The A-Z of Living in Halls You can find Student Services*, Learning Services and Careers in Catalyst.
*Wellbeing and Counselling also operate out of Milton House on Ruff Lane. inspection hastakenplacewillresultinacharge. additional cleaningdiscoveredattheendofcontractand after thefinalroom for yourroom’sconditionuntiltheendofcontract.Any damageorrequired room atanytimeuptotheendofyourcontract,youwill remain responsible Facilities Management(FM).However,asyouhavetheright toreturnyour If youwishtovacateyourroomearlyainspectionwillbecarriedoutby accommodation fees. will notbereleasedfromyourcontractandqualifyforarefundof because offinishedexams,theendformalteachingorotherreasons,you If youvacateyourroomearlierthantheenddateonlicenceagreement whole ofthefixedterm. agreement youarefinanciallyliablefortherentofyourroominhalls and finishesattheendofspecifiedperiod.Onceyouhavesignedalicence Your licenceagreementisfixedtermfortheperiodspecifiedoncontract e.g. essentialmaintenance. and/or Eastervacationsforhealthandsafetyreasonsorotherrequirements, reserves therighttorequireyouchangeroomsduringsummer,Christmas may berequiredtochangeroomsonrequest.Inparticular,theUniversity Your roomisallocatedonthebasisofyoursoleoccupancy.Pleasenote,you Summary Licence Agreement of yourhallfees,youwillbeabletooccupyaroomallocatedforuse. such occupancyisasalicensee,nottenant.Inconsiderationofpayment University. Itallowsyoutooccupyastudybedroomontheunderstandingthat Your licenceagreementisalegalcontractbetweenyouandEdgeHill
THE A-Z OF LIVING IN HALLS Edge Hill University 1 We would recommend that you familiarise yourself with the following procedures:
- The Student Disciplinary Regulations.
- All codes relating to Faculties, Subjects or Service areas of the University.
- The Equal Opportunities Policy, describing all requirements of the Equality Act.
- The Car Parking Policy.
- The IT Acceptable Use Policy and the Information Security Policy.
- The terms of all contractual arrangements entered into with the University.
- All academic and professional regulations governing the operation and assessment of your course.
- All codes of behaviour relevant to professional bodies associated with your course.
- All codes of behaviour relevant to the Students’ Union.
- Ensuring you are familiar with and follow the rules outlined in the Student Disciplinary Regulations and your licence agreement.
- All Health and Safety requirements.
You can find these here: edgehill.ac.uk/governance/strategies-policies
Please also note that you must produce appropriate identification on request from any member of staff of the University, including placement providers’ staff.
Any dispute or difference between you and the University in the interpretation or implementation of your licence agreement should be referred initially to the Director of Student Services, or on their recommendation, to the Pro Vice- Chancellor (Student Experience) & University Secretary, whose decision will be binding and final.
If the University terminates your licence agreement because you have breached the Student Disciplinary Regulations or your licence agreement, you will remain responsible for paying your fees associated with your room for the remainder of the fixed term. ehu.ac.uk/criticalincident For moreinformationon what todoinanemergency,pleasevisit 4. 3. 2. 1. you takethefollowingsteps: In theeventthatyouneedtocallanambulanceinemergency ensurethat Ambulance (howtocalloneinanemergency) Location: Twitter: Facebook: Web: Email: to datewiththelatestnews: You canalsocall,emailorfollowStudentServicesonsocialmediatostayup the latestdrop-intimes). can callintoseetheAccommodationteamCatalyst(checkwebsitefor If youarehavinganyissuesinhallsorwouldjustlikesomegeneraladvice, Accommodation Team should alsobereportedtotheEdgeHillSportDutyManager. undertake athoroughinvestigation.Anysportsrelatedaccidentornearmiss should alsonotifyyourlecturer/tutoroftheaccidentornearmisssotheycan accessible through You shouldreportanyaccidentornearmissusingtheonlinereportingform Accident andNearMissReporting A Report Formwithin24hours. Thiscanbeaccessedvia If theambulancehasbeencalledduetoanaccident,complete anAccident provide thequickestpossibleaccess. to goto.ThisissoCampusSupportstaffcanpreparefor its arrivaland 2222 Contact CampusSupporton Provide theoperatorwithprecisedirectionsofwhereambulance istogo. call. Ifusinganinternalphonepress Phone ehu.ac.uk/accommodationteam [email protected] @StudentsEHU ) andtellthemthatanambulancehasbeencalledwhere itis Catalyst facebook.com/StudentsEHU 999 torequestanambulanceandclearlystatethereasonfor
ehu.ac.uk/MyFM
01695 584227
assoonpossibleaftertheincident.You
9
, then
(ifusinganinternalphonedial 999 .
ehu.ac.uk/MyFM
THE A-Z OF LIVING IN HALLS Edge Hill University 3 B
Bicycles See ‘Parking On Campus’ section under ‘P’.
Bus and Train See ‘Travel’ section under ‘T’.
C
Campus Life Team Your Campus Life team are here to help you settle in and make friends in your halls of residence, so that you can make the most of your on-campus experience. They also work to ensure you have a safe and secure environment and can help you with any issues which may arise by providing support. The Campus Connectors are fellow students who can signpost you to others who will be able to help you with any problems you might have. They will also be organising a range of events and activities in halls to help you meet new people and get involved. The Campus Life Managers also enforce the Student Disciplinary Regulations and manage disciplinary issues on campus.
To keep up to date with upcoming events, find the team on Facebook: facebook.com/EHUCampusLife and follow them on Instagram: @CampusLifeEHU
For more details get in touch or pop into Catalyst.
