sign in sign up
<<
Home , Frederick Delius

FREDERICK DELIUS ROUTLEDGE MUSIC BIBLIOGRAPHIES

Series Editor: Jennifer C. Post

COMPOSERS , Bartholdy 2nd Edition (2009) (2001) Isaac Albéniz (1998) James P. Cassaro John Michael Cooper Walter A. Clark (1993) Olivier Messiaen (2008) C. P. E. Bach (2002) Christopher Kent Vincent P. Benitez Doris Bosworth Powers Gabriel Fauré (1999) Giovanni Pierluigi da Samuel Barber (2001) Edward R. Phillips Palestrina (2001) Wayne C. Wentzel Clara Marvin Christoph Willibald Gluck, Béla Bartók, 2nd Edition (2003) (1999) 2nd Edition (1997) Patricia Howard Linda B. Fairtile Elliott Antokoletz Charles François Gounod (2004) , (2009) Stephen Zank 2nd Edition (2009) Timothy S. Flynn Stephen A. Willier , G.F. Handel, 2nd Edition (2009) Alban Berg, 2nd Edition (2004) Denise P. Gallo 2nd Edition (2009) Mary Ann Parker Bryan R. Simms Camille Saint-Saëns (2003) Paul Hindemith, Timothy S. Flynn Leonard Bernstein (2001) 2nd Edition (2009) Alessandro and Domenico Paul F. Laird Stephen Luttmann Scarlatti (1993) (2003) Charles Ives, Carole F. Vidali Heather Platt 2nd Edition (2009) Heinrich Schenker (2003) Gayle Sherwood Magee William Byrd, Benjamin Ayotte 2nd Edition (2005) (1998) Richard Turbet (2004) Nancy R. Ping-Robbins Ellon D. Carpenter Elliott Carter (2000) Zoltán Kodály (1998) John L. Link (1998) Mícheál Houlahan and Glenda D. Goss Carlos Chávez (1998) Philip Tacka Robert Parker (1998) , Gregory Harwood Frédéric Chopin (1999) 3rd Edition (2009) William Smialek Michael Saffle Tomás Luis de Victoria (1998) Aaron Copland (2001) Guillaume de Machaut Eugene Casjen Cramer Marta Robertson and (1995) Robin Armstrong Lawrence Earp (2002) Michael Saffle Frederick Delius, Gustav and Alma Mahler 2nd Edition (2009) (2008) Adrian Willaert (2004) Mary Christison Huismann Susan M. Filler David Michael Kidger GENRES Ethnomusicology (2003) The Recorder, Jennifer C. Post 2nd Edition (2003) American Music Richard Griscom and Librarianship (2005) Jazz Scholarship and David Lasocki Carol June Bradley Pedagogy, 3rd edition, (2005) Serial Music and Serialism Central European Folk Music Eddie S. Meadows (2001) (1996) John D. Vander Weg Philip V. Bohlman The Musical (2004) William A. Everett String Quartets (2005) Chamber Music, Mara E. Parker 3rd Edition (2009) North American Indian John H. Baron Music (1997) The Violin (2006) Richard Keeling Mark Katz Church and Worship Music (2005) Opera, 2nd Edition Women in Music (2005) Avery T. Sharp and James (2001) Karin Pendle Michael Floyd Guy Marco

The (2006) Piano Pedagogy (2009) Stephen D. Lindeman Gilles Comeau

FREDERICK DELIUS

A RESEARCH AND INFORMATION GUIDE

SECOND EDITION

MARY CHRISTISON HUISMANN

ROUTLEDGE MUSIC BIBLIOGRAPHIES First edition published 2005 By Routledge

This edition published 2009 by Routledge 270 Madison Ave, New York, NY 10016

Simultaneously published in the UK by Routledge 2 Park Square, Milton Park, Abingdon, Oxon OX14 4RN

Routledge is an imprint of the Taylor & Francis Group, an informa business

Transferred to Digital Printing 2009

© 2005, 2009 Taylor & Francis

Typeset in Times New Roman by Prepress Projects Ltd, Perth, UK

All rights reserved. No part of this book may be reprinted or reproduced or utilised in any form or by any electronic, mechanical, or other means, now known or hereafter invented, including photocopying and recording, or in any information storage or retrieval system, without permission in writing from the publishers. Trademark Notice: Product or corporate names may be trademarks RUUHJLVWHUHGWUDGHPDUNVDQGDUHXVHGRQO\IRULGHQWL¿FDWLRQDQG explanation without intent to infringe.

Library of Congress Cataloging in Publication Data Huismann, Mary Christison. Frederick Delius: a research and information guide/Mary Christison Huismann.—2nd ed. p. cm.—(Routledge music bibliographies) Includes bibliographical references, discography, videography, and index. ML134.D293H85 2009 016.78092—dc22 2008051725

ISBN10: 0–415–99364–4 (hbk) ISBN10: 0–203–89178–3 (ebk)

ISBN13: 978–0–415–99364–7 (hbk) ISBN13: 978–0–203–89178–0 (ebk) To Rick and Andrew, with much love Soli Deo Gloria!

Contents

Preface xi

Acknowledgments xv

I Biography 1 Biographical Sketch 1 Chronology 4 List of Works 9 I Dramatic Works 9 II Works for Voices and 10 III Works for Solo Voice and Orchestra 10 IV Works for Unaccompanied Voice 10 V Songs with Pianoforte Accompaniment 11 VI Works for Orchestra 13 VII Works for Solo Instrument(s) and Orchestra 14 VIII Chamber Music 14 IX Piano Solo 14 X Appendix 15

II Bibliography 17 Source Materials 17 Writings and Correspondence 17 Collected Edition of the Works of Frederick Delius 23 Catalogs 34 Collections 35 Archives and Museums 35 Articles and Essays 39 Images 41 Sound and Video 42 Miscellaneous 44 Special Publications 46 Exhibitions and Exhibition Catalogs 46

ix x Contents

Festival Program Books (Arranged Alphabetically by Festival Title) 48 Unpublished Materials 49 Organizations 50 Delius Society Publications 51 Delius Society Newsletter 52 Delius Society Journal 65 The Delian 147 Secondary Sources 153 Reference Works 153 Topical Studies 179 Book Reviews 241 Genre Studies and Studies of Multiple Works 256 Individual Compositions (Alphabetical by Composition Title) 275 Audiovisual Resources 303

III Related Materials: A Selective List of Works Dedicated to, Inspired by, or Created in Memory of Delius 309 Architecture 309 Art 309 Dance 311 Drama 311 Fiction 312 Films Utilizing the Music of Delius 313 Music 314 Poetry 317 Miscellaneous 318

IV Discography 319

Index of Compositions 355

Index by Keyword 361

Index by Name 367 Preface

2004 marked the seventieth anniversary of the death of composer Frederick Delius. At that time, a review of the Delius literature revealed many publica- tions, but no full-length bibliographical study. The former Delius Trust archivist Rachel Lowe noted the lack of an authoritative bibliographical survey in her condensed summary of her catalog of manuscripts held by the Delius Trust.1 However, the lack of a full-scale bibliography is not the only void in Delius VFKRODUVKLS²ZHVWLOODZDLWWKHGH¿QLWLYHELRJUDSK\DQGVWXG\RIWKHPXVLF That is not to say there have been no bibliographical efforts along the way. The meticulous work of Robert Threlfall and Rachel Lowe have given us au- thoritative catalogs of the works and manuscripts of Delius; these works also contain bibliographies, but not as the primary focus. Dr. Lionel Carley has also compiled a concise bibliography issued by the Delius Trust in their set of infor- mation guides. The index of the Delius Society Newsletter and Delius Society Journal, compiled by Stephen Lloyd, gives a detailed look at what those publi- cations contain. Finally, at least one bio-bibliography project was considered but not undertaken.27KHDXWKRUKXPEO\KRSHVWKLVYROXPHFDQ¿OOWKHYRLG

PURPOSE AND SCOPE

As with other volumes of the Routledge Music Bibliographies series, this text provides citations to the core Delius literature. The volume is intended for stu- dents and researchers, as well as those seeking an introduction to Delius. It is not a comprehensive record of published materials on Delius, but rather presents a selective, annotated list of essential texts published through mid-2008. Indexing of the Delius Society Journal is complete through issue no. 143 (2008). Citations have been gathered through a search of appropriate print and electronic indexes and resources accessed primarily through the University of Minnesota Libraries, including the Music Index, International Index to Music Periodicals, RILM Abstracts of Music Literature, WorldCat, and other data- bases, other library catalogs, and musical reference works. Research was also conducted in the collections located at the Jacksonville () Public Library and Jacksonville University. An entirely subjective selection of reviews has been included, primarily fo- cused on feature reviews, comparative reviews of scores or recordings, and per- IRUPDQFHUHYLHZV3UHIHUHQFHZDVJLYHQWRWKRVHUHYLHZVRIVLJQL¿FDQWSHUIRU- PDQFHVRUE\VLJQL¿FDQWDXWKRUVWKRVHZLWKH[WUDIHDWXUHVVXFKDVLOOXVWUDWLRQV

xi xii Frederick Delius: A Research and Information Guide or summaries of critical reaction, and those easily accessible to the researcher. Reviews of the core Delius literature have been gathered into a separate section.

CRITERIA FOR SELECTION

All substantial, relevant writings in English and the major European languages in all formats published through mid-2008 have been considered for inclusion. 3UHIHUHQFHLQWKH¿QDOVHOHFWLRQZDVJLYHQWRWKRVHPDWHULDOVHDVLO\DFFHVVLEOH through normal library and research methods. The following types of materials are included:

‡ Full-length monographs solely devoted to the life and works of Delius ‡ &KDSWHUVDQGPRQRJUDSKVZLWKVLJQL¿FDQWGLVFXVVLRQRI'HOLXV ‡ Articles in scholarly journals and selected popular magazines ‡ Doctoral dissertations primarily from North American universities ‡ Selected master’s level theses chosen for unique content ‡ Selected reviews of performances, recordings, and scores ‡ Festivals and exhibitions devoted to Delius ‡ Websites and Internet resources related to Delius ‡ Original creative works inspired by or dedicated to Delius

The following types of materials were generally excluded:

‡ Textbooks and general histories of music ‡ Newspaper articles and reviews (unless reprinted in books or articles making them more accessible, or that offer unique content) ‡ Reviews of single recordings or scores ‡ Brief news notes or announcements ‡ Uncompleted doctoral dissertations or master’s theses ‡ Undergraduate theses or seminar papers ‡ Musical scores ‡ Liner notes ‡ Non-western European foreign-language materials

CONTENTS OF THE BOOK

The information in each chapter is organized as follows: Chapter 1. Biography. This section contains a biographical sketch, chronol- ogy of Delius’s life and compositions, and a list of Delius’s works. The works are DUUDQJHGLQDFODVVL¿HGOLVWIROORZLQJWKHDUUDQJHPHQWDQGQXPEHULQJVFKHPH devised by Robert Threlfall. Chapter 2. Bibliography. This lengthy chapter has been subdivided into eight SDUWV7KH ¿UVW SDUW FRYHUV VRXUFH PDWHULDO 'HOLXV¶V ZULWLQJV DQG FRUUHVSRQ- dence, and the collected edition of his musical works. Following source material Preface xiii are the major catalogs of works and manuscripts. The third part is devoted to collections and archives, including collections of manuscripts, articles and es- says, images, sound and video. Special publications such as exhibition catalogs and festival program booklets are found in the fourth part. The following two parts cover unpublished materials and various Delius-related organizations. The seventh part is a selective list of articles published in the Delius Society Newslet- ter, the Delius Society Journal, and The Delian (published by the Delius Society, Philadelphia Branch). A slight preference has been given to articles not covered in Stephen Lloyd’s excellent index to the Delius Society Newsletter and Journal. 7KH¿QDOSDUWRIWKHFKDSWHULVGHYRWHGWRVHFRQGDU\VRXUFHVUHIHUHQFHZRUNV containing Delius information (necessarily selective), surveys of his life and works, topical studies, dissertations and theses, book reviews of the core Delius literature, genre studies, studies of individual compositions, and audiovisual materials. Chapter 3. Related Materials. This chapter contains citations to original, cre- ative works that were inspired by or dedicated to Delius. Chapter 4. Discography. The selective discography is limited to commer- cially available compact discs issued 1983 through mid-2008. Preference was given to reviewed discs, recordings containing multiple Delius works, reissues RIVLJQL¿FDQWDQDORJGLVFVDQGWKRVHIHDWXULQJQRWHGSHUIRUPHUVRUFRQGXFWRUV Indexes. There are indexes for titles of Delius’s compositions, keywords, and names.

ARRANGEMENT OF ENTRIES

In general, citations follow the format of The Chicago Manual of Style, 14th edition. Entries are arranged alphabetically by author, unless noted. Unattributed DUWLFOHVDSSHDU¿UVWIROORZHGE\WKRVHZLWKDXWKRUV0RQRJUDSKVJHQHUDOO\SUH- cede portions of books or articles; in most cases there are subheadings directing the reader. Reprint and other publication information generally follows the main citation. Separate citations are not generally made for such works, unless the entry would prove to be too complicated without such an arrangement (e.g., the various editions of ’s Delius As I Knew Him). Each citation is accompanied by an annotation that gives a brief, objective description of the contents of the item. In a few cases it was not possible to personally examine the actual material. Annotations for those items are marked ³1RW DYDLODEOH IRU H[DPLQDWLRQ´ /LEUDU\ RI &RQJUHVV FODVVL¿FDWLRQ QXPEHUV and International Standard Book Numbers (ISBN) have been provided when available for monographs. Citations for reviews of the essential Delius literature (primarily monographs with Delius as the sole focus) have been placed in their RZQVHFWLRQ5HYLHZVRIRWKHUVHOHFWHGPDWHULDOV FKLHÀ\DXGLRYLVXDOPDWHULDOV  are given in a list at the end of the annotation. xiv Frederick Delius: A Research and Information Guide

MISCELLANEA: DELIUS’S BIRTH YEAR, SOLANO GROVE, AND PHILIP HESELTINE ()

The year of Delius’s birth was always thought to be 1863, even by Delius him- self. Research carried out by Philip Heseltine established the correct year as 1862. There is a short explanation of this situation in an article published in De- lius Society Journal no. 94 (1987): 31. Many early sources use the “1863” date, so I have chosen not to point out that error for those sources. The original spelling of the name of Delius’s Florida property was Solana Grove. Over the years the spelling has changed to “Solano” and that is the spell- ing I have chosen to use in this book. Philip Heseltine was perhaps better known as “Peter Warlock,” the pseud- onym he adopted for musical composition. I have chosen to use his given name, Philip Heseltine, in the interest of consistency. A cross-reference in the name index has been added for “Peter Warlock.”

Notes

1 Rachel Lowe, “The Music Archive of the Delius Trust,” Music Review 34 (1973): 294. 2 Harold J. Diamond, correspondence with author, 11 April 2003. Acknowledgments

A work of this magnitude could not have been performed solo, and many people deserve my grateful thanks. It was truly a joy to meet so many fellow Delians while working on this project, ready to offer assistance and advice. I hope the following list includes everyone I am indebted to, but if not, please accept my gratitude anyway. I would like to thank my colleagues at the University of Minnesota University Libraries for their support and encouragement, particularly Linda Haack Lomker (Specialized Cataloging Section Leader), Barbara Stelmasik (Director, Techni- cal Services), and my colleagues in Wilson Library and the Music Library. I owe a huge debt of gratitude to the Interlibrary Loan staff (Cherie Weston, head) for all the wonderful and obscure documents they tirelessly located for me. Thanks are also due to the Stack Services crew, who cheerfully retrieved storage materi- als on a moment’s notice. I would also like to express my gratitude to the Friends of the Library for a Staff Development Grant that allowed me to visit collections in Jacksonville, Florida. Many thanks are due to Mr. Jeff Driggers, Curator of the Delius Collection at the Jacksonville Public Library, who was most helpful in my research and in arranging use of the Delius Collection. Many thanks to Ms. Carol Schwartz, Fine Arts Library Head, Jacksonville Public Library and her staff, for graciously allowing me access to library materials and study space. The Jacksonville Uni- versity Delius Collection was another wonderful resource, and I would like to thank Ms. Anna Large (Special Collections) and Mr. Thomas H. Gunn (Director, Swisher Library) for taking time out of their busy schedules to assist with my project. Thanks are due to Mr. Jesse G. Wright of Jacksonville University and the Delius Association of Florida for facilitating my visit to the Delius House on the grounds of the university. Thanks also to Bill Thompson, for graciously announcing this project on his Delius website. I would like to thank Dr. Lionel Carley of the Delius Trust, for answering questions and giving permission to use the photograph of Delius for the book cover. Many thanks also go to Anthony Lindsey of the Delius Society, who de- VSLWHDQXQIRUWXQDWHDFFLGHQWZDVVWLOODEOHWRIXO¿OOP\UHTXHVWIRUPDQ\EDFN issues of Delius Society Journal. Thanks are also due to Mr. Bill Marsh, Chair- man of the Delius Society Philadelphia Branch, for providing materials and information. I would also like to thank the staff at Routledge, Denny Tek and Constance Ditzel, for their guidance in the preparation of the manuscript.

xv xvi Frederick Delius: A Research and Information Guide

Finally, many thanks are due to Barbara Bren, and to Elaine and George Krasny, for editorial assistance, advice, and encouragement throughout this project. Your enthusiasm has kept me going! Last, but certainly not least, I would like to thank my family and friends for their patience, encouragement, and support of this project. I could not have done it without you. Most of all, my deepest gratitude to Rick and Andrew, for dealing with the ups and downs this project has brought. Life can now get back to normal! I Biography

