kaforou M, Frontini A, Okolo A, Chan Y, Nikolo- different types of adipose tissue: white adipose tissue (WAT) poulou E, Millership S, MacIntyre ME, Turner JO, Moore JD, that stores energy in the form of triacylglycerol (TAG) and Blackburn E, Gullick WJ, Cinti S, Montana G, Parker MG, brown adipose tissue (BAT) that dissipates energy as heat, Christian M.
[Show full text]