Email: [email protected] Web: ehu.ac.uk/campuslife Location: Catalyst
Campus Support The Campus Support team provide an out of hours support system for students on campus, ensuring you feel comfortable and safe in your accommodation. You can contact the team out of hours on 01695 584227 (4227 if calling from an internal phone) or you can text them on 07785 928911. The team are based in the SCIC (the security hut at the main entrance to campus). cleaner, brush, mop,bucket,ironandironing boardforyouruse. will beleftforuseovertheweekend. Eachcorridorisprovidedwithavacuum your wasteandrecyclingfrom bedroomsandkitchens.Blackclearbags bins. Atweekendsandbank holidays youareresponsiblefortakingoutallof bedroom areasanddisposeof itintheappropriateexternalwasteandrecycling en-suite shower,includingshower curtain.Youshouldremovewastefrom You areresponsibleforcleaning yourownbedroomand,ifyouhaveone, edgehill.ac.uk/sustainability recycling bins.Forinformationaboutwhatyou can recycle,visit Please rinseoutbottlesandcansbeforedisposingofthem inthecorrect Recycling, includingbottlesandcans,mustnotbelefttobuild upinthekitchen. belongings. cleaning andarekeptneat,tidyclearofadditionalfurniture andstudent It isyourresponsibilitytoensurethatcommunalareas areaccessiblefor Saturdays, Sundays,bankholidaysandbetweenChristmas andNewYear. from 8.30amto3.00pmMondayFriday.Nocleaning iscarriedouton Site Servicesstaffcleanthecommunalareasregularlyand theygenerallywork Cleaning See ‘Laundry’undersection‘L’. Circuit Laundry Location: Facebook: Web: Email: and CustomerInformationCentre(SCIC)atthemainentrance. 9.00pm. ToaccesstheroomoutsideofthesehourspleasegotoSecurity of residence).ThisroomisaccessiblebyUnicardswipebetween6.00am– The FaithandReflectionRoomisintheMagnoliabuilding(ForestCourthalls campus. staff ofallfaithsandnone,helpingtocreateawelcomingcommunityon The ChaplaincyServiceisheretosupportEdgeHillUniversitystudentsand Chaplaincy See ‘ParkingOnCampus’sectionunder‘P’. Car Parking
edgehill.ac.uk/chaplaincy [email protected]
Catalyst facebook.com/chaplaincyehu
THE A-Z OF LIVING IN HALLS Edge Hill University 5 Council Tax Students living on campus are not required to pay council tax.
Counselling See ‘Wellbeing and Counselling’ section under ‘W’.
Cycling See ‘Travel’ section under ‘T’.
D
Damage or Loss You are responsible for any damage, loss and/or an unacceptable level of cleanliness caused by you or your visitors within halls. If your room is left unsecure, you will be held financially liable for the full cost of repairing the damage, loss, or cost of additional cleaning. It is essential that you report any damage, loss or defect to the FM Helpdesk at the earliest opportunity or visit ehu.ac.uk/MyFM. All rooms and communal areas are inspected periodically by the FM and Accommodation teams.
The sequence of inspections is:
- Initial Room Inventory/Inspection/Sign-off
- Initial Room Inventory – students must complete their room Portable Applicance Testing (PAT) via the MyRoom icon on MyFM within seven working days of arrival. Go to ehu.ac.uk/MyFM
- Periodic Inspection of rooms and communal areas
- Final Inspection of rooms and Sign-Off
- Final Room Inventory/Inspection informed ofsuchdeductions in writingbytheUniversity. cost maybespreadamong the studentsinyourhalls.Youwillbeformally responsibility forthedamage, lossorunacceptablelevelofcleanliness,the edgehill.ac.uk/fm/damage-deposit apply intheeventofdamage/breakages etc.Youcanfindthefulllistonlineat: The damagedepositpricelist providesguidanceoftheminimumchargesthat Damage DepositInformation Experience) &UniversitySecretarywillbefinal. University Secretary.ThedecisionoftheProVice-Chancellor (Student decision youmayappealtotheProVice-Chancellor(Student Experience)& working daysuponreceiptofanappeal.Ifyouwishto challengetheFM any deductionstobemade.FMwillinformyouofthedecision withinfourteen the FMCustomerFeedbackprocedurewithinfourteendays ofnotification must bemadeviatheFMHelpdeskor deposit ortheapplicationofanyadditionalcharges.Appeals orcomplaints You havetherightofappealagainstadecisiontowithhold yourdamage amount, additionalchargeswillbeapplied. If therecordeddamage,lossoradditionalcleaningexceedsdeposit individual and/orcommunaldamage,lossoradditionalcleaninginyourhalls. The agreeddamagedepositof£150perstudentwillbeusedtopayfor issues raised. to SiteServiceswhowillthenarrangeanappointmentwithyoudiscussthe Room Inventoryyoumustmarkthisclearly.Thiswillraiseaninspectionalert administration ofdamagedeposits.Ifyoudisagreewiththecontent occupation. Thiswillformthebasisoffinalinspectionand room andwillimplythatthiswasacceptabletoyoutheUniversityupon Your RoomInventorywillbetakenasevidenceoftheinitialcondition - - - - - The finalandperiodicinspectionswillincludearecordof: Damage tofurniture,fittingsandequipment Damage causinginterruptiontotheprovisionofservices Damage tothefabricofbuildingorservices Loss ofEdgeHillproperty Levels ofcleanliness
. Ininstanceswherenoindividual admits ehu.ac.uk/MyFM
inaccordancewith
THE A-Z OF LIVING IN HALLS Edge Hill University 7 Disability Support The Inclusion team offers advice and support to students with a range of needs arising from physical or sensory impairments, mental health needs, autism spectrum disorders or other disabilities. The team provides advice about reasonable adjustments to study, based on the student’s individual requirements.
There are a number of adapted rooms available to disabled students who may want to live on campus. However, please ensure that you make contact with us as early as possible, as the University may not be able to guarantee availability due to the demand for adapted rooms. We can also make minor adaptations to standard rooms to ensure that your on-campus room meets your requirements.