BIOGRAPHICAL SKETCH

Fritz Theodore Albert Delius was born 29 January 1862, the fourth child and second son of the fourteen children born to Julius and Elise Krönig Delius. The Deliuses emigrated from , Germany, to , , in the 1850s. The Delius family was engaged in the wool trade in the city. Delius was educated at a local preparatory school, followed by enrollment at the Bradford Grammar School in 1874. Fritz also studied piano and violin, the latter started in 1868 with Mr. Bauerkeller of the Hallé Orchestra and later with a Mr. Haddock of . Although music was highly appreciated in the Delius household, it was made clear that music was to be only an amateur pursuit. In 1878 Fritz became a student at the International College in Isleworth as preparation for participation in the family wool business. The college’s loca- tion near London afforded him ample opportunity to attend concerts. After his VFKRROLQJHQGHGKHEHJDQKLVDSSUHQWLFHVKLSZLWKWKHIDPLO\¿UP+HWUDYHOHG DEURDGRQEHKDOIRIWKH¿UPYLVLWLQJ)UDQFH*HUPDQ\6ZHGHQDQG1RUZD\ While spending time in on business, Delius managed to study violin with . A trip to Norway made a lasting impression on him and was later UHÀHFWHGLQKLVPXVLF At this point it was obvious that Delius did not want to continue in the family business. His father however did not take this lightly—the eldest son, Ernest, had already proven unsuited for business, so it had been assumed that Fritz ZRXOGFRQWLQXHLQWKH¿UP8QGDXQWHG)ULW]SHUVXDGHG-XOLXVWRVHWKLPXSZLWK an orange plantation in Florida. He and a family friend, Charles Douglas, set sail IRU$PHULFDLQ0DUFK¿QDOO\DUULYLQJDW6RODQD 6RODQR *URYHRQWKH6W Johns River.1 )ORULGDZDVWRSURYLGHDODVWLQJLQÀXHQFHRQ'HOLXV¶VPXVLF,WZDVWKHUH WKDWKHKHDUGWKH$IULFDQ$PHULFDQVLQJLQJWKDWLQÀXHQFHGPXFKRIKLVPXVLF

1 2 Frederick Delius: A Research and Information Guide and it was there that he received the musical instruction enabling him to make composition his career. While in Jacksonville, as he was arranging for delivery of a piano to Solano Grove, Delius met the organist Thomas F. Ward by chance in a local music store. Delius then persuaded Ward to return to Solano Grove with him to instruct him in . Delius would later maintain that only Ward’s teaching had any importance in his life.2 In November 1884 Delius’s brother Ernest arrived at Solano Grove. Delius handed over management of the plantation to him and moved on to Jacksonville, where his piano piece Zum Carnival Polka was published. In 1885 he moved to Danville, Virginia, to teach violin at Roanoke College. When he heard nothing from his son, Julius Delius hired a detective to locate Fritz and to return him to England. Fritz returned, possibly by way of New York, when promised an opportunity to study at the Conservatory. In 1886 Fritz was on his way to Leipzig, where he studied with Sitt, (1824–1910), and (1831–1902) for eighteen months. More important than his musical studies were the friendships developed there—particularly that with the Norwegian composer (1843–  ,WZDV*ULHJZKRZDVDEOHWR¿QDOO\FRQYLQFH-XOLXV'HOLXVRI)ULW]¶V musical abilities and his promising career. Furthermore, Grieg was instrumental in the publication of Delius’s Five Songs from the Norwegian in London by Augener in 1890. Delius moved to in the summer of 1888. His associates included mostly writers and artists, such as (1849–1912), (1863–1944), and (1848–1903). Many of the people in this circle had ties to Scandinavia. He also made the acquaintance of the mu- sicians Maurice Ravel (1875–1937), Gabriel Fauré (1845–1922), and (1870–1958). Although Paris provided much pleasure to Delius, it also later provided much pain in the form of syphilis, which he contracted around 1895. At this time Delius was determined to be a composer of opera, writing both the music and libretti for (1890–1892) and The Magic Fountain (1893–1895). Other operas written at this time included (1897) and A Village (1899–1901). Delius met Helene “Jelka” Rosen, a German painter studying in Paris, in 1896. Although not a musician herself, she came from a musical family that included the famous pianist and composer (1794–1870). The following year, Delius moved to her home in Grez-sur-Loing, near Fontainb- leau, and the two married in 1903. Around this time Fritz anglicized his name to Frederick, probably to widen his musical appeal. After a brief trip to America in 1897, Delius returned to Grez and remained there for most of his remaining life, except for the war years spent in England, Norway, and Denmark. Delius’s early success as a composer came in Norway. His Paa ViderneZDVWKH¿UVWRIKLVZRUNVWREHSHUIRUPHGLQSXEOLF &KULVWLDQLD [], 10 October 1891). His to ’s play Fol- Biography 3 keraadet provided scandal at its premier in 1897 with its controversial treatment of the Norwegian national anthem. Delius’s music became increasingly successful in Germany thanks to the ef- forts of conductor . He was responsible for several premieres in Elberfeld, including Over the Hills and Far Away (1897), Paris (1901), and   7KH\HDUDOVREURXJKWWKH¿UVWVWDJLQJRIWKHRSHUD Koanga at the Elberfeld Stadttheater. The critic Max Chop published his study, WKH¿UVWERRNGHYRWHGWR'HOLXVLQ Delius was not yet known in England, a situation he attempted to remedy with DVHOI¿QDQFHGFRQFHUWLQ/RQGRQLQ0D\&ULWLFDOUHDFWLRQZDVOXNHZDUP however, and Delius was not able to generate additional opportunities. Delius’s music was not heard in London again until 1907 when the and Appalachia were performed. The conductor (1879–1961) was impressed by Delius’s music, and undertook efforts to make the music more well known. Beecham began a series of performances, including a complete performance of A Mass of Life in 1909. After the war, Delius’s health began to show signs of the syphilis caught years before in Paris. Although ill, Delius was able to travel to Norway for three VXPPHUV ± DQGWR(QJODQGIRUWKH¿UVW/RQGRQSHUIRUPDQFHRIHas- san, his greatest commercial success to date. Another bright spot during these gloomy years was the publication of Philip Heseltine’s biography of Delius in 1923. Heseltine (1894–1930) had admired Delius’s works since his youth, and the two regularly corresponded over the years. As Delius’s health suffered further decline, the Deliuses traveled Europe in search of a cure. By his early sixties, though, Delius became blind and progres- sively paralyzed. Delius now relied on Jelka for assistance with daily tasks, cor- respondence, and music copying. Serendipitously, a young Yorkshireman, Eric Fenby (1906–1997), wrote to Delius offering his services as amanuensis. After 'HOLXVZDVVDWLV¿HGWKDW)HQE\KDGWKHUHTXLVLWHPXVLFDODELOLW\IRUWKHWDVN )HQE\DUULYHGLQ*UH]LQ)HQE\VSHQW¿YH\HDUVLQ*UH]DOORZLQJ'HOLXV to compose or complete several last works, including , A Late Lark, and Songs of Farewell to texts of . Delius was the recipient of several honors in his later years. In 1929 Thomas Beecham organized a festival of six concerts in London featuring Delius’s works, and the composer, despite his frailty, was able to attend each of the concerts. He was made a Companion of Honour in 1929. The Lord Mayor of Bradford trav- eled to Grez to present Delius with the Freedom of the City of Bradford award in 1932. Many distinguished musicians and friends visited Delius in his last year. Among the guests was the English composer Edward Elgar (1857–1934), with whom Delius corresponded until Elgar’s death in February 1934. Jelka was di- agnosed with cancer and underwent an operation later that year; as her health declined, Eric Fenby was recalled to Grez to help once again. 4 Frederick Delius: A Research and Information Guide

Delius died on 10 June 1934. His desire was to be buried in his garden at *UH]VXU/RLQJEXWWKHORFDORI¿FLDOVGLVDSSURYHG+LVERG\ZDVWHPSRUDULO\ interred in Grez and a year later was reinterred in the cemetery at St. Peters &KXUFK/LPSV¿HOG6XUUH\-HOND'HOLXVDFFRPSDQLHGKHUKXVEDQG¶VERG\WR England, but was too ill to attend the reburial. She passed away a few days later.

Notes

1 As stated in the preface, the spelling of the name of Delius’s plantation was “Solana Grove.” Over time it changed to “Solano,” the form used here for consistency’s sake. 2 Don Gillespie, The Search for Thomas F. Ward, Teacher of Delius (Gainesville: Uni- versity of Florida Press), xi. In the preface to Gillespie’s book, Eric Fenby recalls Delius saying “Ward’s counterpoint lessons were the only lessons from which I ever GHULYHGDQ\EHQH¿W+HVKRZHGZRQGHUIXOLQVLJKWLQKHOSLQJPHWR¿QGRXWMXVWKRZ much in the way of traditional technique would be useful to me.”

CHRONOLOGY

Year Life Events Principal Works 1862 Fritz Theodore Albert Delius born 29 January, No. 6 Claremont, Horton Lane, Bradford, Yorkshire. Fourth child (second son) of German natives Julius Delius, wool merchant, and Elise Krönig. 1868 Studies violin with Mr. Bauerkeller of the Hallé Orchestra. 1869 Violin lessons with Mr. Haddock of Leeds. 1871 Attends preparatory school in Bradford. 1872 Impressed by hearing a Chopin waltz (E minor, op. posth.). 1874 Attends Bradford Grammar School (1874–1878). 1875 Hears Lohengrin at Covent Garden; makes an impression on him. 1878 Pupil at International College, Isleworth, Middlesex (1878–1880). 1879 Enters the family wool business, Bradford; sent to Chemnitz to complete his business education; studies violin with Hans Sitt; visits Dresden, Berlin. 1880 Joins the family wool business. Biography 5

Year Life Events Principal Works 1881 Sent to , Gloucestershire, and Chemnitz as representative of the ¿UP 1882 Takes violin lessons with Hans Sitt in Chemnitz; recalled to Bradford; sent to Sweden and Norway; recalled to Bradford again; travels to St. Étienne (France), winds up in Monte Carlo; travels to Paris, calls on Uncle 7KHRGRUH'HOLXVDQG¿QDOO\UHWXUQV to Bradford. 1883 Travels to Norway; meets Ibsen and Heiberg; sent to Manchester to work LQ8QFOH(UQVW¶V¿UPGHFLGHVWR leave family business. 1884 Sails to Florida with Charles Douglas to grow oranges at Solano Grove, near Jacksonville. Meets organist Thomas F. Ward in a Jacksonville music store; Delius persuades Ward to return with him to Solano Grove; Delius studies counterpoint with him for six months. Delius impressed by singing of former slaves. Brother Ernest arrives in November; Delius leaves him in charge of the plantation. 1885 Leaves for Danville, Virginia; Six Part-Songs, Zum Carnival Polka, teaches violin at Roanoke College. Pensées mélodieuses, “Zwei bräune Augen” 1886 Leaves Danville for New York; returns to Bradford in June; parents relent and allow him to study at Leipzig Conservatory (1886–1888). Studies with Sitt, Reinecke, Jadassohn. 1887 Walking tour in Norway; returns to (1887, rev. 1889) Leipzig, meets Edvard Grieg and . 1888 Hires orchestra to play Florida; Zanoni (incomplete), Hiawatha accompanies Grieg to London; (incomplete), Suite, Paa Vidderne Grieg assures Julius Delius of (reciter, orchestra), String Quartet Frederick’s abilities; visits Uncle (incomplete), Fünf Lieder (aus dem Theodore Delius in Paris; remains Norwegischen) at Ville d’Avray to concentrate on composition. 6 Frederick Delius: A Research and Information Guide

Year Life Events Principal Works 1889 Moves to Croissy-sur-Seine. Idylle de printemps, Suite d’orchestre, Three Small Tone Poems, Sakuntala, Romance, Songs from the Norwegian 1890 Irmelin (1890–1892), Légendes, Paa Vidderne (tone poem), Four Songs (Heine; 1890–1891) 1891 Moves to 33 Rue Ducoüédic, Paris; Maud, Three Songs (Shelley) spends summer with Björnsen, 1RUZD\¿UVWSXEOLFSHUIRUPDQFH of Delius work (Paa Vidderne, Christiania [Oslo], 10 October 1891). 1892 Violin in B 1893 Paa Vidderne performed in Monte The Magic Fountain (1893–1895) Carlo. 1894 The Magic Fountain accepted for Weimar performance but withdrawn by Delius. 1895 Quarrels with Uncle Theodore Koanga (1895–1897), Over the Hills Delius; contracts syphilis around this and Far Away, Deux mélodies time. 1896 Meets German painter Appalachia: American Rhapsody, and they become close friends. Visits Romance Norway during the summer. 1897 Makes a brief visit to Florida Folkeraadet, Piano Concerto, Seven (possibly to search for former lover Danish Songs and child). Jelka and her mother purchase the house at Grez-sur- Loing; Delius returns from Florida and moves in. 1898 Uncle Theodore Delius dies and Mitternachtslied Zarathustras, leaves Frederick a small inheritance. Lieder nach Gedichten von Friedrich Delius buys Paul Gauguin’s Nietzsche Nevermore. Gunnar Heiberg commissions incidental music for Folkeraadet; the première causes a scandal. 1899 Delius travels to England to visit his A Village Romeo and Juliet (1899– sister Clare. Produces a concert of 1901), La ronde se déroule (rev. as his own works at St. James’s Hall, Lebenstanz, 1901), Paris 30 May, to polite response; incurs ¿QDQFLDOGHEWIURPFRQFHUW 1900 “The Violet” 1901 Julius Delius dies, age 80. Lebenstanz, 1901 1902 Margot la Rouge, Summer Landscape, Appalachia (1902–1903) Biography 7

Year Life Events Principal Works 1903 Marries Jelka Rosen in Grez-sur- (1903–1904) Loing. 1904 Several major performances in A Mass of Life (1904–1905) Germany, including Appalachia, Koanga. Meets . 1905 Violin Sonata no. 1 (1905–1914) 1906 Approached by German publisher (1906–1907) Harmonie Verlag. Takes summer holiday in Norway; sees Grieg for the last time. 1907 First performance of A Village Fair, “On Craig Ddu,” Cynara Romeo and Juliet in Berlin. (1907–1929) Performances of the Piano Concerto and Appalachia in England. Meets Thomas Beecham. First book on Delius published (by Max Chop). 1908 Accepts vice presidency of the (1908–1911), Musical League. , Dance Rhapsody no. 1, “Wanderer’s Song” 1909 ([SHULHQFHVGLI¿FXOWLHVZLWK Harmonie Verlag and begins legal proceedings. First complete performance of A Mass of Life given by Beecham, London. Delius FRQGXFWV¿UVWSHUIRUPDQFHRIDance Rhapsody no. 1, Hereford Festival. 1910 Delius’s health deteriorates. A Village Romeo and Juliet produced at Covent Garden (Beecham). Begins correspondence with Philip Heseltine. Meets Béla Bartók. 1911 Travels to Wiesbaden in search of An Arabesque, The Song of the High DFXUH%HHFKDP¶V¿UVWDOO'HOLXV Hills concert, Queen’s Hall, London. 1912 Travels to England for a performance Two Pieces for Small Orchestra of Sea Drift (Birmingham Festival). (1912–1913) Sees his mother for the last time. Spends summer in Italy; meets American sculptor Henry Clews. 1913 Correspondence with Heseltine North Country Sketches (1913– reaches its peak. 1914), Two Songs for Children, (1913–1914) 1914 German performances of Delius’s music cease with outbreak of war; UHVXOWVLQ¿QDQFLDOORVV7KH'HOLXVHV leave Grez for London; spend winter with Beecham at Grove Mill House, Watford, and London. 8 Frederick Delius: A Research and Information Guide

Year Life Events Principal Works 1915 Air and Dance, (1915–1916), Four Old English Lyrics (1915–1916) 1916 The Deliuses return to Grez. Dance Rhapsody no. 2, Violoncello Sonata, String Quartet (rev. 1919) 1917 The Deliuses leave Grez for Eventyr, To Be Sung of a Summer England; remain there until the end Night on the Water of the war. 1918 Travels to Biarritz for a cure and A Song before Sunrise WR1RUZD\IRUWKH¿UVWWLPHLQIRXU years. House at Grez commandeered by French troops and left in a mess. 1919 Performances in London of Violin Dance Concerto, String Quartet, Eventyr. First performance of the opera Fennimore and Gerda (in Frankfurt). 1920 Song of the High Hills and the Hassan (1920–1923), Violoncello Double Concerto performed in Concerto (1920–1921), Songs of London. A Village Romeo and Juliet Farewell (1920–1930) revived by Beecham at Covent Garden. Accepts commission for incidental music for the Basil Dean production of ’s play Hassan. 1921 Paralysis sets in. Summer holiday spent in Norway; has chalet built there at Lesjaskog. 1922 Five Piano Pieces 1923 Hassan premiere given at Darmstadt; The Splendour Falls on Castle Walls, London production opened in Three Piano Preludes, Violin Sonata September. Last summer spent in no. 2 Norway. Heseltine’s biography of Delius is published. Several concerts given in honor of Delius’s sixtieth birthday. Purchases a motor car. Visits Cannes and spends Christmas in Rapallo. 1924 Financial outlook brighter. Takes A Late Lark (1924–1929) treatment in Cassel. 1925 Becomes blind and completely paralyzed. 1926 Obtains wireless and enjoys BBC broadcasts. 1927 1928 Eric Fenby arrives in October; serves as amanuensis. Biography 9

Year Life Events Principal Works 1929 Created a Companion of Honour A (1929–1930) in January. Beecham organizes a Delius Festival in October (series of six concerts); Delius able to attend. Composes several works through dictation to Fenby. 1930 Caprice and Elegy, Violin Sonata no. 3 1931 Irmelin Prelude, Fantastic Dance 1932 Given the Freedom of the City of Two Aquarelles, Idyll: Once I Passed Bradford award. James Gunn paints through a Populous City portrait of Delius. 1933 Edward Elgar, , and Norman O’Neill visit Delius at Grez. Jelka suffers accident with cyclist. 1934 Jelka has surgery for cancer. Delius dies 10 June and is buried temporarily at Grez. 1935 'HOLXVUHLQWHUUHGDW/LPSV¿HOG , England on 26 May. Jelka travels to England, but is too ill to attend the reburial and succumbs two days later.

LIST OF WORKS

The standard numbering for Delius’s works is that found in the catalog compiled by Robert Threlfall in 1977. Other lists of works can be found in Thompson, Kenneth, “Frederick Delius (1862–1934)” (see no. 821), pp. 116–131 and New Grove Dictionary of Music and Musicians (see no. 805), Vol. 7, pp. 161–169. The summarized list below is drawn from the Threlfall catalog (see no. 33). Following the number for the work is its title, description, and composition date. Titles that have become better known in translated form have been added fol- lowing an equals sign after the title (e.g., Im Meerestreiben = Sea Drift).

I Dramatic Works

I/1 Zanoni (incidental music; incomplete) 1888 I/2 Irmelin (opera) 1890–1892 I/3 The Magic Fountain (opera) 1893 I/4 Koanga (opera) 1895–1897 I/5 Folkeraadet (incidental music) 1897 I/6 A Village Romeo and Juliet (opera) 1900–1901 I/7 Margot la Rouge (opera) 1901–1902 I/8 Fennimore and Gerda (opera) 1909–1910 I/9 Hassan (incidental music) 1920–1921; additions, 1923 10 Frederick Delius: A Research and Information Guide

II Works for Voices and Orchestra

II/1 Mitternachtslied Zarathustras for baritone solo, men’s chorus, orchestra (words by ) 1898 II/2 Appalachia (variations for baritone solo, chorus, orchestra) 1902 II/3 Im Meerestreiben = Sea Drift for baritone solo, chorus, orchestra (words by Walt Whitman) 1904 II/4 Eine Messe des Lebens = A Mass of Life for soprano, alto, tenor and baritone solo, chorus, orchestra (words by Friedrich Nietzsche) 1905 II/5 Songs of Sunset for soprano, baritone solo, chorus, orchestra (words by ) 1906–1908 II/6 The Song of the High Hills for wordless chorus, orchestra 1911 II/7 An Arabesque for baritone solo, chorus, orchestra (words by 1911) II/8 Requiem for soprano, baritone solo, double chorus, orchestra 1914 II/9 Songs of Farewell for double chorus, orchestra (words by Walt Whitman) 1930 II/10 Idyll (‘Once I passed thro’ a populous city’) for soprano, baritone, orchestra (words by Walt Whitman) 1932

III Works for Solo Voice and Orchestra

III/1 Paa viderne [melodrama] (words by ) 1888 III/2 Sakuntala for tenor, orchestra (words by Holger Drachmann) 1889 III/3 Maud for tenor, orchestra (words by Alfred, Lord Tennyson) 1891 1. “Birds in the High Hall-Garden” 2. “I Was Walking a Mile” 3. “Go Not Happy Day” 4. “Rivulet Crossing My Ground” 5. “Come into the Garden, Maud” III/4 Seven Danish Songs with orchestral or piano acc. 1897 1. “Silken Shoes” (words by Jens Peter Jacobsen) 2. “Irmelin Rose” (words by Jens Peter Jacobsen) 3. “Summer Nights” (words by Holger Drachmann) 4. “The Seraglio Garden” (words by Jens Peter Jacobsen) 5. “Wine Roses” (words by Jens Peter Jacobsen) 6. “Red Roses” (words by Jens Peter Jacobsen) 7. “Let Springtime Come, Then” (words by Jens Peter Jacobsen) III/5 Cynara for baritone, orchestra (words by Ernest Dowson) 1907–1929 III/6 A Late Lark for tenor, orchestra (words by W. E. Henley) 1924–1929

IV Works for Unaccompanied Voice

IV/1 Six Part-Songs for Mixed Voices 1885–1887 1. “Lorelei” (words by Heinrich Heine) 2. “Oh! Sonnenschein” Biography 11

3. “Durch den Wald” 4. “Ave Maria” 5. “Sonnenscheinlied” (words by Bjørnstjerne Bjørnson) 6. “Frühlingsanbruch” (words by Bjørnstjerne Bjørnson) IV/2, 3, 4 Three Unaccompanied Part-Songs for Mixed Voices 1907–1908 1. “On Craig Ddu” (words by Arthur Symons) 2. “Wanderer’s Song” (words by Arthur Symons) 3. “Midsummer Song” (words unattributed) IV/5 To Be Sung of a Summer Night on the Water for mixed voices 1917 IV/6 The Splendour Falls on Castle Walls for chorus, men’s chorus (words by Alfred, Lord Tennyson) 1923

V Songs with PianoforteAccompaniment

V/1 “When Other Lips Shall Speak” c. 1880 V/2 “Over the Mountains High” (words by Bjørnstjerne Bjørnson) 1885 V/3 “Zwei bräune Augen” (words by Hans Christian Andersen) 1885 V/4 “Der Fichtenbaum” (words by Heinrich Heine) 1886 V/5 Fünf Lieder (aus dem Norwegischen) = Five Songs (from the Norwegian) 1888 1. “Der Schlaf” = “Slumber Song” (words by Bjørnstjerne Bjørnson) 2. “Sing, Sing” = “The Nightingale” 3. “Am schönsten Sommerabend war’s” = “Summer’s Eve” (words by John Paulsen) 4. “Sehnsucht” = “Longing” (words by Theodor Kjerulf) 5. “Beim Sonnenuntergang” = “Sunset” (words by Andreas Munch) V/6 “Hochgebirgsleben” (words by Henrik Ibsen) 1888 V/7 “O schneller mein Ross” = “Plus vite mon cheval” (words by Emmanuel Geibel) 1888 V/8 “Chanson [de] Fortunio” (words by Alfred de Musset) 1889 V/9 Sieben Lieder (aus dem Norwegischen) = Seven Songs (from the Norwegian) 1889–1890 1. “Wiegenlied” = “Cradle Song” (words by Henrik Ibsen) 2. “Auf der Reise zur Heimat” [later: Heimkehr] = “The Homeward Journey” (words by A. O. Vinje) 3. “Abendstimmung” = “Evening Voices” [later: Twilight Fancies] (words by Bjørnstjerne Bjørnson) 4. “Kleine Venevil” = “Sweet Venevil” (words by Bjørnstjerne Bjørnson) 5. “Spielleute” [later: Spielmann] = “Minstrel” (words by Henrik Ibsen) 6. “Verborg’ne Liebe” = “Love Concealed” (words by Bjørnstjerne Bjørnson) 7. “Eine Vogelweise” = “The Bird’s Story” (words by Henrik Ibsen) V/10 “Skogen gir susende langsom besked” (words by Bjørnstjerne Bjørnson) 1890–1891 12 Frederick Delius: A Research and Information Guide

V/11 Songs (words by Heinrich Heine) 1890–1891 1. “Mit deinen blauen Augen” 2. “Ein schöner Stern geht auf in meiner Nacht” 3. “Hör’ ich das Liedchen klingen”  ³$XVGHLQHQ$XJHQÀLHVVHQPHLQH/LHGHU´ V/12 Three Songs (words by Percy Bysshe Shelley) 1891 1. “Indian Love Song” 2. “Love’s Philosophy” 3. “To the Queen of My Heart” V/13 “Lyse naetter” = “Dreamy Nights” (words by Holger Drachmann) 1891 9 ³-HJKDYGHHQQ\VNDDUHQVHOMHÀ¡MWH´ ZRUGVE\9LOKHOP.UDJ RU 1893 V/15 “Nuages” (words by Jean Richepin) 1893 V/16 Deux mélodies (words by Paul Verlaine) 1895 1. “Il pleure dans mon coeur” 2. “Le ciel est, par-dessus le toit” V/17 “Pagen højt paa taarnet sad” (words by Jens Peter Jacobsen) 1895 V/18 “Traum Rosen” (words by Marie Heinitz) c. 1898 V/19 Lieder nach Gedichten von Friedrich Nietzsche 1898 1. “Nach neuen Meeren” 2. “Der Wanderer” 3. “Der Einsame” 4. “Der Wanderer und sein Schatten” V/20 “Im Glück wir lachend gingen” (words by Holger Drachmann) 1898 V/21 Two Songs from the Danish (words by Ludvig Holstein) 1900 1. “The Violet” 2. “Autumn” V/22 “Schwarze Rosen” = “Black Roses” (words by Ernst Josephson) 1901 V/23 “Jeg hører i natten” = “I Hear in the Night” (words by Holger Drachmann) 1901 V/24 “Summer Landscape” (words by Holger Drachmann) 1902 V/25 “The Nightingale Has a Lyre of Gold” (words by W. E. Henley) 1910 V/26 “La lune blanche” (words by Paul Verlaine) 1910 V/27 “Chanson d’automne” (words by Paul Verlaine) 1911 V/28 “I-Brasîl” (words by Fiona Macleod []) 1913 V/29 Two Songs for Children 1913 1. “Little Birdie” (words by Alfred, Lord Tennyson) 2. “The Streamlet’s Slumber Song” (words unattributed) V/30 Four Old English Lyrics 1915–1916 1. “It Was a Lover and His Lass” (words by William Shakespeare) 2. “So White, So Soft, So Sweet Is She” (words by Ben Jonson) 3. “Spring, the Sweet Spring” (words by Thomas Nashe) 4. “To Daffodils” (words by Robert Herrick) V/31 “Avant que tu ne t’en ailles” (words by Paul Verlaine) 1919 Biography 13

VI Works for Orchestra

VI/1 Florida [suite] 1887 VI/2 Hiawatha [tone poem] 1888 9, 5KDSVRGLVFKH9DULDWLRQHQ>XQ¿QLVKHG@ VI/4 Three Pieces for String Orchestra 1888 [lost] VI/5 Idylle de Printemps 1889 VI/6 Suite d’orchestre 1889–1890 1. Marche [Caprice] 2. La Quadroöne (Rapsodie Floridienne) 3. Berceuse 4. Scherzo 5. Thème et Variations VI/7 Drei symphonische Dichtungen = Three Small Tone Poems 1890 1. Sommer Abend = Summer Evening 2. Winter Nacht [Schlittenfahrt] = Winter Night [Sleigh Ride] 3. Frühlings Morgen = Spring Morning VI/8 A l’amore [incomplete; surviving portion of orchestral work] VI/9 Petite suite d’orchestre 1890 1. Allegro ma non troppo 2. Con moto 3. Allegretto VI/10 Paa Vidderne = On the Mountains [tone poem] 1890–1892 VI/11 Over the Hills and Far Away 1893 [1897?] VI/12 Appalachia: American Rhapsody for Orchestra 1896 VI/13 La ronde se déroule [tone poem] 1899 VI/14 Paris: Ein Nachtstück (The Song of a Great City) 1899 VI/15 Lebenstanz = Life’s Dance [tone poem] 1901 VI/16 Brigg Fair: An English Rhapsody 1907 VI/17 In a Summer Garden 1908 VI/18 A Dance Rhapsody [no. 1] 1908 VI/19 Two Pieces for Small Orchestra 1. On Hearing the First Cuckoo in Spring 1912 2. Summer Night on the River 1911 VI/20 North Country Sketches 1913–1914 1. Autumn (The Wind Soughs in the Trees) 2. Winter Landscape 3. Dance 4. The March of Spring (Woodlands, Meadows and Silent Moors) VI/21 Air and Dance 1915 VI/22 A Dance Rhapsody [no. 2] 1916 VI/23 Eventyr (Once Upon a Time) 1917 VI/24 A Song before Sunrise 1918 VI/25 Poem of Life and Love 1918 14 Frederick Delius: A Research and Information Guide

VI/26 1929 VI/27 Irmelin Prelude 1931 VI/28 Fantastic Dance 1931

VII Works for Solo Instrument(s) and Orchestra

VII/1 [Suite] for violin and orchestra 1888 VII/2 Légendes (Sagen) for piano and orchestra 1890 VII/3 Légende for violin and orchestra 1895 VII/4 Piano Concerto 1897 (rev. 1904, 1907, 1909) VII/5 Concerto for violin, violoncello and orchestra 1915 VII/6 1916 VII/7 Violoncello Concerto 1921 VII/8 Caprice and Elegy for violoncello and chamber orchestra 1930

VIII Chamber Music

VIII/1 [String Quartet] 1888 VIII/2 Romance for violin and piano 1889 VIII/3 Sonata, B major 1892 VIII/4 [String Quartet] 1893 VIII/5 Romance for violoncello and piano 1896 VIII/6 Sonata no. 1 for violin and piano 1914 VIII/7 Sonata for violoncello and piano 1916 VIII/8 String Quartet 1916 1. With animation 2. Quick and lightly 3. Late Swallows (also arr. for string orchestra by Eric Fenby, 1963) 4. Very quick and vigorously VIII/9 Sonata no. 2 for violin and piano 1923 (arr. for viola and piano by Lionel Tertis, 1932) VIII/10 Sonata no. 3 for violin and piano 1930 (arr. for viola and piano by Lionel Tertis, 1932)

IX Piano Solo

IX/1 Zum Carnival Polka 1885 IX/2 Pensées mélodieuses 1885 IX/3 Norwegischer Schlittenfahrt = Norwegian Sleigh Ride 1887 IX/4 Badinage [undated] IX/5 [Two Piano Pieces] 1890 1. “Valse” ³5HYHULH´ XQ¿QLVKHG IX/6 Dance for Harpsichord 1919 Biography 15

IX/7 Five Piano Pieces 1923 1–2. “ and Waltz for a Little Girl” 3. “Waltz” 4. “Lullaby for a Modern Baby” 5. “Toccata” IX/8 Three Preludes 1923 1. “Scherzando” 2. “Quick” 3. “Con moto”

X Appendix

(i) Arrangements, collaborated works, etc. 1. Swedish folk songs arranged by Delius, 1888 2. Aus dem Volksleben (Edvard Grieg) orchestrated by Delius, 1889 3. Small piece composed jointly by Grieg, Christian Sinding, Delius, 1890 [lost] 4. Anatomie et Physiologie de l’Orchestre written by Papus [Dr. Gérard Encausse] and Delius, 1894 [literary pamphlet] 5. Ten pièces pour le piano, op. 3 (Zoltán Kodály) and Two Román Tanc, op. 8a (Béla Bartók) both have “rev. par Frédéric Delius” on printed editions; Delius’s name was used as reviser only to establish foreign copyright.

(ii) Notebooks, sketches, etc. 1. Notebook I (location: Jacksonville University) 2. Notebook II (location: Grainger Museum, Melbourne) 3. Notebook III (location: Delius Trust) 4. “Larger small sketchbook” (location: Grainger Museum) 5. “Smaller small sketchbook” (location: Grainger Museum) 6. Miscellaneous sketch-sheets, drafts, etc. (Delius Trust)

II Bibliography

SOURCE MATERIALS

Writings and Correspondence

Writings

1. Delius, Frederick. “At the Cross-Roads.” The Sackbut 1, no. 5 (1920): 205–208. Reprint, Delius Society Newsletter no. 33 (1972): 17–21; “The Present Cult: Charlatanism and Humbug in Music.” British Musician and Musical News (November 1929): 304–307, and in Redwood, Christopher. A Delius Companion (see no. 59), pp. 37–43. Delius gives his views on contemporary music. The reprint in A Delius Companion (see no. 59) includes a postscript taken from the Daily Telegraph, London (5 October 1929).

2. Delius, Frederick. “Musik in England im Kriege.” Musikblätter des Anbruch 1, no. 1 (1919): 18–19. English translation by Lionel Carley, “Music in England During the War,” Delius Society Newsletter no. 32 (1971): 6; and in Carley, Lionel, ed. Delius, a Life in Letters (see no. 10), pp. 207–208. Delius gives his impressions of musical life in England while taking refuge there during the war.

3. Delius, Frederick. “Recollections of Strindberg.” The Sackbut 1, no. 8 (1920): 353–354. Reprint in Heseltine, Philip. Frederick Delius (see no. 854), pp. 49–52, and in Smith, John Boulton. Frederick Delius and

17 18 Frederick Delius: A Research and Information Guide

Edward Munch: Their Friendship and Their Correspondence (see no. 14), pp. 32, 41, 174–175. Recalls his friendship with the artist.

4. Delius, Frederick. “Success: A Great Composer’s Philosophy.” Delius Society Journal no. 132 (2002): 106. First published Liverpool Post (September 1929). 'HOLXVGH¿QHVVXFFHVVDV³WKHVDWLVIDFWLRQRIP\RZQFRQVFLHQFHDIWHU that, the comprehension of those few who are thoroughly in sympathy with my aims, and, a long way after, the applause of the crowd.”

5. Delius, Frederick. “Vorwort.” In Der weisse Neger: ein Leben zwischen den Rassen, edited by James Weldon Johnson. Frankfurt am Main: Frankfurter Societät-Druckerei, 1928. PS 3519.O2625 A813 1928. Reprint of the introduction with English translation by Jeff Driggers, Delius Society Journal no. 126 (1999) pp. 23–29 (see no. 301). Delius wrote the foreword for the German translation of the 1927 English-language edition of Johnson’s book.

6. Delius, Frederick, and Papus [Gérard Encausse]. Anatomie et physiologie de l’orchestre. Paris: Chamuel, 1894. 24 p. MT 70.D45. Papus was the pseudonym of Dr. Gérard Encausse (1865–1916), whom Delius met in Paris. Delius’s contribution to this pamphlet on the orchestra was probably minimal. In French.

Reprints of Delius’s Writings in General Anthologies

7. “Frederick Delius 1862–1934.” In Composers on Music: An Anthology of Composers’ Writings from Palestrina to Copland, edited by Sam Morgenstern, pp. 319–323. New York: Pantheon, 1956. Reprint, New York: Bonanza, 1956; London: Faber, 1958; Westport, Conn.: Greenwood Press, 1969. ISBN 0394496698. ML 90.M6. Includes two selections: “The State of Music Today” (from The Sackbut [see no. 1]) and “The Future of Opera” (an interview excerpted from Clare Delius’s book [see no. 849]).

8. “Frederick Delius 1862–1934.” In Composers on Music: Eight Centuries of Writings, edited by Josiah Fisk, pp. 195–198. Boston: Northeastern University Press, 1997. ISBN 1555532780. ML 90.C77 1997. Quotes from letters to , , and Philip Heseltine; an interview with G. M. Stevensen Reece (from Clare Bibliography 19

Delius’s book [see no. 849]); and Delius’s article “At the Cross-Roads” (The Sackbut [see no. 1]).

9. “Frederick Delius in The Sackbut 1920.” In Words About Music: An Anthology, edited by John Amis and Michael Rose, pp. 390–391. London: Faber and Faber, 1989. Also published: New York: Paragon House, 1992. ISBN 0571147488. PN 6084.M8 W67 1989. One excerpt from Delius’s article “At the Cross-Roads.”

Correspondence

Compilations 10. Carley, Lionel, ed. Delius, a Life in Letters. 2 vols. London: Scolar Press, 1983–1988. Also published: Cambridge, Mass.: Harvard University Press, 1983–1988. ISBN 0674195701. ML 410.D35 A4 1984. A compilation of over 600 letters from the several thousand housed in the Delius Trust Archives. Letters not originally in English have been translated by the editor and explanatory material has been added between the letters. Includes many illustrations, appendices, bibliography, and indexes. Published in association with the Delius Trust.

11. Carley, Lionel, ed. Grieg and Delius: A Chronicle of Their Friendship in Letters. London: M. Boyars, 1993. 226 p. ISBN 0714529613. ML 410. G9 A4 1993. A collection of correspondence between Norwegian composer Edvard Grieg and Delius. Almost all of the letters from Grieg to Delius are extant, but few of the Delius to Grieg letters survive. These letters are located in the Delius Trust Archive and the Grieg Collection of the Bergen Public Library Music Department, respectively. Most of the letters were originally written in German, and appear in translation by the editor. Approximately two-thirds of the letters are printed here for WKH¿UVWWLPH

12. Montgomery, Robert and Robert Threlfall. Music and Copyright: The Case of Delius and His Publishers. Aldershot, Hampshire, England: Ashgate, 2007. xii, 410 p. ISBN 9780754657467. ML410.D35 M66 2007. Covers Delius’s business relationships with his publishers during his lifetime plus the time period after his death when the Delius Trust (as legal representative of his estate) took over responsibility for copyright administration and music promotion. An introductory chapter explains the complicated copyright situation that Delius’s works fall under, with 20 Frederick Delius: A Research and Information Guide

the bulk of the book given over to the extant correspondence between Delius and his publishers. Letters originally in another language have been translated to English. Includes indexes and bibliography.