Email: [email protected] Web: edgehill.ac.uk/inclusion Location: Catalyst
Doctor and Dentist We strongly recommend that you register with Beacon Primary Care Medical Practice, preferably within the first two weeks of starting at Edge Hill. It is not a good idea to leave it until you need to see a doctor as the registration process may delay your appointment. You will be given the opportunity to register during Welcome Week or you can register in advance by visiting ehu.ac.uk/GPreg
Ravat and Ray Dental Care run dental clinics at the West Lancashire Health Centre, Ormskirk Hospital, just a five minute walk from campus. NHS dental treatment is free for people under 18 (19 if in full time education). Call 01695 578019 or visit ravatandray.com for more information. Other dental practices in the area are also available. You shouldtakeallelectricalitemsawayfromcampuswhen youleave. Please donotthrowawayelectricalequipmentinthewaste andrecyclingbins. the FMHelpdeskor a responsibilitytoreportitemswhichlookunsafeFacilitiesManagementvia Electrical fittingse.g.lighting,powersocketsetc.mustnotbealtered.Youhave appliances. to campus,e.g.fridges/minifridges,freezers,washingmachines,heating Please notethatyouarenotpermittedtobringlargeelectricalapplianceson equipment aresafe. a reasonablysafeenvironment,e.g.ensuringthatcablestopersonalelectrical on campusforyoutobringyourelectricalitemsbetested.Pleasemaintain the FMHelpdeskorvia of theirage,youmustrequestaPATcheck(PortableApplianceTest)through If youbringanyoftheaboveitemsintoyourroomorcommunalarea,regardless ONLY beusedinthedesignatedcommunalkitchenareas. DVD/game equipment.Toastersandkettlesarealsopermittedbutthesemust hairdryers/stylers, computers,smalltelevisions(withvalidTVlicence)and may bringwithyouforuseinyourstudybedroomare:radios,stereos,shavers, from outsidetheUK,duetovoltagedifferences.Theonlyelectricalitemsyou being broughtontothepremises.Thisisparticularlyimportantifitem All electricalitemsmustbeingoodworkingorderandtestedforsafetybefore Electrical Items E
ehu.ac.uk/MyFM ehu.ac.uk/MyFM .
. FMwillalsoholddrop-insessions
THE A-Z OF LIVING IN HALLS Edge Hill University 9 F
Faith See ‘Chaplaincy’ section under ‘C’.
Fire Safety [Details of Personal Emergency Evacuation Plans (PEEPs) are listed under ‘P’.]
Fire Action Notices are posted throughout Edge Hill’s buildings to help you familiarise yourself with the procedures to be followed in the event of a fire. On hearing the fire alarm, leave the premises immediately using the nearest safe exit and proceed to the designated Assembly Point (indicated on the Fire Action Notice). The Campus Support team will organise at least one fire practice each term. Fire alarms are tested every Thursday.
It is a criminal offence and a serious breach of the Student Disciplinary Regulations to misuse any fire safety equipment, including extinguishers, alarms, and fire blankets. Disciplinary action will be taken against those found in breach of the Regulations.
All residential students are required to attend a Welcome Talk at the start of the first term which includes important fire safety information. If you notice any fire-fighting equipment within your hall that appears to have been tampered with, you have a responsibility to report this to Facilities Management by contacting the FM Helpdesk. This can be accessed via ehu.ac.uk/MyFM.
- Candles or other items that contain a naked flame are not permitted in halls at any time.
- Fairy lights (or any strings of lights) are not permitted in rooms or halls.
- You must co-operate fully with any fire evacuation exercises.
- Fire doors must not be propped open (for example with a doorstop) or obstructed and fire door closers must not be disabled or tampered with.
- Any items that prevent fire doors from closing properly e.g. door wedges, over-door hangers etc. are not permitted within halls of residence.
- Cookers must not be left unattended or left in a poor condition e.g. a build-up of oil in grill pans.
- Tampering or misuse of fire extinguishers, fire alarms or smoke detection sensors is a criminal offence and a serious breach of the Student Disciplinary Regulations. Covering smoke detectors will result in disciplinary action being taken.
- You must not fill up your room or any communal area with too many personal belongings. Rooms should be left in a suitable condition to allow cleaning and to ensure that a safe environment is maintained.
- You must not obstruct stairs (internal or external) at any time. date opening times, please visitour website at Food at EdgeHilloutlets areopenfrom 7.30am-9.00pm. Forthe mostupto Opening times andlocations From Sunday5th April2020toSaturday25th April2020. Easter Vacation From Sunday22ndDecember 2019toSaturday4thJanuary2020. Christmas Vacation for theseperiods: and youwillnotbechargedthe cateringelementofyouraccommodationfees will notbecreditedwiththeweeklycateringallowancefor the followingweeks allowance, email catering outletsoveraseven-dayperiod.Forissues with yourcatered automatically loadedeachweekandcanbeusedinall FoodatEdgeHill If youareonacateredpackagewillbeprovidedwith a Unicard,whichis Food information andadvice If youhaveafoodallergy(e.g.nuts),pleasevisit jewellery, westronglyrecommendthatthisiswornatalltimes. summon CampusSupportstaffwhocanofferhelp.Ifyou havemedicalalert an alerterdevicetouseifyou’reinhallsalone.Whenactivated, thedevicewill of amedicalconditionsuchasdiabetesorepilepsy,youwillbeprovidedwith with thesupportofhealthprofessionals.Ifyouneedadditionalbecause condition andweexpectthatyouwillbeabletomanagethisindependently health conditions.Weknowthatyouaretheexpertonyourownmedical We understandthatsomestudentswillbemanagingcomplexmedicaland/or Support knowthatitisonitsway. ambulance (seetheinformationunder‘Ambulance’)andthenletCampus call year. Intheeventofanaccidentoremergencyrequiringmedicalassistance, The CampusSupportteamispresentoncampus24hoursaday,365days First Aid residence, youmustcontacttheFMHelpdeskassoonpossible. If youhaveanyconcernsaboutelectricalequipmentinyourroomorhallsof - - -
user manualavailableat: For instructionsoncookingequipment,pleaserefertheappliance should notbeinterferedwithunlessincaseofemergency. Window openingrestrictorsystemsareforyoursecurityandsafety Barbeques arenotallowedoncampus. 01695 584227
(
2222
fromaninternalphone).Foremergencies,call edgehill.ac.uk/fm/equipment-manuals
edgehill.ac.uk/food ehu.ac.uk/foodallergies Please noteyourUnicard
.