13. Smith, Barry. Frederick Delius and Peter Warlock: A Friendship Revealed. Oxford: , 2000. xxii, 542 p. ISBN 0198167067. ML 410.D35 A4 2000. A collection of correspondence between Delius and the composer Philip Heseltine. The correspondence spans the years 1911–1930, and currently resides in the . Letters from both correspondents have been preserved. Includes commentary, references, a list of Heseltine’s arrangements and translations of Delius’s works, a list of the works performed at the 1929 Delius Festival, select bibliography, index, and fourteen black-and-white illustrations.

14. Smith, John Boulton. Frederick Delius and Edvard Munch: Their Friendship and Their Correspondence. Rickmansworth, Hertfordshire, England: Triad Press, 1983. 192 p. ISBN 0902070266. ML 410.D35 S6 1983. Contains the complete correspondence between Delius and Norwegian painter Edvard Munch (1863–1944). The correspondence spans the years 1899–1934, and has been translated into English. Appendices include the entire text of Delius’s article “Recollections of Strindberg” (originally published in The Sackbut [see no. 3]), and a list of Munch prints in Delius’s possession (prepared from the inventory made at the time of Delius’s death, with additional information provided by Eric Fenby). Illustrations (including Munch’s drawings of Delius), bibliography, and index complete the volume.

15. Wilson, Jane. C. W. Orr, The Unknown Song-Writer: Including the Complete Delius–Orr Correspondence. London: Thames, 1989. 90 p. ML 410.O75 W52 1989. A study of the English composer and Delius admirer Charles Wilfred Orr (1893–1976) based on the author’s dissertation at the University of Adelaide. Fourteen holographic letters spanning the years 1916–1921 from Orr to Delius survive, but unfortunately none of the letters from Delius to Orr survive. The letters, now housed at the Delius Trust Archive, are discussed in a brief chapter and are reprinted in their entirety in an appendix. Includes bibliography and index. Bibliography 21

SELECTED LETTERS

16. “Frederick Delius.” In Letters of Composers: An Anthology, edited by Gertrude Norman and Miriam Lubell Shrifte, pp. 309–310. New York: Knopf, 1946. Also published: New York: Grosset and Dunlap, 1946. Reprint, Westport, Conn.: Greenwood Press, 1979. ML 90.N67 1946. Includes one letter from Delius to Ethel Smyth, dated 15 March 1909. This letter also appears in Delius: A Life in Letters (see no. 10).

17. “Frederick Delius 1862–1934.” In Composers’ Letters, edited by Jan Fielden, pp. 133–141. London: Marginalia Press, 1994. ISBN 1874572755. ML 90.C65 1994. Also issued as audiobook: Naxos NA203012-NA203022. (CD). 1995. Includes seven Delius letters: three each from Frederick Delius to Edvard Grieg and , and one letter from Jelka Delius to Rose Grainger (Percy’s mother). The letters from Delius to Grieg also appear in Delius: A Life in Letters (see no. 10). Includes brief introductory material.

18. Demény, János, ed. Béla Bartók Letters. London: Faber and Faber, 1971. 466 p. Also published: Budapest: Corvina, 1971; New York: St. Martin’s, 1971. ISBN 0571096387. ML 410.B26 A42. English translations of the six known letters from composer Béla Bartók (1881–1945) to Delius. The correspondence, originally written in German, dates from June 1910 to July 1911. These letters also appear in Delius: A Life in Letters (see no. 10).

19. Dreyfus, Kay, ed. The Farthest North of Humanness: Letters of Percy Grainger. South Melbourne: Macmillan, 1985, xxvi, 542 p. Also published: St. Louis, Mo.: MMB, 1985. ISBN 0333380851. ML 410. G75 A4 1985. Contains eight letters written to Delius around 1907–1914.

20. Foreman, Lewis, ed. From Parry to Britten: British Music in Letters 1900–1945. London: B. T. Batsford, 1987. Also published: Portland, Or.: Amadeus, 1987. ISBN 0713455209. ML 90.F67 1987. Five letters written by Frederick and three letters written by Jelka Delius appear in this anthology. Three letters received by Frederick are also included. The correspondence is chronologically arranged, and the book includes a list of sources and copyright owners, biographies and an index of correspondents, and a general index. 22 Frederick Delius: A Research and Information Guide

21. Gillies, Malcolm, and David Pear, eds. The All-Round Man: Selected Letters of Percy Grainger, 1914–1961. Oxford: Clarendon, 1995. 301 p. ISBN 0198163770. ML 410.G75 A4 1994. Contains one letter to Delius (1922) that does not appear in Delius: A Life in Letters (see no. 10).

22. Benestad, Finn, ed. “To Frederick Delius.” In Edvard Grieg: Letters to Colleagues and Friends, pp. 212–213. Columbus, OH: Peer Gynt Press, 2000. ISBN 0964523825. ML 410.G9 A4 2000. Includes two letters from the Norwegian composer Edvard Grieg to Delius, both written in 1888. The reader is referred to Delius: A Life in Letters (see no. 10) for additional correspondence between the two composers.

23. Moore, Jerrald Northrop, ed. Edward Elgar: Letters of a Lifetime. Oxford: Oxford University Press, 1990. xviii, 524 p. ISBN 0193154722. ML 410.E41 A4 1990. Includes four letters from Edward Elgar to Delius (and two from Delius to Elgar) and a reprint of Elgar’s Daily Telegraph, London, article recounting his visit with Delius in Grez.

24. Moore, Jerrald Northrop, ed. Music and Friends: Seven Decades of Letters to . London: H. Hamilton, 1979. 207 p. ISBN 0241101786. ML 422.B79 A4 1979. Contains three letters from Delius to the conductor Sir Adrian Boult (1889–1983) and one letter from Boult to Delius. Three of the letters also appear in Delius: A Life in Letters (see no. 10).

25. Oelmann, Klaus Henning, ed. Der Briefwechsel mit dem Hause Breitkopf und Härtel, die Briefe von Frederick Delius an Nina und Edvard Grieg und andere ausgewählte Schreiben. Deutsche Hochschulschriften. Egelsbach: Hänsel-Hohenhausen, 1997. 158 p. ISBN 3826711238. ML 410.G9 A4 1997. Thirty-seven letters between the Deliuses and the Griegs are reprinted in this collection of correspondence by Edvard Grieg; the majority of the letters are from Frederick Delius to Edvard Grieg.

26. Rittmann, Annegret, ed. Briefe Ida Gerhardi, 1862–1927: Eine west- fälische Malerin zwischen Paris und Berlin. Munster: Ardey-Verlag, 1993. 376 p. ISBN 3870230363. Bibliography 23

This collection includes twenty letters between the Deliuses and artist Ida Gerhardi (1862–1927). Some of the letters appear in English translation in Delius: A Life in Letters (see no. 10). Gerhardi was an early friend of Jelka in Paris, as well as spending some of her time at Grez-sur-Loing. Includes a color plate of Ida’s 1912 portrait of Frederick.

Collected Edition of the Works of Frederick Delius

27. Delius, Frederick. Frederick Delius, Complete Works. 33 vols. Edited by Sir Thomas Beecham and Robert Threlfall. London: Delius Trust, 1951–1993. ISBN 0950265373. M 3.D35. 7KHFROOHFWHGZRUNVHGLWLRQZDVLVVXHGLQWKLUW\WKUHHYROXPHVDQG¿YH supplementary volumes, and is arranged by genre (see Tables 2.1–2.9). The editorial report was issued separately (see no. 28), and contains the history and background for the collected edition, as well as critical commentary for all the volumes in the edition.

28. Threlfall, Robert. Frederick Delius, Complete Works. London: Delius Trust, 1990. 228 p. ISBN 0950265365. ISMN M060087707. ML 410. D35 F7 1990. Editorial report. ISMN M-060-08260-3 M-060-08167-5 M-060-08807-0 M-060-07930-6 M-060-07938-2 M-060-07452-3 M-060-07476-9 M-060-08549-9 (B&H) Date Publisher 1990 B&H 1991 Boosey & Hawkes 1988 B&H 19851988 B&H B&H Editor T. Beecham T. T. Beecham T. T. Beecham/E. FenbyT. 1990 B&H N. Del Mar Beecham T. E. Fenby Beecham/E. FenbyT. 1989 B&H T. Beecham/E. FenbyT. 1991 B&H Irmelin Hassan Folkeraadet The Magic Fountain Romeo and Village A Juliet la Rouge Margot and Gerda Fennimore Koanga Dramatic Works Volume NumberVolume Title 1 8 7 2 4 5 6 3 Table 2.1 Table ISMN M-060-08246-7 M-060-08513-8 M-060-07919-1 M-008-04107-5 M-008-04109-9 M-060-07941-2 M-060-08245-0 M-060-07939-9 M-060-07940-5 Publisher (B&H) 18446 B&H B&H B&H Date Editor T. BeechamT. ed. 1990 Rev. Boosey & Hawkes T. BeechamT. ed. 1988 Rev. B&H T. BeechamT. ed. 1994 Rev. B&H T. BeechamT. ed. 1987 Rev. (UE) T. BeechamT. ed. 1985 Rev. UE 17988 T. BeechamT. 1988 T. BeechamT. ed. 1990 Rev. B&H E. Fenby 1988 E. Fenby 1988 Appalachia Sea Drift A Mass of Life A Songs of Sunset The Song of the High Hills An Arabesque Requiem Songs of Farewell Prelude and Idyll Prelude Works for Voices and Orchestra Voices for Works Volume NumberVolume Title 9a 9b 10 11a 11b 12a 12b 13a 13b Table 2.2 Table M-060-08249-8 M-060-07759-3 M-060-08166-8 ISMN (B&H) 1987 B&H Date Publisher R. Threlfall 1990 B&H T. Beecham/ T. E. Fenby E. Fenby 1987 Stainer & Bell (S&B) M-2202-0547-7 R. ThrelfallR. 1988 Boosey & Hawkes Editor Maud Tennyson’s Settings from “Birds in the High Hall-Garden” a Mile” Walking “I Was “Go Not, Happy Day” “Rivulet Crossing My Ground” “Come into the Garden, Maud” “Silken Shoes” “Irmelin Rose” “The Seraglio Garden” Sakuntala “The Violet” Cynara Late Lark A Songs with orchestra, part 2 “Twilight Fancies” “Twilight Story” “The Bird’s “Summer Nights” “Summer Landscape” Roses” “Wine Years” “Through Long, Long “Let Springtime Come” Songs with orchestra, part 1 Paa Vidderne Works for Solo Voice and Orchestra Voice for Solo Works 16 15b 15a 14 Volume NumberVolume Title Table 2.3 Table M-060-07942-9 ISMN (B&H) 1992 Thames/Elkin R. Threlfall/L. Carley R. ThrelfallR. 1988 Boosey & Hawkes Editor Date Publisher Six Early Part Songs “Durch den Wald” “Durch den “An den Sonnenschein” Maria” “Ave “Sonnenscheinlied” “Frühlingsanbruch” “Her ute skal gildet staa” Part Songs “On Craig Ddu” Song” “Wanderer’s “Midsummer Song” be Sung of a Summer Night on the “To Water” Walls” “The Splendour Falls on Castle Songs for Children” “Two Works for Unaccompanied Voice for Unaccompanied Works 17 Suppl. 17 Volume NumberVolume Title Table 2.4 Table M-008-03999-7 M-060-07765-4 M-2202-0548-4 ISMN Universal Edition (UE) 17428 Press (OUP) 0-19- 345287-1 (B&H) Stainer & Bell (S&B) B659 Publisher 1981 1988 Date E. Fenby ed. 1987 Corr. Oxford University R. ThrelfallR. ed. 1987 Corr. Boosey & Hawkes R. Threlfall/A. Percival Editor words by Scandinavian poets 7 Songs from the Norwegian 3 songs (Shelley) 4 songs (Verlaine) 5 songs (various poets) Nineteen Songs 5 Songs from the Danish 5 Songs from Lieder nach Gedichten Nietzsche von Fr. 4 Old English Lyrics que tu ne t’en ailles” “Avant Appendix: 2 songs Sixteen Songs Twenty-two Songs Twenty-two 12 songs hitherto uncollected the Norwegian 5 Songs from the Danish 5 Songs from Songs with Pianoforte Accompaniment Songs with Pianoforte 18a/b, 19 Suppl. Four posthumous songs to 19 18b 18a Volume NumberVolume Title Table 2.5 Table ISMN M-060-08322-8 M-2202-0532-3 M-060-08165-1 M-060-08247-4 M-008-03864-8 Publisher (B&H) Stainer & Bell (S&B) B782 B&H G. Schirmer(GS) 81382 Universal Edition (UE) 19162 Date Editor T. BeechamT. ed. 1986 Rev. Boosey and Hawkes T. BeechamT. 1989 T. BeechamT. ed. 1989 Rev. B&H R. ThrelfallR. ed. 1992 Rev. B&H 9021 M-060-09021-9 T. BeechamT. 1990 T. BeechamT. 1990 T. BeechamT. 1988 Florida Early Orchestral Works I Works Early Orchestral Marche Caprice Marche Summer Evening Early Orchestral Works II Works Early Orchestral Sleigh Ride Spring Morning Early Orchestral Works III Works Early Orchestral Idylle de Printemps La Quadroöne Scherzo On the Mountains American Rhapsody Over the Hills and Far Away Over the Hills and Far Paris Works for Orchestra Works Volume NumberVolume Title 20 21a 21b 21c 22 23a 23b Table 2.6 Table ISMN M-008-03865-8 M-008-04189-1 M-008-04192-1 M-060-07766-1 Publisher S&B B676 M-2202-0536-1 S&B B661 M-2202-0539-2 S&B B677 M-2202-0543-9 B&H Date 1988 1987 Editor E. Fenby T. BeechamT. ed. 1989 Rev. UE 19241 T. BeechamT. ed. 1988 Rev. UE 18807 T. BeechamT. ed. 1988 2nd rev. UE 18811 T. BeechamT. 1986 T. BeechamT. 1988 T. Beecham/E. T. Fenby Life’s Dance Life’s Brigg Fair In a Summer Garden Dance Rhapsody no. 1 North Country Sketches Dance Rhapsody no. 2 Eventyr Three Pieces for Small Orchestra On Hearing the First Cuckoo in Spring Summer Night on the River Sunrise Song before A Miscellaneous Orchestral Works Miscellaneous Orchestral Air and Dance Aquarelles Two Song of Summer A Irmelin Prelude Fantastic Dance Works for Orchestra (continued) Works Volume NumberVolume Title 24a 24b 25a 25b 26 27a 27b Table 2.6 Table M-2202-0526-2 M-060-07531-5 M-060-08323-5 M-060-07439-4 ISMN Stainer & Bell (S&B) B648 B&H B&H Boosey & Hawkes (B&H) Publisher T. BeechamT. 1985 E. Fenby 1985 R. ThrelfallR. 1985 Editor Date Double Concerto Concerto Violin Caprice and Elegy Piano Concerto Beecham T. ed. 1990 Rev. Suite Légende for violin and orchestra Works for Solo Instrument(s) and Orchestra Works 30 29b 29a 28 Volume NumberVolume Title Table 2.7 Table M-2202-0551-4 ISMN M-2202-2959-7 M-060-08770-7 M-060-07530-8 M-060-07754-8 Date Publisher 1986 B&H Editor E. Fenby 1984 Stainer & Bell (S&B) H237 R. ThrelfallR. 1987 BeechamT. Boosey & Hawkes (B&H) M-060-07753-1 1986 B&H R. ThrelfallR. Threlfall 1999 1988 S&B B&H *T. Beecham/**E. *T. Fenby ** String Quartet Early Works for Violin and Violin for Works Early Piano Romance Sonata in B Légende Violin Three for and Piano Early String Quartet (1888) for Piano Solo, etc. Works Dance for Harpsichord 5 Piano Pieces 3 Preludes Appendix: Early works, fragments, etc. Works for Cello and Piano Works Romance Sonata* Caprice and Elegy Chamber Music and Piano Solo 32 Volume NumberVolume Title 31a 32 suppl.33 Movements from the Two 31b 31c Table 2.8 Table ISMN M-060-11963-7 M-060-10713-9 M-060-10674-3 M-060-10628-6 M-060-10627-9 Editor Date Publisher R. Threlfall 2008 B&H R. Threlfall 1999 B&H R. Threlfall 1997 B&H R. Threlfall 1997 B&H R. Threlfall 1997 B&H R. ThrelfallR. 1992 Boosey & Hawkes (B&H) M-060-10482-4 Hiawatha Scandinavian Texts Early Versions of Songs to Versions Early 8Q¿QLVKHG:RUNVLQ Form Variation Rhapsodic Variations Légende Rhapsody movement version) Piano Concerto (3 Two Early Suites Grieg Two Orchestration Poem of Life and Love for two pianos (arr. by Balfour Gardiner; completed by Fenby) Supplement 6 5 4 3 Supplement Volume NumberSupplement Volume Title 2 1 Table 2.9 Table 34 Frederick Delius: A Research and Information Guide

CATALOGS

29. Cowan, Robert. Frederick Delius. London: Boosey and Hawkes/Delius Trust, 1999. 39 p. ISMN M060018152. Publisher’s catalog. Contains a short introduction (in English, French, and German), chronology, and a list of Delius’s works arranged by genre. Information given in the list of works includes the date of composition, RUFKHVWUDWLRQ ODQJXDJH WH[W VRXUFH ¿UVW SHUIRUPDQFH ,QWHUQDWLRQDO Standard Music Number (ISMN), and the volume number of the collected edition. A separate chronological list of works is also given, as well as a list of volumes in the collected edition (including volume editor and ISMN) and a list of books about Delius available through Boosey and Hawkes.

30. Lowe, Rachel. A Descriptive Catalogue with Checklists of the Letters and Related Documents in the Delius Collection of the Grainger Museum, University of Melbourne, Australia. London: Delius Trust, 1981. v, 233 p. ISBN 0920265322. ML 134.D285 L68 1981. An inventory of correspondence and related documents housed in the Delius Collection of the Grainger Museum. Appendices include information about Percy Grainger’s footnotes and marginalia, related documents found with the letters, and a list of news clippings from the Grainger collection concerning matters discussed in the correspondence.

31. Lowe, Rachel. Frederick Delius, 1862–1934: A Catalogue of the Music Archive of the Delius Trust, London. London: Delius Trust, 1974. 182 p. ISBN 085162023X. ML 134.D293 L7. A catalog of manuscripts held in the Delius Trust music archive. Gives a description of each manuscript, notes, and links to other works. Appendices include the orchestral details of unpublished scores, a concordance of the vocal scores of Margot la Rouge and Idyll, an explanation of the editions of Hassan, a list of Delius’s published music (prepared by Robert Threlfall), translations of three articles from Verdens Gang, October 1897 (prepared by Lionel Carley), a list of printed music received by the trust as part of the original accession, and a list of manuscripts not presently held by the trust (prepared by Robert Threlfall). An updated edition of the catalog was issued in 1986 (see no. 32).

32. Lowe, Rachel. Frederick Delius 1862–1934: A Reprint of the Catalogue of the Music Archive of the Delius Trust (1974) with Minor Corrections. Corrected reprint ed. London: Delius Trust, 1986. 183 p. ML 134.D293 L7 1986. Bibliography 35

An updated edition of the 1974 catalog (see no. 31).

33. Threlfall, Robert. A Catalogue of the Compositions of Frederick Delius: Sources and References. London: Delius Trust, 1977. 206 p. ISBN 0851620280. ML 134.D293 T5. This authoritative listing of Delius’s compositions was compiled primarily from manuscript sources. Arranged by genre, each entry contains information on the work’s title, date, dedication, key, compass (for solo songs), instrumentation, manuscript, publication, performance, text source, and miscellaneous notes. Durations and thematic incipits are not included. A list of abbreviations and references, thirty-one plates FKLHÀ\ RI PDQXVFULSWV LQ 'HOLXV¶V RZQ KDQG  OLVWV RI DUUDQJHPHQWV collaborated works and notebooks/sketches, a conspectus of Delius’s principal compositions, and index round out the volume.

34. Threlfall, Robert. A Check-list of Printed Editions of the Stage Works by Frederick Delius. London: Delius Trust, 2002. 48 p. ISBN 0952306719. A detailed list of original and revised editions of Delius’s six operas plus Folkeraadet and Hassan. Includes eight illustrations, mostly of title pages or covers.

35. Threlfall, Robert. Frederick Delius: A Supplementary Catalogue. London: Delius Trust, 1986. 252 p. ISBN 0950265349. ML 134.D36 T531 1986. Part one of this book serves as an update to the author’s 1977 catalog (see no. 33). There are page references to the 1977 work and clear markings to indicate changed or new material. Part two is a supplement to Rachel Lowe’s Catalogue of the Music Archive of the Delius Trust (1974) (see no. 31), covering the trust’s post-1974 acquisitions. An appendix contains a list of principal manuscripts of Delius works known to exist in collections outside of the Delius Trust, and a list of principal autographs whose location or survival is unknown. Includes musical examples, illustrations, and an index.

COLLECTIONS

Archives and Museums

36. “Archives and Special Collections.” Royal Northern College of Music. http://www.rncm.ac.uk/content/view/127/151/ (accessed 2 October 2008). 36 Frederick Delius: A Research and Information Guide

The collections contain some Delius works (Violin Sonata no. 1, a paraphrase of “A smiling, a melting, a quivery look” from A Mass of Life, and Légende) and a visitor’s book, signed by Delius and the Fenbys. The visitor’s book was featured as an online exhibition in June 2008 (see no. 100).

37. “Bolling Hall.” Bradford Museums Galleries and Heritage. http://www. bradfordmuseums.org/bollinghall/index.htm (accessed 20 October 2008) Bolling Hall is a historic house in Bradford that now serves as a museum of Bradford’s heritage. The museum contains the “Delius Room,” which features a piano owned by the Delius family, and a bust and portrait of the composer. A panoramic view of the room is available through the BBC Bradford and West Yorkshire website (see no. 42)

38. “British Composer Manuscripts.” Bodleian Library. http://www.ouls. ox.ac.uk/bodley/library/specialcollections/western_rarebooks/music (accessed 1 October 2008). Library collection contains various Delius manuscripts.

39. The British Library. http://www.bl.uk (accessed 20 October 2008). The British Library collections include manuscripts, correspondence (among others, the Heseltine letters), images, and festival program books.

40. “The Delius Collection.” Jacksonville (Florida) Public Library. http:// jpl.coj.net/coll/delius/index.html (accessed 20 October 2008). The Delius Collection can be found at the Main Library, Fine Arts Department. The focus of the collection is on analytical materials rather than primary sources. The collection grew from materials collected by a local Delius enthusiast, Mrs. Martha Bullard Richmond. Mrs. Richmond was also responsible for locating and preserving the cottage at Solano Grove, Delius’s residence while in Florida. The Delius Collection consists of over 400 items. Many of the items have been cataloged with detailed bibliographical records available through the library’s catalog. All formats of materials can be found in the collection, including books, scores, theses and dissertations, issues of the Delius Society Newsletter and Journal, copies of several items held by the Delius Trust, local oral histories (print and recorded), and materials from the Delius Association of Florida and the annual Delius Festival. The collection also includes uncataloged collections of news clippings and audiotapes. Mr. Jeff Driggers serves as curator of the collection. Bibliography 37

41. Delius Letters and Documents. West Yorkshire Archive Service. http:// www.archives.wyjs.org.uk/catalogue.asp?pg=indexhome.htm (accessed 1 October 2008). The West Yorkshire Archive Service collection contains historical documents related to the Delius family. In addition to correspondence, a search of the collection’s catalog yields results for various legal documents regarding the Delius family wool business, wills, property documents, and materials from the Bradford Delius Festival. No online access to images or document contents, however.

42. “Delius Room, Bolling Hall: West Yorkshire in 360°.” BBC Bradford & West Yorkshire. http://www.bbc.co.uk/bradford/360/version2_bolling_ hall_6.shtml (accessed 20 October 2008). A panoramic look at the Delius Room at Bolling Hall (see no. 37).

43. The Delius Trust. http://www.delius.org.uk/g_trust.htm (accessed 20 October 2008). 7KH7UXVWZDVIRUPHGE\DSURYLVLRQLQ-HOND'HOLXV¶VZLOOWKDWVSHFL¿HG proceeds of her estate be used to further Delius’s music in England or elsewhere through recordings, publication of a collected edition of ZRUNVDQG¿QDQFLQJRISXEOLFSHUIRUPDQFHVRIKLVZRUNV The Delius Trust Archive has acquired many manuscripts, photographs, concert programs, and other research materials. The trust has completed LVVXDQFHRIWKHFROOHFWHGHGLWLRQDQGFRQWLQXHVWR¿QDQFHUHFRUGLQJVDQG ¿OPV PRVWQRWDEO\The Fenby Legacy recordings [see D120], and the ¿OPVDiscovering Delius [see no. 1811] and A Village Romeo and Juliet [see nos. 1821–1822]). Current trustees include Martin Williams, David Lloyd-Jones, and William Parker; current advisers to the trust are Robert Threlfall, Lionel Carley, Robert Montgomery, and Helen Faulkner. Dr. Lionel Carley serves the Trust as Archivist, and Marjorie Dickinson serves as secretary. The trust has a Web page that includes information on the history DQGDFWLYLWLHVRIWKHWUXVWDQGDOLVWRIWKHFXUUHQWRI¿FHUVDQGFRQWDFW information.

44. “Frederick Delius.” Jacksonville (Florida) Historical Society. http:// www.jaxhistory.com/journal4.html (accessed 27 August 2008). The Jacksonville Historical Society has a Delius page on its website that includes a brief biographical sketch and pictures of Delius’s house before and after its restoration and subsequent move to the grounds of 38 Frederick Delius: A Research and Information Guide

Jacksonville University. The Society, founded in 1929, also has pages about general Jacksonville history and architecture on this website.

45. “Frederick Delius Collection.” Bradford Libraries, Archives and Information. Central Library. http://www.bradford.gov.uk/information_ and_communication/library_and_information_services/libraries_ archives_and_collections.htm (accessed 1 October 2008). Library collection.

46. The Grainger Museum Archive. Grainger Museum. http://www.lib. unimelb.edu.au/collections/grainger/collection/ (accessed 20 October 2008). The Grainger Museum Archive in Melbourne, Australia, holds a collection of correspondence between the Deliuses and the Graingers. The materials forming the Delius collection have been inventoried by Rachel Lowe in A Descriptive Catalogue with Checklists of the Letters and Related Documents in the Delius Collection of the Grainger Museum, University of Melbourne, Australia (see no. 30). The Percy Grainger Music Collection also contains several Delius works, some of which bear inscriptions by Delius.

47. “Microform Sources for Music: Frederick Delius.” University of York Library & Archives. http://www.york.ac.uk/services/library/ publications/guides/musmicro.htm (accessed 1 October 2008). This microform collection contains archival materials from the Delius Trust (eighteen reels), Delius manuscripts from the Grainger Centre, Melbourne University, and manuscripts (several autograph) from the British Library (Five Piano Pieces, Mazurka, Two Waltzes, Toccata, Lullaby, Fennimore and Gerda, An Arabesk, Requiem, Violoncello Concerto, Dance for harpsichord, excerpts of music from Hassan), and from Stanford University Libraries (Over the Hills and Far Away).

48. The Morgan Library and Museum. http://www.themorgan.org/(accessed 1 October 2008). The Morgan holds several letters and other materials.

49. Swisher Library, Jacksonville University. http://www.ju.edu/library/ default.aspx (accessed 22 October 2008). Jacksonville University is the home of Delius’s restored cottage from Solano Grove. It is open by appointment to campus visitors. The cottage consists of four rooms with donated period furniture. Delius’s Florida piano was found and has been installed at the cottage. Bibliography 39

Swisher Library holds a collection of materials by and about Delius, including the manuscript of Koanga in the hand of Eric Fenby. The Delius collection includes manuscripts, correspondence, books, SURJUDPV D ¿OH RI QHZV FOLSSLQJV YLGHR UHFRUGLQJV LQFOXGLQJ V  and the Delius Society Journal. The collection is also the repository for the Delius Association of Florida. Most materials have bibliographical records available in the library’s catalog.

50. “Delius, Frederick: Papers, 1938–1945.” St. Augustine Historical Society. http://www.staugustinehistoricalsociety.org/index.html (accessed 1 October 2008). Includes correspondence, musical scores, pamphlets, and newspaper FOLSSLQJV¿QGLQJDLGDYDLODEOHLQWKHUHSRVLWRU\RQO\

51. Altman, Burt. “Inventory of the Gloria Jahoda Collection (MSS2004007).” Florida State University Libraries. http://diglib.lib.fsu. HGX¿QGDLGV)7D68SGI DFFHVVHG2FWREHU  Finding aid for the collection located in the Special Collections Department of the Florida State University Libraries. Jahoda, a novelist and Florida historian, wrote The Road to Samarkand: Frederick Delius and His Music (see no. 859). This collection includes background materials, research notes, and manuscript drafts of her book plus radio scripts prepared for WFSU-FM programs about Delius and correspondence.

52. Thompson, Bill. “Music of Frederick Delius.” 18 October 2002. http:// thompsonian.info/delius.html (accessed 20 October 2008). Well indexed and documented, this is a particularly useful major website. ,W FRQWDLQV DUWLFOHV VRXQG ¿OHV OLQNV WR RWKHU 'HOLXV:HESDJHV DQG information about festivals, organizations, books, recordings and scores.

Articles and Essays

53. Delius, 1862–1934. London: Delius Trust, 1984. 24 p. Rev. ed. 1992; 2nd rev. ed. 1998. ML 410.D35 D42. A set of information guides issued by the Delius Trust to mark the ¿IWLHWK DQQLYHUVDU\ RI WKH FRPSRVHU¶V GHDWK &RQWHQWV RI WKH RULJLQDO set include: a biography and select bibliography (by Lionel Carley), a discography (by Stephen Lloyd), a list of works, a list of proposed volumes in the collected works edition, and a calendar of performances and events for the 1984 anniversary year. The revised edition carries the helpful subtitle A Short Guide to His Life and Works, and updates the bibliography, discography, and list of volumes in the collected edition. 40 Frederick Delius: A Research and Information Guide

Several new materials have been added to the revised set: a list of “other publications” (including scores and materials issued by the Delius Trust), contact information for various Delius societies, and a short history of the Delius Trust.

54. “Delius Number.” Tempo, no. 26 (1952–1953): 5–38. Covers the life and music of Delius, plus a description of the Delius Trust.

55. Familienzeitung Delius. Bielefeld, Germany: Familienverbindung Delius. An irregularly issued periodical devoted to the collection of information about persons with the “Delius” surname.

56. Carley, Lionel, ed. Frederick Delius: Music, Art, and Literature. Aldershot, Hants, England: Ashgate, 1998. xviii, 337 p. ISBN 1859282229. ML 410.D35 F74 1998. A collection of twelve essays focusing on the cosmopolitan aspects of 'HOLXV¶VOLIHDQGPXVLF,OOXVWUDWLRQVDUHFKLHÀ\GUDZQIURPWKH'HOLXV Trust collections. Includes index and references.

57. Jones, Philip, ed. The Collected Writings of the German Musicologist Max Chop on the Composer Frederick Delius. Studies in the History and Interpretation of Music. Lewiston, N.Y.: Edwin Mellen Press, 2002. 301 p. ISBN 0773472940. ML 410.D35 C46 2002. Provides English translations along with the original German texts for WKH FULWLF 0D[ &KRS¶V PRVW VLJQL¿FDQW ZULWLQJV RQ 'HOLXV ,QFOXGHV the extant correspondence (in English translation) between Chop and Delius, a list of Chop’s writings and musical compositions, biographical notes on prominent people and organizations in the text, and reprints of Chop’s sixtieth birthday tribute and obituary. Extensive bibliography; illustrated, although not of the highest quality.

58. Lloyd, Stephen, ed. Fenby on Delius: Collected Writings on Delius to Mark Eric Fenby’s Ninetieth Birthday. London: Thames, 1996. 259 p. ISBN 0905210271. ML 410.D35 F42 1996. A collection of Eric Fenby’s articles, transcriptions of broadcasts, and liner notes. The selection is prefaced with introductions by , , and Lyndon Jenkins. The volume is divided into two parts: “Articles and Talks” and “The Works of Delius.” Includes several previously unpublished photographs, a catalog of Fenby’s sound Bibliography 41

recordings, a summary list of his work associated with Delius (music arranged, recorded, or performed, writings, recorded talks), lists of his published musical works and articles, and an index.

59. Redwood, Christopher. A Delius Companion. London: J. Calder, 1976. 270 p. ISBN 0714535265. ML 410.D35 D44. Reprint, New York: Da Capo Press, 1977; rev. ed., New York: Riverrun Press, 1980. A collection of twenty-six essays mostly reprinted from various sources, published as a tribute to Eric Fenby. The articles are a mix of those published during Delius’s lifetime and after. Includes brief biographical notes on the contributors, index, and eighteen illustrations. The 1980 edition is marked “revised edition,” but there are no apparent differences from the original publication.

60. Tadday, Ulrich. Frederick Delius. Munich: Edition Text + Kritik, 2008. 207 p. ISBN 3883779520. ML 410.D34 F6 2008. A collection of ten essays. In German with English abstracts.

Images

61. Brown, Steve. “Frederick Delius (1862–1934).” Find A Grave. http:// ZZZ¿QGDJUDYHFRPFJLELQIJFJL"SDJH JU *5LG  DFFHVVHG 20 October 2008). Provides a brief biographical sketch, information on the cemetery (St. 3HWHUV/LPSV¿HOG DQGGLUHFWLRQVWRWKHEXULDOSORW,QFOXGHVDFORVHXS photograph of the headstone, and a view of the cemetery and church. There is a brief entry (no biographical sketch) for Jelka as well: http:// ZZZ¿QGDJUDYHFRPFJLELQIJFJL"SDJH JU *5LG 

62. “Edward Beach Collection.” Library of Congress. http://lcweb2.loc.gov/ service/music/eadxmlmusic/eadpdfmusic/mu007001_x.pdf (accessed 22 October 2008). Edward Beach was a host of a well-known jazz show in New York City. The collection consists of photographs and portraits of jazz musicians and composers, including Delius.

63. “Frederick Delius (1862–1934), Composer.” National Portrait Gallery. http://www.npg.org.uk/live/search/person.asp?LinkID=mp01244 (accessed 27 August 2008). Information on several Delius-related images in the National Portrait Gallery collection can be found at this website. Some images are 42 Frederick Delius: A Research and Information Guide

available for viewing on the website, including sketches and paintings by .

64. “Gallery of Pictures.” Delius Trust. http://www.delius.org.uk/gallery. htm (accessed 20 October 2008). Collection of images drawn from Delius: A Life in Pictures (see no. 847).

65. “Picture Files.” The Music of Frederick Delius (see no. 52). Contains a collection of various images, including many of the Solano Grove area and Grez-sur-Loing.

66. “A Selection of Delius Inspired Festival Photos.” http://www.tasminlittle. org.uk/bradford/index.htm (accessed 20 October 2008). Features photographs of the festival by Michael Kulas.

67. “West Yorkshire in 360°.” BBC Bradford and West Yorkshire. http:// www.bbc.co.uk/bradford/in_pictures/360/history/index.shtml (accessed 18 October 2008). A collection of panoramic views of Bradford (including the Delius Room, Bolling Hall [see nos. 37, 42]) and surrounding area views.

Sound and Video

68. British Library Sound Archive. British Library. http://www.bl.uk/ collections/sound-archive/cat.html (accessed 20 October 2008). The archive, opened in 1955 as the British Institute of Recorded Sound, became part of the British Library in 1983. The catalog can be searched online, and contains several listings for Delius-related material, ranging from interviews of Sir Thomas Beecham and Eric Fenby to a recording of the Kate Bush song, “Delius (Song of Summer).”

69. “Delius, Frederick (1862–1934).” Naxos.com. http://umn. naxosmusiclibrary.com.floyd.lib.umn.edu/composer/btm.asp? composerid=27155 (accessed 20 October 2008). Provides streaming audio by subscription. Offers recordings from several labels besides Naxos; some recordings (including some of the Beecham recordings) are unavailable for listening because of copyright restrictions. Bibliography 43

70. “Delius, Frederick (Theodore Albert).” Classical Music Library, Alexander Street Press. http://www.alexanderstreetpress.com (by subscription, accessed 20 October 2008). This collection of recordings from a variety of recording labels is searchable in various ways and features playlist options, static URLs, and track-level metadata. CML also includes reference material; the composer reference page includes a short biography and portrait. Interestingly, it provides a “related composers” link that compares Delius with Ernest Chausson, , , and Maurice Ravel (no English composers!).