.
for
THE A-Z OF LIVING IN HALLS Edge Hill University 11 Forbidden Items - The use and/or supply of illegal drugs on the University campus is prohibited.
- Any substance that is intended to create a high, hallucination or other psychoactive effect is prohibited. This includes nitrous oxide (‘laughing gas’) capsules.
- Firearms (including air pistols or rifles), sharp or pointed instruments, replica weapons, knives, axes, swords or martial art equipment (that could be used an offensive weapon) should not be kept or used on the University campus.
- Other than assistance dogs, no animal, bird, fowl, fish or pet of any kind may be kept on the University campus.
- Candles and fairy lights (or any strings of lights) are not permitted on the campus for fire safety reasons.
- Alcohol may not be sold in halls of residence or in any other area of Edge Hill University except the SU Bar and Venue, McColls or on premises specially licensed by Magistrates.
- Smoking is not allowed in halls of residence or any other University building or in and around the entrances to buildings. This includes electronic cigarettes (‘vapes’).
G
Gaming (online) See ‘Internet’ section under ‘I’.
GP See ‘Doctor and Dentist’ section under ‘D’.
Gym See ‘Sports and Fitness’ section under ‘S’. instalments, unlessyoupayin full. licence agreement(40weeks oragreedfixedterm)isdividedintothreeequal regarding paymentarrangements. Thetotalbalancedueforthedurationofyour middle oftheacademicyear,please contacttheHallFeesteam,forinformation If youarenotonthestandard 40weekcontractorstartedyourinthe instalments atthestartofeach term. received inthreetofiveworkingdays.Studentloans arepaidinthree note thatonceyouareregisteredontoyourcourse,first instalmentwillbe If youintendtopayyouraccommodationfeeswithstudent funding,please you willbegiveninstructionsforthis. If youareaninternationalstudent,paymentarrangementsmay bedifferentand with studentfundingpayments. Most studentschoosetopaytheirfeesinthreeinstalments asthiscoincides - - - in August.Youwillhavethreestepstocomplete: a linktothee-licenceagreementsigningpageonorafterALevelresultsday If youaremovingintohallsonWelcomeSunday,willreceiveanemailwith Paying yourHallFees Hall Fees H
- - credit cardinoneoftwoways: e-licence agreement.Youcanpayyourhallfeesonlinewithadebitor Arrange paymentofyourhallfeeswithinfiveworkingdayssigning agreement. Pay £150damagedepositwithinfiveworkingdaysofsigningyoure-licence Sign youre-licenceagreementwithinfivedaysofreceivingroomoffer. 28 April2020 7 January2020 2 October2019 The paymentswillbetakenonthefollowingdates: (RCP) sothatyourhallfeeswillbetakeninthreeequalinstalments. Pay inthree instalments. on aproratabasis. quoted. Ifyouleavehallsearly,yourdiscountwillbereversedandrepaid your e-licenceagreement)youwillqualifyfora5%discountontherates Pay infull.
Ifyoupayyourhallfeesinfull(withinfivedaysofsigning
YoucansetupaRecurringCardPayment
THE A-Z OF LIVING IN HALLS Edge Hill University 13 What happens if I am having difficulty paying? If you cannot pay your hall fees, you must inform the Hall Fees team as soon as possible so they can offer support, guidance, and review your payment options. If you fail to pay, or to negotiate a payment plan, you will be subject to the University credit control procedures.
You should note that failure to pay outstanding bills will affect your standing at the University and may result in your debt being referred to an external debt collection agency.
For any queries regarding hall fee payments please contact the Hall Fees team who can:
- Assist you with any queries you may have regarding your accommodation fees and your associated payment plan.
- Provide guidance and support in relation to any difficulties you may experience with your accommodation payments.
- Refer you to the Money Advice team for additional financial support as appropriate.
- Update your bank card details in the event that you have changed your bank card. It is important to remember that your payment plan is linked to the 16 digit number on your debit / credit card and not to your sort code and bank account number. If you do not update your card details your payment will fail unnecessarily.
Email: [email protected] Web: ehu.ac.uk/accommodationteam Location: Catalyst
Halls Fees for International Students If you are an International student you will receive further information with your offer letter regarding payment arrangements for your damage deposit and halls fees.
Please note that these payment arrangements will not apply to students enrolled on the following courses:
- US Study Abroad
- English Language courses
- Residential Summer Schools I Manuals’ under‘AdditionalServices’. available via Instruction manualsforallof theappliancesinyourhallsofresidenceare Instruction Manuals edgehill.ac.uk/services/games-console-registration for awiredinternetconnection.Findoutmoreandregister viathislink: If youwanttouseagamesconsoleinhalls,willneed registeryourdevice Using aGamesConsoleinYour Room askus.edgehill.ac.uk Alternatively youcanemail If yourequireyourpasswordtobereset,visittheHelpdesk inCatalyst. whatever youupdateditto. received inyourstageoneenrolmentemail,orifyouchanged itatthattime, [email protected]. Yourpasswordiseitherthedefault onethatyou your [email protected]. Forexample, To connecttotheon-campusWi-Fi,searchforeduroam. Yourusernameis Internet for moreinformation. threatening situation.Callsarefreefrommobilesandlandlines.Visit You cancallNHS find outmoreortocontactthecentre,visit: injury youcanvisitthewalk-incentrewithoutneedforanappointment.To check thewebsiteforuptodateopeningtimes).Ifyouhaveaminorillnessor and 8.00pmeverydayoftheyear,includingpublicholidays(pleaseensureyou There isawalk-incentreatOrmskirkHospitalwhichopenbetween8.00am Hospital andWalk-in Centre under section‘D’. See ‘HospitalandWalk-inCentre’undersection‘H’‘DoctorDentist’ Health
edgehill.ac.uk/fm/equipment-manuals
111
for furtherinformation. ifyouneedmedicalhelpurgentlybutit’snotalife-
bit.ly/ormskirkwalkin .
. Clickon‘Equipment
nhs.uk/111 orvisit
THE A-Z OF LIVING IN HALLS Edge Hill University 15 Insurance Edge Hill is not liable or responsible for the security of your personal belongings while they are on University premises or within your room. The University does not insure the personal effects of students against loss or damage, including loss of food contained in Edge Hill fridges or freezers.
You are therefore strongly advised to take out insurance cover either individually or by special arrangement within the terms of parental insurance. The Students’ Union can provide advice on insurance arrangements.
Please be aware that if you do take out insurance cover, leaving your room unsecure will potentially negate the terms of any insurance policy. K
Keys You are responsible for looking after your own keys at all times. You should not give your keys to anyone else or have copies made. You must report to the Security and Customer Information Centre (SCIC) immediately if any keys are lost or stolen and in order to gain access to your room. Campus Support Security staff will ask you to prove your identity before allowing you access to the room. You will be charged for replacement keys, fobs and swipe cards at the published rate.
If you have your keys stolen, this must be reported to the Police and a crime reference number obtained, otherwise you may be liable for the cost of replacement keys. Locks will also be changed if FM deems this necessary and this may also involve a charge. If you lock yourself out of your room or hall, contact Campus Support Security staff. Proof of identity will be required. Keys should not be left in rooms because the accommodation remains your responsibility until the keys are returned.
Returning Keys and Passes All keys and passes must be returned to the Security and Customer Information Centre (SCIC) at the end of the fixed term. It is important that you remove all personal tags from the keys. Failure to return keys and passes to Campus Support staff may mean you are charged for the full cost of replacing the lock, key or pass. You will be charged additional rent and for a replacement key if your keys are returned after the due date.
Key Identification and Price List For any keys that you are missing or that don’t work then please contact the Campus Support team on 01695 584227. A full list of keys, images, and prices can be found at: edgehill.ac.uk/fm/keys sign youre-licenceagreement withinfivedaysofreceivingyouroffer. agreement signingpageonor afterALevelResultsDayinAugust.Youmust If youaremovingintohalls willreceiveanemailwithalinktothee-licence Licence Agreement (Signing) To letusknow,ortofindout more, visit ------as concernsyoumighthaveaboutothersoryourself: in ouronlinereferralform.Youcanletusknowaboutarangeofissues,such If youareworriedaboutyourselforsomeoneelse,canletusknowbyfilling Let UsKnow under ‘W’. See ‘MovingorLeaving’sectionunder‘M’and‘WithdrawalfromUniversity’ Leaving Halls the SUShop.Visit If youdon’thaveaniOSorAndroidphonesimplypurchasealaundrycardfrom to youraccountandpayforwashingthroughapp. the laundrywithyourapp.Onceyouareregisteredwillbeabletoaddfunds circuit.co.uk/mobile-app Download thefreeCircuitLaundryAppforiOSandAndroid The openingtimesare7.30am–11.30pm(lastwashat10.30pm)daily. The LaunderetteissituatedintheStudents’Union(neartoSubway). Laundry L
Personal hygieneorappearancehasdeteriorated. Excessively drinkingand/ortakingdrugs. Someone whosebehaviourmakesyoufeeluncomfortable. Abusive relationship. Struggling withmentalhealth. Self-harm. Struggling withuniversityorlifeingeneral. not mixingwithothers). Feeling isolatedoraloneinaccommodation(e.g.neverleavingtheroom
circuit.co.uk
. ToregistersimplyscanaQRcodeonmachinein
andfollowtheinstructionsonlinetotop-up.
ehu.ac.uk/letusknow
THE A-Z OF LIVING IN HALLS Edge Hill University 17 M
Mental Health Support See ‘Let Us Know’ under section ‘L’ and ‘Wellbeing and Counselling’ under section ‘W’.
Money Advice The Money Advice team, based in Catalyst, offers confidential, professional information and advice in relation to budgeting and the range of financial support that you may be able to access. In addition, they administer the Student Support Fund.
Email: [email protected] Web: edgehill.ac.uk/moneyadvice Location: Catalyst
Motorcycles See ‘Parking On Campus’ section under ‘P’.
Moving or Leaving Many students find themselves feeling unhappy, having doubts about their subject choice or difficulties during their studies and may even think about dropping out or leaving the University – this is not unusual and you are not on your own. You can always speak to your tutor but alternatively you can also contact [email protected] where you can speak to an advisor. The Transitions team can help you to navigate the challenges that come with university life, connecting you to support and services to help you succeed.
If you formally withdraw from study or wish to leave the University, you must immediately inform the Accommodation team. Your liability for hall fees will continue for a period of 28 days from the date of receipt of formal notification of withdrawal by the Accommodation team (see 4.11 of the licence agreement for detailed terms).