71. Chandos Records. http://www.chandos.net/default05.asp (accessed 20 October 2008). The Chandos Records website contains audio clips, and downloadable ¿OHVRISURJUDPQRWHV

72. “Downloads.” Tasmin Little. http://www.s230964027.websitehome. co.uk/pages/02_pages/02_set_download.htm (accessed 20 October 2008). Includes several audio clips related to the Delius Inspired Festival organized by Tasmin Little.

73. “Delius, Frederick.” Music Preserved: Rare Recordings about Live Performances. http://www.musicpreserved.org.uk/index.asp (accessed 2 October 2008). A collection of archive recordings of music performances (both on-site and off-air broadcasts). Includes recordings of the Violin Concerto, Fennimore and Gerda, “Suite” from Hassan, North Country Sketches, A Village Romeo and Juliet, Brigg Fair, and A Mass of Life.

74. Hyperion Records. http://www.hyperion-records.co.uk/(accessed 20 October 2008). The Hyperion Records website offers audio clips, track-level metadata; rolling the mouse over certain areas of the screen provides snippets of reviews, and program notes.

75. “Delius, Frederick.” Naxos Music Library. http://www.naxos.com/ composerinfo/Frederick_Delius/27155.htm (accessed 20 October 2008). Offers a composer reference page, and discography. 44 Frederick Delius: A Research and Information Guide

76. “Sound Files.” The Music of Frederick Delius (see no. 52). &RQWDLQV DQ DUUD\ RI 5HDO$XGLR 0,', DQG 03 ¿OHV IURP YDULRXV sources.

77. “YouTube.” http://www.youtube.com (accessed 22 October 2008). Includes an ever-changing number of video clips of Delius’s music, in performance or as background music.

Miscellaneous

78. Barg, David. “Frederick Delius.” Classical Music Archives. http://www. classicalarchives.com/bios/delius_bio.html (accessed 21 October 2008). %LRJUDSKLFDOVNHWFKWLPHOLQHDQGOLQNVWR0,',VRXQG¿OHVRIYDULRXV orchestral and opera excerpts (of variable quality, as these are contributed by individuals).

79. British Music Information Centre. http://www.bmic.co.uk/collection/ default.asp (accessed 21 October 2008). A search of the collection’s database reveals some 300 results related to Delius. Each result line gives a summary (year of composition and performance forces required). Individual work records offer more information such as dedication, publisher, collected edition citation, etc. Although some of the materials in the collection offer score views or audio clips, there are none for Delius.

80. “Census Records.” National Archives. http://www.nationalarchives. gov.uk/census/default.htm?homepage=fr-census (accessed 20 October 2008). Census records (1841–1901) can be searched online from this gateway. Search results for the 1901 census include Delius’s family in Bradford.

81. “Delius, Frederick.” International Music Score Library Project/Petrucci Music Library: The Public Domain Music Score Library. http://imslp. org/wiki/Main_Page (accessed 20 October 2008). A “virtual library” of public domain scores contributed by volunteers. Individual work entries contain a link to the biographical sketch in Wikipedia, credits, contributor, and copyright status information (i.e., public domain status varies between countries in some cases). At time of writing there are ten Delius scores available.

82. “Delius, Frederick (Theodore Albert).” Classical Scores Library, Bibliography 45

Alexander Street Press. http://www.alexanderstreetpress.com (by subscription, accessed 20 October 2008). This collection of online scores includes the entire Boosey & Hawkes catalog (at time of writing; content of the database is not yet complete). There are two index entries for Delius, due to differing forms of his forename. The thirty-nine scores feature static URLs and are available in pdf format.

83. “Frederick Delius.” Allmusic. http://www.allmusic.com/ (accessed 20 October 2008). This website offers a biographical sketch (by Alexander Carpenter) and a list of works. Selecting a particular work reveals a brief description DQGOLVWRIUHFRUGLQJV VRPHZLWKDXGLRFOLSV :RUNVDUHLGHQWL¿HGZLWK Threlfall catalog numbers.

84. “Frederick Delius 1862–1934.” Boosey & Hawkes, http://www.boosey. com/composer/Frederick+Delius (accessed 27 August 2008). A comprehensive site featuring both a snapshot sketch and a lengthier biography suitable for program notes (in English and German). Also includes a short discussion of his works, a list of works (including title, description, and availability for sale, custom print, or hire), news items and performances, discography, sound samples and an article “In Focus,” a discussion of Delius’s music by Robert Cowan with text in English, French, and German.

85. “The Frederick Delius Website: France.” http://fdelius.free.fr/actual.htm (accessed 20 October 2008). This website features several online articles, audio clips, and a list of Delius’s works. Text in French.

86. Bradford: In the Heart of West Yorkshire’s Bronte Country. City of Bradford. http://www.city-of-bradford.com/welcome.html (accessed 21 October 2008). A brief overview of the city and the surrounding area. There is a link to the Delius birthplace, which offers a contemporary street view (http:// www.city-of-bradford.com/delius-birthplace.html).

87. “Concert Programmes.” Arts & Humanities Research Council. http:// www.concertprogrammes.org.uk/ (accessed 27 August 2008). Searchable database of collections of program notes. Some of the institutions covered include the British Library, the Royal College of 46 Frederick Delius: A Research and Information Guide

Music and the Royal Academy of Music in London, the Bodleian Library, Oxford, and the national libraries of Scotland and Ireland, as well as repositories in Aldeburgh, Birmingham, Bradford, Cardiff, Cheltenham, Edinburgh, Leeds, and Manchester. Programs containing Delius works are numerous.

88. The English Music Festival: The Spirit of England. http://www. englishmusicfestival.org.uk/ (accessed 2 October 2008). Managing and Artistic Director, Em Marshall. Includes recaps of the 2006 and 2008 festivals at which several Delius works were performed. Includes photos from the festivals.

89. “Harrison Sisters Collection.” Royal College of Music. http://www.rcm. ac.uk/default.aspx?pg=2005 (accessed 2 October 2008). Contains manuscripts and correspondence.

90. Music Web International. http://www.musicweb.uk.net/ (accessed 20 October 2008). This mega-site contains articles, current news, reviews of books and recordings, and more.

91. “The Papers of Edward Joseph Dent.” King’s College Archive Centre. http://janus.lib.cam.ac.uk.floyd.lib.umn.edu/db/node.xsp?id=EAD/ GBR/0272/PP/EJD (accessed 2 October 2008). The Dent collection includes a signed postcard and notes from a 1929 conversation with the Deliuses.

92. “Royal Historical Society Bibliography of British and Irish History.” Royal Historical Society. http://www.rhs.ac.uk/bibl/ (accessed 8 October 2008). This massive bibliography is an authoritative guide to writings on British and Irish history; it is hosted by the Institute of Historical Research, University of London. A basic search of the database turns up approximately thirty titles related to Delius.

SPECIAL PUBLICATIONS

Exhibitions and Exhibition Catalogs

93. Carley, Lionel. The School of Grez-sur-Loing, Nordic Artists in France during the 1880s, and an English Composer among Scandinavian Artists, Frederick Delius at Grez-sur-Loing. London: Delius Trust, 1994. 14 p. Bibliography 47

Catalog for an exhibition organized by the Delius Trust and Riksutstallningar (Swedish National Centre for Touring Exhibitions) and held at the Cheltenham International Festival of Music, 2–17 July 1994. The exhibit included photographs of the Delius house and gardens at Grez, and various manuscripts. Articles included “Nordic Artists in France During the 1880s,” and “An English Composer among Scandinavian Artists: Frederick Delius at Grèz-sur-Loing.”

94. Carley, Lionel. Young Delius. London: Delius Trust, 1978. 13 p. Catalog of an exhibition held at the Royal Festival Hall, London, 1 November–14 December 1977. Delius’s life and works through 1903 were featured in the exhibition.

95. Carley, Lionel, and Robert Threlfall. Delius and America: An Exhibition of Photographs, Scores, Letters and Other Material Relating to Delius’s Visits to America and Illustrating the American Background to “Koanga” and Other Works. London: Delius Society, 1972. 15 p. ISBN 0950265306. Also published as a special issue of the Delius Society Newsletter (May 1972). Catalog of an exhibition at St. Pancras Library, London, organized by the London Borough of Camden, Libraries and Arts Department, 1–20 May 1972. Includes a brief bibliography and illustrations.

96. Delius Exhibition, January 29–February 3, 1963. Jacksonville, Fla.: Cummer Gallery of Art, 1963. 12 p. Catalog of an exhibition held at the Cummer Gallery of Art, Jacksonville, Florida. The exhibit featured 150 items. There are no illustrations in the catalog.

97. Eggum, Arne, and Sissel Biørnstad, eds. Frederick Delius og Edvard Munch. Oslo: Oslo kommunes kunstsamlinger, 1979. 61 p. Catalog of an exhibition held at the Munch-museet, Oslo, Norway 2 April–13 May 1979. Includes illustrations and a bibliography. The three articles are “Frederick Delius and Edvard Munch” by John Boulton Smith (pp. 9–27; see no. 1283), “En engelsk-amerikansk Hardanger-vidde-mann” by Lionel Carley (pp. 29–33), and “Munch og musikken” by Arne Eggum (pp. 35–49). The two Norwegian articles are accompanied by English translations.

98. Frederick Delius: Centenary Festival Exhibition. Bradford, England: Bradford City Art Gallery and Museums, 1962. 20 p. 48 Frederick Delius: A Research and Information Guide

Catalog of an exhibition held 30 March–13 May 1962 at the Bradford City Art Gallery and Museums, and 1–21 June 1962 at the Royal Festival Hall, London. The exhibition, part of the Bradford Delius Centenary Festival, featured 209 items. The catalog contains no illustrations.

99. “Frederick Delius: Life and Times in Bradford.” Bradford Libraries, Archives and Information Service. http://www.bradlibs.com/localstudies/ delius/index.htm (accessed 15 October 2008). Originally mounted as a foyer exhibition at the Bradford Central Library in 2006 as part of the Delius Inspired festival. The online exhibit features many historical pictures and reproductions, including his baptismal record, obituary (from The Bradfordian) and documents related to his family’s business.

100. “Royal Manchester College of Music Visitors’ Book.” Royal Northern College of Music http://www.rncm.ac.uk/content/view/471/151 (accessed 2 October 2008). An online exhibition that featured the Visitors’ Book, signed by many distinguished visitors to the College, Both Delius’s and the Fenbys’ signatures are found in the book (although dating from different visits). The page with Delius’s signature is unfortunately not included in the online exhibit, but pages with Edvard and ’s and Eric and Rowena Fenby’s signatures are reproduced.

Festival Program Books (Arranged Alphabetically by Festival Title)

101. Bottomley, Alan, ed. Frederick Delius 1862–1962: Centenary Festival, Bradford, March 29–April 7, 1962. Bradford: Council and Executive Committee, 1962. 102 p. Selected articles include: “Homes of Delius” (photographs of residences at Bradford, Solano Grove, Norway, Grez-sur-Loing), “A Village Romeo and Juliet” by Norman Tucker, and “Delius Today” by Thomas Armstrong.

102. A Delius Festival. Danville, Va.: Danville Delius Association, 1997. 40 p. Program book for the Delius Festival held in Danville, Virginia, 29 May–1 June 1997. The festival was dedicated to Mary Cahill, local researcher and author of the book, Delius in Danville (see no. 845). Includes biographical sketch, list of festival events, biographical notes on the festival lecturers, program notes for the musical events, and many illustrations of the Danville sites associated with Delius. Bibliography 49

103. Delius in Danville: An International Centennial Celebration. Danville, Va., 1986. 33 p. Program book for the centennial celebration held 24 February–2 March, 1986. The festival featured a re-creation of an 1886 Delius concert. Includes a survey of Delius’s life and works and a list of festival events.

104. Delius Festival Program Books (Jacksonville, Fla., 1961–present) Variable in quality (for example, some books have generous illustrations and essays whereas others only list festival events), but provide an invaluable record of activities and events associated with the annual Delius Festivals. Selected articles include: “The Delius Festival: Highlights of the First Twenty-Four Years.” 25th (1985): 3. Richmond, Martha Bullard. “Solano Grove Rediscovered: A Personal Account.” 27th (1987): 5–6 (see no. 494).

105. Thompson, Bill. “The Delius Festivals.” http://www.thompsonian.info/ delfest.html (accessed 20 October 2008). Recaps of all the Jacksonville Delius Festivals; several have images of the program book covers.

 %DQ¿HOG6WHSKHQHGThe Fourth Delius Festival, 8–14 March 1982. Staffordshire: University of Keele, 1982. 64 p. Program book for the festival held at the University of Keele, Staffordshire. Articles include: “Delius: The Man and the Musician” by Eric Fenby, “The Delius Festivals” by Stephen Lloyd, “The Delius Trust and the Delius Society” by Robert Threlfall, “Delius in Perspective” by Christopher Palmer, “Delius in Hanley” by Jack Oliver, and “Frederick Delius through the Festival: An Exhibition” by Philip Jones.

107. Delius Inspired: A Major Festival Celebrating Frederick Delius, his ,QVSLUDWLRQVDQG,QÀXHQFHV. Bradford: [unnamed publisher], 2006. 28 p. Program book for the festival held in Bradford, 1–8 July 2006, and organized by violinist Tasmin Little.

UNPUBLISHED MATERIALS

108. The Delius House. Pamphlet, c. 1961. Caption title: “Frederick Delius in Florida.” Includes a brief biographical sketch focusing on his Florida years, and a history of the Delius cottage culminating in its move to the grounds of Jacksonville University. 50 Frederick Delius: A Research and Information Guide

109. Fenby Lectures. Lectures presented at the annual Delius Festival, 1983. The annual Fenby Lecture is given as part of the annual Delius Festival sponsored by the Delius Association of Florida, and is named in honor of Eric Fenby. The Jacksonville Public Library Delius Collection holds copies of most of the lectures.

 +HDOH\ 'HUHN ³7KH ,QÀXHQFHV RI %ODFN $PHULFDQ 0XVLF XSRQ WKH Works of Frederick Delius: Fact or Nostalgia?” Paper presented at the College Music Society annual meeting, 1984. Healey expanded this original paper into a book-length study (see no. 965.)

111. Stewart, Sandra. “The Ladies Friday Musicale and the Birth of the Delius Association of Florida.” Paper presented at the College Music Society Southern Chapter, Carrollton, Ga., 1998. The Ladies Friday Musicale is the oldest musical organization in Jacksonville. The annual Delius Festival started out as a concert given by the Musicale. The copy housed in the Jacksonville Public Library Delius Collection includes abstract, script, and list of illustrations.

ORGANIZATIONS

112. Delius Society. http://www.delius.org.uk/g_society.htm (accessed 1 October 2008). The current Delius Society was formed in 1962 following the centenary Bradford Delius Festival. According to information found on the society’s Web page, there are currently over 500 members throughout the world. The society publishes a journal, the Delius Society Journal, and a newsletter twice per year. A gallery of photographs, list of works, and calendar of Delius-related events are also available.

113. Delius Society, Philadelphia Branch. http://thompsonian.info/delphila. html (accessed 20 October 2008). The Delius Society, Philadelphia Branch, was founded in 1976. The society’s aim is to promote the music of Delius and presents a number of concerts, lectures, and other events annually. The society publishes a newsletter, The Delian, three times per year.

114. Delius Society, West of England Branch. http://delius.the-mill.co.uk (accessed 20 October 2008). This branch has its news and events on its website. Bibliography 51

115. Delius Association of Florida The Delius Association of Florida was formed in 1960 as an outgrowth of the Ladies Friday Musicale, the oldest musical association in Florida. The Ladies Friday Musicale sponsored concerts of Delius’s music that eventually became the annual Delius Festival. In 2004, the Association merged with the Riverside Fine Arts Association.

116. Delius Society of South Africa The inaugural meeting of the Delius Society of South Africa took place on 29 November 1965 but the society was inactive at time of publication.

117. Frederick Delius Society An announcement of the formation of this group, headquartered in Houston, Texas, was made in issue 41 of the Delius Society Newsletter (1973) (see no. 133). George Englesmith was the Executive Director, and Eric Fenby accepted an invitation to become Honorary Chairman of the group.

118. Les Amis de Delius This society was formed to promote the music of Delius in France but was inactive at time of publication.

119. West Coast Delius Society Currently inactive. The society published three issues of a newsletter, The West Coast Delius Society Newsletter.

DELIUS SOCIETY PUBLICATIONS

The Delius Society Newsletter, Delius Society Journal, and The Delian have been selectively indexed. Inclusion of reviews from the Delius Society Journal KDYHEHHQFKLHÀ\OLPLWHGWRIHDWXUHRUFRPSDUDWLYHUHYLHZVRISHUIRUPDQFHV scores, or sound recordings. Routine society business reports, brief reviews, news notes, and letters to the editor have been generally been excluded. The current Delius Society Newsletter LVVXHG WZLFH \HDUO\ FKLHÀ\ FRQWDLQV QHZV reports and society notices, and is consequently not indexed here.

120. Lloyd, Stephen. Index to the Delius Society Journal 1–100. 64 p. ML 410.D35. This very useful companion to the Delius Society Journal (and its former title, the Delius Society Newsletter) contains a foreword by Delius Society president Eric Fenby, a history of the society by Rodney 52 Frederick Delius: A Research and Information Guide

Meadows, and a list of society meetings. A list of society publications (“Secretary’s Notes,” Delius Society Newsletter, Delius Society Journal) is given with publication dates and editors. There is a general index, plus indexes for authors and illustrations. The author index includes authors of correspondence, articles, and reviews (including reviews extracted from external sources). The illustration index includes photographs, drawings, musical examples, and reproductions of external source material (e.g., newspaper reviews, advertisements).

121. “The Delius Society Journal: Past Issues.” David Tall. http://homepage. mac.com/davidtall/journals/ (accessed 17 October 2008). This website offers the jackpot to the Delius researcher—previous Delius Society Journal and Newsletter issues, including the earliest unnumbered issues available in pdf format. A brief publication history and reminiscences by Rodney Meadows of the genesis of the Delius Society are also included.

Delius Society Newsletter

122. “[English Songs Broadcast].” Delius Society Newsletter no. 4 (1964): 3. Review of a broadcast of English songs, performed by . Two Delius songs were performed, as was E. J. Moeran’s “Merry Month of May,” which was dedicated to Delius.

123. “The 1972 Delius Festival of Jacksonville.” Delius Society Newsletter no. 36 (1972): 8–14. Excerpts from the festival program booklet. The 1972 festival, held 23 January through 4 February, was dedicated to the memory of Hugh Alderman (founder member and former President of the Delius Association of Florida). The Delius Composition Award prize was awarded to Haiku—A Song Cycle for Soprano, Viola, and Harpsichord by Marilyn J. Ziffrin, Bradford, New Hampshire.