If the room is re-let within the 28 day liability period to an eligible student of Edge Hill University, (i.e. one not already in halls, and whose conduct and payment history are acceptable), liability for hall fees will cease the day the room is re-let. If you vacate your room but are still enrolled on your course you will continue to be liable for rent for the duration of your agreement, and any costs incurred through damage or items lost, unless the room is re-let to an eligible student of Edge Hill University in the meantime.
- - - - are detailedinfullunderSection4ofthecontractbutexamplesinclude: The circumstancesinwhichtheUniversitymayterminatelicenceagreement for yourroom. Please note,youareultimatelyresponsibleforfindingareplacementstudent subject todisciplinary action. nuisance, yourlicenceagreement maybeterminatedandyoualso in aMagistratesCourt,andpossibly afineofupto£5000.Ifyoucausenoise Failure tocomplywithaNoise AbatementNoticemayresultinyourappearance nuisance mayberemovedand impounded. Environmental HealthOfficer andtheequipmentwhichiscausingnoise an abatementnotice(tostopthisbehaviour)maybeserved onyoubyan cause anoisenuisancetolocalresidentbyplayingexcessively loudmusic, relation tonoise,andalsotheEnvironmentalProtection Actof1990.Ifyou Your attentionisdrawntoEdgeHill’sStudentDisciplinary Regulationsin levels ofnoise. to aminimum.Youmayalsoberequiredkeepwindows closedtocontrol You areadvisedtolistenmusiconheadphonesinorder to keepnoiselevels neighbouring hallsorbuildings. rowdiness) whichmaybeanuisancetootherresidentsor tootherpeoplein You mustnotbehaveinanyway(forexample,playingloudmusic, shoutingand Noise N
for habitation. The accommodationoraccesstoitissufficientlydamagedasbeunfit other people,theUniversity’sorpeople’sproperty. Your healthorbehaviourisbelievedtobeaseriousriskyourself, You donothavestatusasaregisteredstudentoftheUniversity. agreement andStudentDisciplinaryRegulations. Serious orpersistentbreachofyourobligationsassetoutinthelicence
THE A-Z OF LIVING IN HALLS Edge Hill University 19 O
Off-Campus Housing The Accommodation team and Students’ Union organise ‘Housing Week’ every year. During this week you can attend workshops, get advice from staff and access the registered property list. We would strongly advise you not to start house hunting until after this week. Don’t let other people worry you by saying all of the accommodation in Ormskirk will have gone as there is plenty of availability, even late into the year. Find out more: ehu.ac.uk/accommodationteam.
P
Parking On Campus Car parking at our Ormskirk Campus is very limited. In accordance with the University’s Car Parking Policy (available at ehu.ac.uk/travel), students who live in halls are not eligible to park on campus. However, if you have a mobility impairment or you need your vehicle to attend placements for your course, a permit may be granted. For more information, please contact: [email protected]
Bicycles Bicycles must be parked in designated areas only. Secure cycle areas are available around the campus. For further information please enquire at the FM Helpdesk in the Durning Centre or at 01695 584455.
Cyclists may join the Bike Locker Users’ Club (BLUC) in order to store their bike in any of the secure BLUC lockers on campus. Visit ehu.ac.uk/travel for details.
Motorcycles All motorcycles parked on campus must be registered and display an Edge Hill University permit and be parked in marked motorcycle bays. Spaces on campus are for the use of daily commuters only and not as long term parking facilities i.e. (overnight/holidays). Motorcycles are required to be pushed along any pedestrianised area and not ridden. For more information, please contact [email protected]
Paying Hall Fees See ‘Hall Fees’ under section ‘H’. - - - - To helppreventanyproblems,pleasefollowthesesimple instructions: contacting theFMHelpdesk: If thereisevidenceofpestsinyourhalls,suchasants, pleasereportitby Pests [email protected] contact theInclusionteam,basedinCatalyst,ifyourequireonevia identifies tousthattheymayrequireassistanceduringanevacuation.Please At EdgeHill,wewillconductaPEEPsassessmentwithanystudentwho escape toaplaceofsafetyintheeventanemergencye.g.fire. who cannotevacuateabuildingunaided,withclearplantomanagetheir A PersonalEmergencyEvacuationPlan(PEEP)isaimedatprovidingpeople Personal EmergencyEvacuationPlan building (knownasthe‘GreenLane’)thatallowspedestrianaccess. to GraduatesCourtandtheFacultyofHealth,SocialCareMedicine There isalsoadedicatedpedestrianaccessrouteonStHelensRoadleading and pedestrians,thereforetheentranceonStHelensRoadshouldbeused. between 6.00amand8.30pm.Outsideofthosetimes,thereisnoaccessforvehicles The mainRuffLaneentrancegatesareopentobothvehiclesandpedestrians minimum andensuringalllitterisplacedintheappropriatebin. during theeveningandearlymorningbykeepingnoiselevelstoanabsolute neighbours whenusingthesespecificpedestrianaccessroutes,particularly Some oftheentrancesallowpedestrianaccessonly.Pleasedoconsiderour There areseveralentrancestothecampusonStHelensRoadandRuffLane. Pedestrian Access P
Examples ofrodentsarerats, mice,andsquirrels. Do notfeedbirdsorotherwildlife asthismayencouragerodentactivity. Keep kitchensurfacesandfoodpreparationareasclean. Dispose offoodandpackagingcorrectly. Do notleavefoodorcrumbsonthefloor.
. ehu.ac.uk/MyFM
THE A-Z OF LIVING IN HALLS Edge Hill University 21 Post, Parcels and Postcodes All post, parcels and signed for items are delivered to the FM Post and Print Reception in the Durning Centre, and can be collected at the following times:
Monday – Friday during term time: 7.00am – 7.00pm
Saturday during term time: 10.00am – 2.00pm
*You will be sent notifications by email showing availability outside of term dates.
When a parcel or letter which requires a signature arrives for you our post room staff will email you. Please bring your reference number which will be in the subject heading of the email and your Unicard as ID. Please note these items are held for four weeks only and are returned to sender if not collected within this time.
Ordinary post can be collected from the Durning Centre FM Post and Print Reception but you will not be emailed informing you of this. Please call in and check for post regularly as anything that is not collected after two weeks will be returned to sender. Items will not be forwarded or redirected during or after the end of the contract.
Please ensure that you use the following address format for any post:
Name Room Number and Hall Edge Hill University St. Helens Road Ormskirk Postcode
Read more about the postal service, including your hall-specific delivery address and postcode at edgehill.ac.uk/guides/post-and-parcels. with stickersor stars. wall clearedofwhitetack.You mustnotdecoratetheceiling/wallsofyourroom on walls.Postersmustberemoved attheendofacademicyearand on windowsisnotallowed.Only whitetackisacceptableforstickingposters Use ofstickytape,glue,pinsor nailsonwallsandceilingsChristmassnow out anyalterations,structural orotherwise,anydecorationtothepremises. Halls aretobeusedasaplaceofresidenceandstudyonly. Youmustnotcarry of entrywillbeleftinyourroom. log iskeptoftheentrytoyouraccommodationandreason forit.Notification Campus Support,staffmayenteryourroomwithoutnotice. Ifthisoccurs,a and evacuations,oratthediscretionofHeadAccommodation or However, ifurgentrepairsareneeded,anemergencyoccurs, duringfiredrills are requestedbytheoccupant.Thisistomaintainyourprivacy. notice ifamemberofstaffneedstoenteryouraccommodation, unlessrepairs As detailedinthelicenceagreement,Universitywillnormally give24hours’ Rooms -EntryandUse to you. reported yourself,anychargesmadeforthewastedcall-outwillbepassedon cannot gainaccesstotheaccommodationinresponsearepairthatyouhave given inanemergencyorwhereyouhavereportedtherepairyourself.Ifwe in advanceofanyrepairormaintenanceworks.However,nonoticewillbe maintenance orrepairspurposesbutwewillalwaystrytonotifyyoubyemail The Universityhasrightsofentryintoaccommodationforinspections, to attend. Campus Supportteamwillmakethenecessaryarrangementsforacontractor outside normalhours.Inthecaseofemergencyrepairsoutofficehours, Monday toFridayandtheSecurityCustomerInformationCentre(SCIC) during termtimeoryoucanvisittheDurningCentrebetween7.00am-7.00pm The FMHelpdeskisalsoavailablebytelephoneon All repairs,defectsorfaultsshouldbereportedonlinevia Repairs See ‘Off-CampusHousing’undersection‘O’. Renting aHouseorFlatPrivately Please see‘Cleaning’undersection‘C’. Recycling R
01695 584455 ehu.ac.uk/MyFM
(24hours)* .
THE A-Z OF LIVING IN HALLS Edge Hill University 23 For information on overnight guests, please visit ehu.ac.uk/accommodationteam. You are responsible for the conduct of your visitors and if visitors are causing a nuisance to others, or if we cannot establish that they are a guest of a resident or have legitimate business in the residence, they must leave if asked to do so by a member of staff or the Campus Support team.
Room Transfers Requests to transfer to a different room in halls will be considered but are dependent on the availability of rooms. A charge of £25 will be applied to your original invoice if you do transfer to another room. S
Safety Off Campus Here is some advice for staying safe off campus:
- Wherever possible, avoid walking or cycling after dark in poorly lit areas, especially if alone.
- Be careful and observant when you are using headphones or earphones when walking alone.
- Try to avoid walking alone at night. Take a friend with you if you have to go out.
- Always let someone know where you are going and what time you may be back.
- If travelling away from campus, try to get a lift from a friend or use public transport. Wait with a friend - do not accept lifts from strangers.
- If you suspect you are being followed or feel your safety is endangered, go to a public place and seek assistance.
- Take particular care when withdrawing money from cash machines. Be aware that you are vulnerable when handling your cash and card. Do not use cash machines at night; think ahead and withdraw any cash during the day. of anycigarettebutts. include entrancestohallsofresidence.Pleasebesureresponsibly dispose (‘vapes’). Therearemarkedsmokingexclusionzonesaround campuswhich residence, andEdgeHillvehicles.Thisincludestheuseofelectronic cigarettes Smoking isstrictlyprohibitedwithinallcampusbuildings, including allhallsof Smoking fridges/freezers). and property(thisincludesfoodfrozengoodsstored inEdgeHill’s Edge Hillcannotacceptanyresponsibilityforthelossofpersonal belongings ------Please followthesesimplesuggestions: Securing Your Belongings
( don’t knowwhotheyarecontactCampusSupporton If youseesomeonetryingtoenteryourhallsofresidenceand operational faultyoushouldreportitstraightawayvia If youareunabletosecureadoororwindowduemechanical Do notleavevaluableportableitemswithineasyreachofthewindow. reach ofthewindow. Do notleavevaluableitemsondisplay(i.e.inyourwindow)orwithineasy Ensure windowsanddoorsaresecuredbeforegoingtosleep. only forashorttime. Ensure thatyoulockdoorsandwindowswhenevergoout,evenifitis Ensure theoutsidedoorissecuredwhenleavinghalls. Never allowunknownvisitorsintohalls. from closing. Never propdoorsopenorplacesomethinginfrontofthedoortostopit Never leaveyourroomunattendedwithoutlockingthedoor. 2222
from aninternalphone)immediately.
ehu.ac.uk/MyFM
01695 584227
.