124. “The American Premiere of Koanga,” parts 1 and 2, Delius Society Newsletter no. 30 (1971): 4–14; no. 31 (1971): 8–19. Roundup of critical response to the Opera Society of Washington’s production (18–21 December 1970). Includes reviews from Evening Star (Washington), Washington Post, New York Times, Washington Daily News, Chicago Tribune, Christian Science Monitor, Plain Dealer (Cleveland), National Observer, Time, and Opera News. Bibliography 53

125. “The Delius Composition Award.” Delius Society Newsletter no. 28 (1970): 14–16. Announcement of the results of the competition sponsored by the Delius Association of Florida. The 1970 award was given to Mr. James F. Traver, Valley Stream, New York for his composition From the New England Hills.

126. “Delius Letters at Sotheby’s.” Delius Society Newsletter no. 21 (November 1968): 3–4. The sale catalog for 8 April 1968 offered forty-eight letters from 6LU *UDQYLOOH %DQWRFN WR 'HOLXV SOXV ¿YH OHWWHUV IURP -HOND VHYHUDO postcards, an undated press clipping, and a card from Delius’s reburial DW/LPSV¿HOG,QFOXGHVEDFNJURXQGLQIRUPDWLRQRQWKHFRUUHVSRQGHQFH

127. “The London Revival of Koanga.” Delius Society Newsletter no. 38 (1973): 6–13. A compilation of reviews from the Camden Festival performance reprinted from the Financial Times, Evening News (London), Times (London), Daily Telegraph, Guardian, Observer Review, Sunday Times (London), Sunday Telegraph, Stage and Television Today, and New Statesman.

128. “A Mass of Life.” Delius Society Newsletter no. 29 (1970): 5–8. Collected reviews of a performance conducted by Sir , a review of a recording of the work (CBS Classics 61182–83) by Geoffrey Crankshaw (reprinted from Records and Recording, October 1970), and DSUR¿OHRI*URYHVWKDWZDVRULJLQDOO\EURDGFDVWRQ%%&5DGLR

129. “New Bottles for New Wine.” Delius Society Newsletter no. 15 (1966): 1–4. A discussion of Delius’s use of form in his larger works, including the Piano Concerto, Double Concerto, Violin Concerto and Violoncello Concerto.

130. “The New Recording of A Village Romeo and Juliet.” Delius Society Newsletter no. 40 (1973): 3–18. Reprints of critical reviews from Gramophone (), Records and Recording (John McCabe), New York Times (Peter G. Davis), Cue (Greer Jackson), Country Life (Steward Deas), Daily Telegraph (), and New Statesman (Wilfrid Mellers). 54 Frederick Delius: A Research and Information Guide

131. “Police Guard Memorial; Park Memorial in Tribute to Delius.” Delius Society Newsletter (September 1963): 4–5. The city of Bradford paid tribute to Delius with a monument marking the centenary of Delius’s birth. The monument, a Bradford sandstone monolith holding a commemorative plaque, stands at the head of an DYHQXHRIIRUW\VL[SRSODUWUHHVLQ+RUWRQ3DUN7KH¿UVWUHSRUW H[FHUSWHG from ) tells about the necessity for police guard of the monument in the time leading up to its unveiling, as “hooligans” have vandalized the area. The second report (extracted from the Yorkshire Post) describes the 31 July unveiling ceremony of the monument.

132. “Recent Publications.” Delius Society Newsletter no. 41 (1973): 19–20. A brief list of recent and planned publications by various Delius Society members.

133. “Visit of Mr. Eric Fenby to Bradford.” Delius Society Newsletter no. 42 (1974): 20–21. Fenby lectured on Delius as part of the city’s centenary celebrations. Quotes from the report titled “Delius the Genius?” in the Bradford Telegraph & Argus seem to imply that the audience was drawn to Fenby’s recollections rather than Delius himself.

134. “Visit to America of Mr. Eric Fenby.” Delius Society Newsletter no. 41 (1973): 10. Announces Fenby’s acceptance of an invitation to be the guest of the St. Louis Society for their performance of A Mass of Life to be given in January 1974 in St. Louis, New York, and Washington. Fenby will also be lecturing on Delius. He has also accepted an invitation WREHFRPHWKH¿UVW+RQRUDU\&KDLUPDQRIWKHQHZ³)UHGHULFN'HOLXV Society” formed in Houston, Texas.

135. Barnard, Charles. “[Sale of Letters at Sotheby’s].” Delius Society Newsletter no. 7 (1965): 1–3. Description of a sale lot of correspondence between the Deliuses and Philip Heseltine. Includes excerpts from the letters that appeared in the sale catalog.

136. Buckley, Roger. “‘Et ici le maison d’un compositeur célèbre.’” Delius Society Newsletter no. 10 (1965): 7–8. Recounts visits to Delius’s house at Grez-sur-Loing and to Maurice Ravel’s house at Montfort L’Amaury (his home for his last years). The Bibliography 55

author notes the difference in treatment of the houses by the present owners: extensive renovations have taken place at Grez, whereas Ravel’s house is kept as a museum.

137. Cardus, Neville. “Pagan Ecstasy.” Delius Society Newsletter no. 39 (1973): 3–4. First published in the Guardian (30 November 1972). Notes the neglect of Delius’s music in current concert activities.

138. Cook, C. R. “Delius Letters at Sotheby’s.” Delius Society Newsletter no. 21 (1968): 3–4. Description of a group of materials being sold by the executors of the estate of Sir Granville Bantock. In the lot offered for sale on 8 April 1968 were forty-eight letters written to Bantock by Delius, postcards, and other miscellaneous materials.

139. Coveney, John. “The Visual Impact of A Village Romeo and Juliet in Washington DC.” Delius Society Newsletter no. 40 (1973): 14–18. Describes the “radical and revolutionary” multimedia approach to the staging of the work at its American premiere, April 1972.

140. Foreman, Lewis. “Paa Vidderne and the Problem of Performing Unplayed Music.” Delius Society Newsletter no. 42 (1974): 8–11. Provides a look at the problems associated with a performance of Delius’s tone poem Paa Vidderne. Parts had to be prepared from a manuscript in the Delius Trust. Includes musical examples.

141. Gibson, Roland. “Delius and the Twentieth Century.” Delius Society Newsletter (May 1964): 4–5. Argues that Delius should be regarded as a twentieth-century composer, not a nineteenth-century composer.

142. Gibson, Roland. “The Delius Quartet.” Delius Society Newsletter (October 1963): 4–6. Notes the recent cancellation of a broadcast of the Delius Quartet, the infrequent appearances of his works, and a comparison of another composer of “declining” programming—.

143. Gibson, Roland. “Delius, Sunset and Autumn.” Delius Society Newsletter (August 1963): 4–5. The Songs of Sunset demonstrate Delius’s preoccupation with change and the passing of time. 56 Frederick Delius: A Research and Information Guide

144. Hume, Paul. “Koanga in Washington: An Opera Cancelled.” Delius Society Newsletter no. 29 (1970): 11–12. An announcement (reprinted from the Washington Post) that the Opera Society of Washington will give the American premiere of Koanga. The opera replaced a previously scheduled work by Virgil Thomson when the composer and the Society could not come to terms over its staging.

145. Jefferson, Alan. “The Birthday Weekend.” Delius Society Newsletter no. 39 (1973): 14–16. Recalls that his visits to the public library in Bradford in search of Delius memorabilia and to Claremont (Delius’s birthplace) had yielded mixed results.

146. Jefferson, Alan. “Grez Re-Peopled: A Form of Apologia.” Delius Society Newsletter no. 42 (1974): 11–13. The caption for the picture opposite p. 100 in Jefferson’s biography of Delius (see no. 860) cites three incorrect names. Since its publication, Jefferson has found new information and gives the corrected names as ZHOODVWKHQDPHVIRUWKHSUHYLRXVO\XQLGHQWL¿HGSHRSOHLQWKHSLFWXUH Gives the circumstances surrounding the correction of the names and includes a reproduction of the picture from the book. Lionel Carley provides more information in a letter to the editor in issue 43 of the Delius Society Journal.

147. Jenkins, Lyndon. “Barbirolli’s Last Recording.” Delius Society Newsletter no. 36 (1972): 5–6. Compares Barbirolli’s last recordings of Delius works with those of Thomas Beecham. Jenkins wonders how many other Delius works Barbirolli would have recorded had he lived longer, and notes that Barbirolli did not record many Delius works until after Beecham’s death. The last works Barbirolli recorded were Appalachia and Brigg Fair, less than two weeks before his death.

148. Jenkins, Lyndon. “Delius on Record: The Piano Concerto.” Delius Society Newsletter no. 41 (1973): 5–7. A survey of recordings of Delius’s Piano Concerto.

149. Jenkins, Lyndon. “The Double Concerto.” Delius Society Newsletter (July 1967): 6. Review of a recording by Raymond Cohen and Gerald Warburg with the Royal Philharmonic Orchestra conducted by . Bibliography 57

150. Jenkins, Lyndon. “A New Record of Songs of Sunset.” Delius Society Newsletter no. 27 (1970): 4–6. Review of the 1968 recording by Janet Baker and John Shirley-Quirk with the Liverpool Philharmonic Choir and Orchestra conducted by Charles Groves.

151. Jenkins, Lyndon. “The Requiem and the Idyll.” Delius Society Newsletter no. 22 (1969): 6. Reviews a recording that features , John Shirley-Quirk, the Royal Choral Society, and the Royal Philharmonic Orchestra, conducted by .

152. Jenkins, Lyndon. “The Violin Concerto.” Delius Society Newsletter no. 20 (1968): 5–6. A comparison of LP reissues of recordings made by with the Liverpool Philharmonic Orchestra (, conductor), and by with the Royal Philharmonic Orchestra (Sir Thomas Beecham, conductor).

153. Jenkins, Lyndon. “Songs of Sunset.” Delius Society Newsletter (June 1963): 6–8. Review of the newly released recording featuring Maureen Forrester.

154. Jones, D. Marblacy. “‘Look Back in Envy’ (1).” Delius Society Newsletter no. 21 (1968): 5. An ongoing series that reprints reviews of early Delius performances from the author’s collection of press cuttings. This installment reprints a review of the Piano Concerto, titled “Frederick Delius, A New Concerto Performed,” written by E. A. Baughan (Daily News, London, October 1907).

155. Jones, D. Marblacy. “‘Look Back in Envy’ (2).” Delius Society Newsletter no. 22 (1969): 2–5. Reprints of two reviews by E. A. Baughan: “Appalachia,” Daily News, London (1907), and “Brigg Fair,” Daily News, London (3 April 1908).

156. Jones, D. Marblacy. “Look Back in Envy [3].” Delius Society Newsletter no. 26 (1970): 8–13. This article reprints a review of In a Summer Garden from the Musical Times (journal title in error according to the index; review is actually 58 Frederick Delius: A Research and Information Guide

from Musical News) December 1908; A Mass of Life from the Standard, 8 June 1909; and A Village Romeo and Juliet by E. A. Baughan from the Daily News, London, 23 February 1910.

157. Jones, D. Marblacy. “A Last Look Back.” Delius Society Newsletter no. 27 (1970): 8–14. 7KH ¿QDO LQVWDOOPHQW LQ WKH VHULHV UHSULQWV WKH IROORZLQJ UHYLHZV “A Delius Concert” from the Daily News, London (19 June 1911), “Delius’s Mass of Life: Mr. Beecham’s Revival” from the Daily News, London (10 March 1913), “A Mass of Life: Musical Knight-Errantry at &RYHQW *DUGHQ´ IURP DQ XQLGHQWL¿HG VRXUFH 0DUFK   D UHYLHZ of On Hearing the First Cuckoo in Spring and In a Summer Garden from Crescendo (January 1914), “Delius’s New Compositions” from DQXQLGHQWL¿HGVRXUFH -DQXDU\ DQG³$'HOLXV&RPSRVLWLRQ´E\ E. A. Baughan, a review of A Dance of Life from an untitled, undated source.

158. Jones, D. Marblacy. “The Piano Concerto.” Delius Society Newsletter no. 19 (March 1968): 5–6. Describes Jones’s experience with Delius’s Piano Concerto.

159. Lloyd, Stephen. “Your Concert Choice: .” Delius Society Newsletter no. 42 (1974): 22–23. A survey of performances by noted Delius interpreter Roy Henderson.

160. Lowe, Rachel. “To the Secretary of the Delius Society – 1st May, 1965.” Delius Society Newsletter no. 9 (1965): 5–6. The Archivist to the Delius Trust describes her work of producing a “proper bibliographical” catalog of the music, correspondence, and other material in the possession of the Trust.

 0HDGRZV5RGQH\³6RPH5HÀHFWLRQVRQWKH%UDGIRUG)HVWLYDO´Delius Society Newsletter (March 1963): 1–4. Report of festival events.

162. Mellers, Wilfrid. “God or Mountains.” Delius Society Newsletter no. 38 (1973): 2–3. First published in New Statesman (29 January 1971). Review of a reissued recording of A Mass of Life, juxtaposed with a review of the new recording that Mellers desires. Mellers begins and ends the article by comparing Delius with . Bibliography 59

163. Oldaker, W. H. “Delius and the Lost Chord.” Delius Society Newsletter no. 41 (1973): 21–22. 2OGDNHUTXHVWLRQV'HOLXV¶VLQWHQWRYHUWKH¿QDOFKRUGRIWKH9LRORQFHOOR Sonata; early recordings omitted the bar in question, however the printed score and another recording play the conclusion as printed. A response by Robert Threlfall helps to clarify the matter.

164. Redwood, Christopher. “Fennimore and Gerda: A Postscript.” Delius Society Newsletter no. 25 (1969): 3–9. Compares critical response to the British premiere of the opera. Redwood’s article is followed by reprints of reviews from the Daily Telegraph, London, the Sunday Telegraph, London, and the Sunday Times, London.

165. Redwood, Christopher. “Grez before Delius,” parts 1 and 2. Delius Society Newsletter no. 42 (1974): 14–17; Delius Society Journal no. 43 (1974): 5–7. $QH[DPLQDWLRQRIWKHDUWLVWFRORQ\LQ*UH]VXU/RLQJWKDWÀRXULVKHG LQWKHVWRV7KH¿UVWSDUWRIWKHDUWLFOHFHQWHUVRQWKHDUWLVW colony that included Robert Louis Stevenson; the second part focuses on Strindberg and his circle. Includes photographs of the bridge and mill at Grez, and the bridge from the garden of the Hotel Chevillon.

166. Redwood, Christopher, and Robert Threlfall. “Tale of the FD4.” Delius Society Newsletter no. 42 (1974): 5–7. Recounts the detective work involved in identifying a mysterious “F.D.4” present on a recently discovered copy of the song “Plus vite, mon cheval” [“O, schneller mein Ross”]. The copy of this song was ODFNLQJWKHFRYHUDQGODVWSDJHVRWKHSXEOLVKHUFRXOGQRWEHLGHQWL¿HG It was later found to be part of a song collection published by L. Grus )LOVWKH¿UVWHYLGHQFHRISXEOLFDWLRQRI'HOLXV¶VVRQJVLQ)UDQFH

167. Threlfall, Robert. “Delian Studies: Notes for an Iconography.” Delius Society Newsletter no. 26 (1970): 3–7. Supplement, “Amendments to the Iconography.” Delius Society Newsletter no. 28 (1970): 12–13. A preliminary list of portraits and photographs of Delius. The list also includes subjects of “Delian interest.”

168. Threlfall, Robert. “Errors in the Scores of Songs of Sunset.” Delius Society Newsletter no. 32 (1971): 7–8. $OLVWRIPLVSULQWVLQWKHIXOODQGYRFDOVFRUHVRIDQXQLGHQWL¿HGZRUN compiled by an unknown person was found in the Delius Trust Archive. 60 Frederick Delius: A Research and Information Guide

The author’s intensive study of the manuscripts later revealed the work in question to be Songs of Sunset. Includes a copy of the list of misprints.

169. Threlfall, Robert. “A New Delius Song Album, and Notes on the Authentic Orchestral Versions of Certain Songs Now Available.” Delius Society Newsletter no. 39 (1973): 18–19. Announces publication by Stainer and Bell of an album of ten songs that includes several previously unpublished songs. Includes a brief discussion of Delius’s songs with orchestral accompaniment, several of which remain unpublished (and without piano reductions).

170. Threlfall, Robert. “A Note on Delius Music Manuscripts in the U.S.A.” Delius Society Newsletter no. 22 (1969): 1–2. Lists the locations of various Delius manuscripts in the United States: Jacksonville University (full score of Koanga and a sketchbook used by Delius while at Solano Grove), the Memorial Library of Music at Stanford University (full score of Over the Hills and Far Away), and the Moldenhauer Archive (Zwei bräune Augen). There are also several manuscripts in private collections.

171. Threlfall, Robert. “A Note on the Recent Reissue of the Orchestral Score of A Mass of Life.” Delius Society Newsletter no. 37 (1972): 4–6. Beecham died before this work could be published in the collected edition of Delius’s works. Includes a list of errors that remained in the 1972 reprinting of the score from the 1907 Harmonie edition.

172. Walker, Malcolm. “Delius and Barbirolli.” Delius Society Newsletter no. 34 (1972): 8–16. Text of a talk given to the Delius Society, 29 January 1972. Includes a survey of Delius works conducted by Sir (a relationship WKDWODVWHG¿IW\VHYHQ\HDUV DQGDOLVWRIFRPPHUFLDOUHFRUGLQJVPDGH by Barbirolli (78s, LPs).

173. White, John. “Delius, a Great Composer.” Delius Society Newsletter no. 16 (1967): 1–3. A discussion of various points raised in response to an article in The Listener.

174. White, John. “Delius and Existential Criticism.” Delius Society Newsletter no. 19 (1968): 1–4. Bibliography 61

A critique of Colin Wilson’s characterization of Delius’s music as “minor” in a book of his collected writings.

175. White, John. “Editorial.” Delius Society Newsletter no. 21 (1968): 1. Relays the news of the death of Mrs. Henry Lee Richmond of Jacksonville, who purchased the Solano Grove house and arranged for its move to Jacksonville University. The London Symphony Orchestra concert given at Daytona Beach (27 July 1968) was dedicated to her memory. The notice that appeared in the program is reprinted here.

176. White, John. “Editorial.” Delius Society Newsletter no. 28 (1970): 3–8. Additional remarks about in response to an account of the performance of the work that appeared in the previous issue of the Newsletter. The editorial also contains a copy of the program from the second through fourth concerts of “The Balfour Gardiner Choral and Orchestral Concerts” (Second Series, 1913), including Gardiner’s program notes for Lebenstanz.