THE A-Z OF LIVING IN HALLS Edge Hill University 25 Sports and Fitness If you are a new EHU student, you can access an all-inclusive trial Premier membership for Edge Hill Sport during the first four weeks of the academic term, with the option to continue with this membership at a substantially discounted rate for the remainder of the academic year. You can activate the trial at any time during the first four weeks by attending the Sports Centre and you can purchase the extension period at any time following the trial period.
Edge Hill Sport provides a focus for all sports, fitness and leisure activities on campus. There really is something for everyone regardless of your sporting ability or motivations. Whether you want to try new activities, have an occasional social game with friends, keep fit, play in university sports teams, or get support as a performance athlete on a sports scholarship, we will help you to achieve your goals.
Visit our webpage at edgehill.ac.uk/edgehillsport to check out our range of memberships.
You can get in touch with the Edge Hill Sport team via:
Tel: 01695 584745 Email: [email protected] Web: edgehill.ac.uk/edgehillsport Twitter: @edgehillsport Facebook: facebook.com/edgehillsport To findoutmoreortobuyaTVLicencevisit do notprovidethemforresidentialbedrooms. Edge HillpurchasesaTVLicencefortheTVsincommunal areasonly.We phone, tablet,gamesconsole,digitalboxorDVD/VHSrecorder. This couldbeonanydevice,includingaTV,desktopcomputer, laptop,mobile - - You mustbecoveredbyaTVLicenceto: TV Licensing are notpermittedtocollectordropoffinanyotherareaoncampus. point attheMainEntrancebySCICorfromoutsideSportsCentre.Taxis All taxisshouldbedirectedtocollectanddropoffcustomersfromthepick-up Taxis Please see‘ParkingOnCampus’undersection‘P’. Cycling Please notethereisnoserviceonBankHolidaysandSundays. so pleaseseethetimetableat Ormskirk busstationeverytwentyminutes.Thisscheduleissubjecttochange you showyourUnicard.TheservicerunsbetweenOrmskirkcampusand All EdgeHillstudentsareeligibletouseourEdgeLinkshuttlebusforfreewhen your journey. surrounding area.Visit There areregulartrainandbusservicesconnectingOrmskirkwiththe Bus andTrain Travel T
download orwatchBBCprogrammesoniPlayer. online TVservice,suchasAll4,SkyGoandYouTube,or watch orrecordprogrammesasthey’rebeingshownonTV orliveonan
ehu.ac.uk/travel ehu.ac.uk/travel for moreinformationortohelpplan tvlicensing.co.uk/studentinfo
for currentservicedetails.
.
THE A-Z OF LIVING IN HALLS Edge Hill University 27 U
Unicards If you are resident in a catered hall, a weekly cash value of £42.00 will automatically be placed on your Unicard for 35 weeks of your 40 week contract. Study Abroad students on a semester programme have the cash value for every week of their programme except the vacation periods. You must show your Unicard for every transaction, otherwise a charge will be made for the purchase. Unicards are not transferable.
It is your responsibility to use the full monetary value on the card each week as the balance will only be carried forward for up to three weeks.
Students who wish to remain on campus during the vacation periods can either make cash purchases or top up their Unicard via UPAY Chilli at the following link: upaychilli.com.
Lost Unicards must be reported immediately to the FM Helpdesk in the Durning Centre. An administrative charge must be paid online for a replacement Unicard via the following link: store.edgehill.ac.uk - click on Facilities Management under the product catalogue. Your receipt of payment must be shown at the FM Helpdesk prior to the production of a replacement Unicard. Please note that the University cannot accept any responsibility for monetary losses due to lost or stolen Unicards. services. internal orexternalservicesyoumayfindusefulsuchascounsellingandGP as anxiety,stress,orfeelingoverwhelmed.Theycanalsosignpostyouto The Wellbeingteamcanoffersupportforissuesthataffectyourwellbeingsuch Wellbeing andCounselling See ‘HospitalandWalk-InCentre’under‘H’. Walk-in Centre Edge Hill University accepts noliabilityforerrors oromissions. All informationiscorrect attimeofprinting(July2019)and subjecttochangewithoutnotice. Disclaimer university life,connectingyoutosupportandserviceshelp yousucceed. Transitions teamcanhelpyoutonavigatethechallenges thatcomewith contact your own.Youcanalwaysspeaktotutorbutalternativelyyoualso dropping outorleavingtheUniversity–thisisnotunusualandyouareon subject choiceordifficultiesduringtheirstudiesandmayeventhinkabout Many studentsfindthemselvesfeelingunhappy,havingdoubtsabouttheir Thinking ofleaving? Withdrawal from University See ‘Internet’undersection‘I’. Wi-Fi Location: Web: Email: W
ehu.ac.uk/wellbeing [email protected]
Catalyst
and
MiltonHouse
where youcanspeaktoanadvisor.The
THE A-Z OF LIVING IN HALLS Edge Hill University 29 Notes Notes
THE A-Z OF LIVING IN HALLS Edge Hill University 31 Notes rights tothefollowingkeyareas: protects yourrightstoasafeandgoodqualityplacelive.Itincludes visit For moreinformationabouttheStudentAccommodationCode, ------Edge HillUniversityhassigneduptotheStudentAccommodationCodewhich Student AccommodationCode A livingenvironmentfreefromanti-socialbehaviour. Access tohealthandwellbeingservices. (the University,inthiscase). A formal,contractualrelationshipwithyourlandlord, A clean,pleasantlivingenvironment. Timely repairsandmaintenance. A healthy,safeenvironment. thesac.org.uk ACCOMMODATION WINNER 2017 N
THE A-Z OF LIVING IN HALLS Edge Hill University 33 Edge Hill University w edgehill.ac.uk St Helens Road, Ormskirk, f facebook.com/edgehilluniversity Lancashire, L39 4QP t twitter.com/edgehill United Kingdom