177. White, John. “Editorial.” Delius Society Newsletter no. 31 (1971): 4–5. Includes two tributes to Hugh Alderman of Jacksonville, Florida, who had recently passed away. Alderman was a founder member and former President of the Delius Association of Florida.

178. White, John. “Editorial.” Delius Society Newsletter no. 40 (1973): 1–2. Includes a list of Delius works conducted by Sir with the Hallé Orchestra, 1919–1933.

179. White, John. “The Meditation of Old Times Resumed.” Delius Society Newsletter no. 18 (1967): 1–2. Describes a visit to Grez taken with Eric and Rowena Fenby.

180. White, John. “Mr. Britten, His Festival, and Mr. Delius.” Delius Society Newsletter no. 20 (1968): 2–3. Reprints a letter received from , who had recently conducted a concert containing On Hearing the First Cuckoo in Spring. Britten’s letter was in response to one sent by a Delius Society member expressing gratitude for this performance. The remainder of the article deplores the lack of current professional performances of Delius’s works in the concert halls. 62 Frederick Delius: A Research and Information Guide

181. White, John. “A Postscript to the Washington Performances of Koanga.” Delius Society Newsletter no. 32 (1971): 9–14. $GLVFXVVLRQRIWKHGLI¿FXOWLHVVXUURXQGLQJWKHSURGXFWLRQRIDQRSHUD such as Koanga.

182. Wright, R. O. “‘Man and Nature: Centenary Lecture’ by Wilfred [sic] Mellers,” Delius Society Newsletter (May 1963): 4. Summary of a lecture given by Mellers at Dudley Technical College on 19 May 1962 to mark the Delius Centenary. Wright notes a few errors in the basic facts in the overview of Delius’s life; the remainder of the talk was drawn from Mellers’s and the 20th Century (London: Rockliff, 1957).

Delius Society Meeting Summaries Published in the Delius Society Newsletter

183. “The Operas of Delius.” Delius Society Newsletter (July 1967): 4–5. Summary of a talk given by Christopher Redwood at the Delius Society meeting on 6 January 1967.

184. Haym, Rudolf. “Lecture to the Delius Society, 4th November 1971.” Delius Society Newsletter no. 33 (1972): 5–16. Reminiscences of Delius, Rudolf Haym’s father (the conductor Hans Haym) and family, and Rudolf’s sojourn in Solano Grove. Rudolf relates WKHGLI¿FXOWLHVLQ¿QGLQJWKH6RODQR*URYHSURSHUW\XQWLOKHUDQLQWR0U Anderson, Delius’s old servant and friend. Rudolf left the property after a few months to settle in Tampa.

185. Lloyd, Stephen. “Holborn Meeting.” Delius Society Newsletter no. 42 (1974): 24–25. Summary of a lecture given by Malcolm Walker on rare Delius recordings. Two recordings featured prominently in the presentation: acoustic excerpts from Hassan, and Sir Thomas Beecham’s 1934 Songs of Sunset.

Performance Reviews Published in the Delius Society Newsletter

186. “An Arabesque and Songs of Sunset.” Delius Society Newsletter no. 18 (1967): 4–6. Two reviews of a concert given by the Royal Liverpool Orchestra conducted by Charles Groves on 14 March 1967. The soloists were and Janet Baker. Bibliography 63

187. “The Great Noontide.” Delius Society Newsletter no. 12 (1966): 1–2. Excerpts from various press reviews of a performance of A Mass of Life, given 22 March 1966 at the Royal Albert Hall.

188. “A Mass of Life in New York.” Delius Society Newsletter (July 1967): 1–4. A round-up of press notices for a performance that took place at Philharmonic Hall, Lincoln Center for the Performing Arts, 31 January 1967.

189. “Phoenix from the Flames.” Delius Society Newsletter no. 11 (1966): 11–12. A roundup of press notices from a performance of the Requiem given in Liverpool by the Royal Liverpool Philharmonic Orchestra and Choir, soloists Thomas Hemsley and Heather Harper and conducted by Charles Groves.

190. “A Village Romeo and Juliet,” parts 1 and 2. Delius Society Newsletter no. 36 (1972): 15–20; no. 37 (1972): 7–17. Details of the American premiere of the opera. Includes reviews reprinted from the Washington Post, New York Times, Christian Science Monitor, Cleveland Plain Dealer, Saturday Review, Opera, Opera News, Stereo Review, Washington Daily News, Evening Bulletin (Philadelphia), and Evening Star (Washington).

191. Buckle, Richard. “Dance.” Delius Society Newsletter no. 39 (1973): 7. Brief review of the ballet In a Summer Garden, reprinted from the Sunday Times, London (29 October 1972).

192. Childs, Anthony. “Requiem at Cambridge.” Delius Society Newsletter no. 39 (1973): 17. Review of a performance by the St. Catherine’s and Corpus Music Societies in the Guildhall, 5 March 1973.

193. Crisp, Clement. “Sadler’s Wells Theatre: In a Summer Garden.” Delius Society Newsletter no. 39 (1973): 5–6. Review of the premiere of the Ronald Hynd ballet, reprinted from Financial Times (27 October 1972).

194. East, John Michael. “Hassan at the Scala Theatre.” Delius Society Newsletter no. 21 (1968): 2–3. 64 Frederick Delius: A Research and Information Guide

Review of performances 28–30 March by the Rose Bruford College of Speech and Drama. The production utilized music from the Beecham recording (GL5691).

195. Hall, John G. “An Alternative Assessment.” Delius Society Newsletter 25 (1969): 10. Review of the British premiere of Fennimore and Gerda.

196. Hope-Wallace, Philip. “Sadler’s Wells: Summer Garden.” Delius Society Newsletter no. 39 (1973): 8. Review of the ballet reprinted from the Guardian (27 October 1972).

197. Percival, John. “Impressionist Setting to New Ballet: In a Summer Garden.” Delius Society Newsletter no. 39 (1973): 6–7. Review of the premiere of the ballet reprinted from , London, 27 October 1972.

198. Redwood, Christopher. “Fennimore and Gerda: Camden Festival 1970.” Delius Society Newsletter no. 28 (1970): 9–12. Review of a production at St. Pancras Town Hall, 27–29 May 1969. Includes excerpts of press reviews.

199. Redwood, Christopher. “A Mass of Life at Guildford on May 5th, 1973.” Delius Society Newsletter no. 41 (1973): 8–10. Review of the performance which featured soloists Jane Manning, Margaret Cable, Kenneth Woollam, and Thomas Allen with the Guildford Philharmonic Choir and Orchestra, conducted by .

200. Redwood, Christopher. “News from America.” Delius Society Newsletter no. 41 (1973): 15–18. Includes commentary by Arthur L. Lange on the production of A Village Romeo and Juliet, given in June 1973 at St. Paul, Minnesota. Lange had previously attended the Washington production, and compares the two. Appended to Lange’s remarks is the review from the local newspaper (St. Paul Dispatch) by Mary Ann Feldman titled “A Village Romeo and Juliet: Fragile Delius Work Smoothly Performed by St. Paul Opera.”

201. Woodward, Ian. “The Royal Ballet: Sadler’s Wells.” Delius Society Newsletter no. 39 (1973): 8–9. Bibliography 65

Reprint of a review from the Sunday Times (29 October 1972) of the Ronald Hynd ballet, In a Summer Garden.

Delius Society Journal

202. “1932: Delius’s 70th Birthday in the Press.” Delius Society Journal no. 131 (2002): 40–43. A compilation of press notices from the collection of Norah Barr Adams (Norah Barnaby), who as “Norman Cameron” was the Honorary Press Representative for the Delius Society.

203. “Advertisement.” Delius Society Journal no. 51 (1976): 19. Reproduction of an advertisement for the new recording of Brigg Fair, conducted by Beecham and issued in advance of the Delius Festival.

204. “Another Delius Piano.” Delius Society Journal no. 124 (1998): 75–76. First published in Telegraph & Argus, Bradford, England (31 August 1998). The piano used by Delius in his youth was acquired by a Bradford museum. It is the third surviving piano known to have been used by Delius (the others include the square piano used at Solano Grove and the Ibach grand from the house at Grez).

205. “Archive: Midnight Burial of a Great Composer.” Delius Society Journal no. 136 (2004): 52–54. Reprint of the leading article published in the Sunday Dispatch (26 May 1934) reporting Delius’s death and burial.

206. “Balfour Gardiner on Delius.” Delius Society Journal no. 85 (1985): 10–17. Reproduces notes written by H. Balfour Gardiner to Philip Heseltine in 1925 regarding the editing, tempi, and phrasing of Delius’s music. Includes several photographs of Gardiner and Delius, and facsimiles of several diary pages containing details of a codicil to Delius’s will dictated to Gardiner just days before Delius’s death.

207. “Boosey and Hawkes’ Delius Catalog.” Delius Society Journal no. 47 (1975): 17–19. A list of works published by Boosey and Hawkes. 66 Frederick Delius: A Research and Information Guide

208. “Boy Musician and Delius.” Delius Society Journal no. 134 (2003): 53–55. First published in the Daily Dispatch (3 September 1929). Reprint of an “exclusive” interview with Eric Fenby about his work with Delius at Grez. Includes a facsimile of the article.

209. “Bradford Honors Delius: July 1932.” Delius Society Journal no. 132 (2002): 52–54. Reprints a selection of press clippings of the presentation of the Freedom of the City of Bradford award to Delius. Includes a photograph of the Lord Mayor awarding the honor to Delius at his home in Grez.

210. “Bradford’s Best 100.” Delius Society Journal no. 137 (2005): 62–63. This special issue of the Bradford Telegraph & Argus (published 29 September 1999) rated Delius 23rd in the list of the top 100 people and places contributing to the city of Bradford.

211. “Delius: A Mass of Life.” Delius Society Journal no. 119 (1996): 37–42. Reprints of three reviews for a performance given by the Bournemouth 6\PSKRQ\ 2UFKHVWUD DQG &KRUXV DQG :D\QÀHWH 6LQJHUV FRQGXFWHG by . The reviews are reprinted from the Guardian, the Church Times, and the Freethinker. Includes a reproduction of the hand- bill for the production.

212. “Delius and the Gramophone.” Delius Society Journal no. 49 (1975): 5–6. Reproduces two newspaper advertisements (c. 1929) for the Beecham recordings.

213. “Delius in Poetry.” Delius Society Journal no. 64 (1979): 17–18. Reprints two Delius-inspired poems.

214. “Delius on Florida and Negro Music.” Delius Society Journal no. 141 (2007): 22–25. Reprints two of Delius’s writings on Florida and Negro music: the foreword to James Weldon Johnson’s The Autobiography of an Ex- Coloured Man (1927/1928) and the foreword from the original full and vocal scores of Appalachia (published by Harmonie). Includes map.

215. “The Delius Prize.” Delius Society Journal no. 141 (2007): 18–21. Sir served as adjudicator of the 2006 Delius Prize Bibliography 67

competition, held 17 November 2006 at the Royal Academy of Music. Prizes were awarded to violinist Liv-Marie Fletcher and violist Edgar Bailey.

216. “Delius Society Branch Formed in Philadelphia.” Delius Society Journal no. 55 (1977): 19–20. Notes the founding of a Society branch in the United States, 11 December 1976. William W. Marsh, Jr. was elected Chairman.

217. “Delius the Deterrent.” Delius Society Journal no. 123 (1998): 61–62. A selection of press stories regarding a decision made at an English train station to broadcast classical music (including works of Delius) in an effort to deter loitering youth. Includes stories from the Daily Telegraph, London, Guardian, and Répertoire des Disques Compacts. Further press items on this matter appear in issue no. 124. A related story “ Soothe Train Vandals” is available at the BBC News website (http:// news.bbc.co.uk/2/hi/uk_news/51939.stm).

218. “A Delius World Premiere.” Delius Society Journal no. 112 (1993): 24. Reports the world premiere of Delius’s orchestration of Edvard Grieg’s Norwegian Bridal Procession in a concert marking the 150th anniversary of Grieg’s birth.

219. “Eric Fenby in Interview.” Delius Society Journal no. 106 (1991): 3–11. 7UDQVFULSWVRIWZRLQWHUYLHZVWKH¿UVWZLWK5REHUW/D\WRQ$XJXVW 1972, for a BBC broadcast and the second with Fred Calland, January 1974, while in the United States for the Public Broadcasting Service.

220. “Eric Fenby: Three Nordic Musicians Reminisce.” Delius Society Journal no. 143 (2008): 93–103. Reminiscences of Eric Fenby by the conductor Bo Holten, composer Tommie Haglund, and cellist John Ehde with a short introduction by Lionel Carley.

221. “Eric Fenby Tribute.” Delius Society Journal no. 121 (1997): 7–77. This special issue of the Delius Society Journal is devoted to the memory RI(ULF)HQE\ ± 'HOLXV¶VDPDQXHQVLVDQG¿UVWSUHVLGHQWRI WKH'HOLXV6RFLHW\7KHLVVXHLQFOXGHVIRUW\¿YHWULEXWHVFRQWULEXWHGE\ Society members. Fenby’s obituary is reprinted from the Times, London, Daily Telegraph, London, Independent, London, Guardian, London, 68 Frederick Delius: A Research and Information Guide

Yorkshire Post, Scarborough Evening News, New York Times, and Florida Times-Union newspapers.

222. “The Genius of Mr. Delius.” Delius Society Journal no. 139 (2006): 130–131. First published in Telegraph & Argus, Bradford, England (17 January 1927). Attempts to raise support for securing the Order of Merit for Delius, despite Delius’s fame being made elsewhere.

223. “Listed Building to Become Delius Pub.” Delius Society Journal no. 119 (1996): 69. First published in Telegraph & Argus, Bradford, England (26 July 1995). The article notes that the building next to the Claremont home of Delius is slated to become a pub. A reproduction of an advertisement that features the line, “Delius Lived Next Door,” is included.

224. “The Loss at the Heart of His Music: Violinist Tasmin Little Describes Her Quest and Says Knowledge of a Composer’s Love Life Can Only %H RI %HQH¿W´ Delius Society Journal no. 122 (1997): 20–22. First published in the Daily Telegraph, London (25 June 1997). Little recounts her trip to Florida in search of evidence that Delius fathered a child while living there.

225. “Maestro Delius a.k.a. Claude Debussy: The Philharmonic Concert.” Delius Society Journal no. 143 (2008): 104. Reprint of a concert review that originally appeared in The World (13 December 1908); the author notes that Delius, who served as conductor, “nearly piloted his own work to shipwreck.”

226. “The Magic Fountain.” Delius Society Journal no. 57, Supplement (1977): 1–19. Complete libretto.

227. “Margaret Harrison Remembers.” Delius Society Journal no. 87 (1985): 13–18. Edited transcript of an interview with Miss Harrison, conducted in August 1984.

228. “Midnight Burial of Delius.” The Delius Society Journal no. 136 (2004): 55–57. Bibliography 69

Reprint of an article published in (26 May 1935) giving the details of Delius’s burial and comments given by Sir Thomas Beecham.

229. “Mr. Chancellor.” Delius Society Journal no. 61 (1978): 21–22. Text of the oration given by Professor R. Hinton-Thomas on the awarding of an honorary degree to Eric Fenby from the University of Warwick.

230. “Music by Delius, and Those Who Knew and Loved Him.” Delius Society Journal no. 140 (2006): 105–106. The Midlands Branch hosted a piano recital by Paul Guinery that featured works by Delius and his friends Balfour Gardiner, Roger Quilter, and Cyril Scott. Includes complete program details.

231. “News from America: A Village Romeo and Juliet,” parts 1 and 2. Delius Society Journal no. 49 (1975): 14–15; no. 50 (1976): 22–24. Reprints program pages and selected reviews of two American performances of the opera.

 ³1HZVIURP$PHULFD3UR¿OH-RKQ&DQDULQD´Delius Society Journal no. 49 (1975): 10–11. Brief biographical sketch of John Canarina, former conductor and musical director of the Jacksonville Symphony Orchestra. Includes a list of Delius works conducted by Canarina during his tenure at Jacksonville.

233. “The Premiere Staged Production of The Magic Fountain.” Delius Society Journal no. 122 (1997): 50–60. $VHOHFWLRQRIFULWLFDOUHVSRQVHWRWKH¿UVWVWDJHGSURGXFWLRQRIWKHRSHUD at the Opera House in Kiel, Germany. Includes a cast list and picture, and reprints of reviews from The Delian, Kieler Nachrichten, Schleswig- Holsteinische Landeszeitung, and Frankfurter Rundschau. The German reviews appear in English translation.

234. “The Real Delius: A Conversation between and Paul Guinery.” Delius Society Journal no. 143 (2008): 112–120. Cellist Lloyd Webber discusses Delius’s Violoncello Concerto and the Violin Sonata no. 2 (including selected recordings), his interactions ZLWK(ULF)HQE\DQGKRZ%HDWULFH+DUULVRQLQÀXHQFHG/OR\G:HEEHU¶V playing. An audio version of this interview is recorded on Gramophone GCD1207 (see D89.) 70 Frederick Delius: A Research and Information Guide

235. “Royal Philharmonic Society Concert – 7 December 1922: The Third Performance of The Song of the High Hills.” Delius Society Journal no. 138 (2005): 105. 5HSULQWVRI¿YHUHYLHZVIURPWKHWKLUGSHUIRUPDQFH 'HFHPEHU  of The Song of the High Hills. Critical reaction ranged from “masterly” to monotonous!

236. “The Song of the High Hills: From the Archives.” Delius Society Journal no. 138 (2005): 92–93. Reprints excerpts from two articles about The Song of the High Hills: a performance review from the Times (3 June 1920), and a piece from the Delius Society Journal (January 1981).

237. “Unveiling of Delius Commemorative Plaque.” Delius Society Journal no. 126 (1999): 65–66. Describes the ceremony unveiling an English Heritage blue plaque at 44 Belsize Park Gardens, London, where the Deliuses lived from October 1918 to July 1919. Includes four illustrations.

238. Amis, John. “Margaret Harrison: In Conversation.” Delius Society Journal no. 131 (2002): 7–10. Transcript of an interview in 1989. Miss Harrison recalls her acquaintance with Delius.

239. Anderson, Hattie. “Vilhelmine, the Muse of Sakuntala.” Delius Society Journal no. 127 (2000): 11–15. 3UR¿OH RI 9LOKHOPLQH (ULFKVHQ 'UDFKPDQQ WKH LQVSLUDWLRQ IRU WKH Danish poets Holger Drachmann and J. P. Jacobsen. Delius set texts by both poets.

240. Aprahamian, Felix. “Obituary: Dr. Philip Emanuel.” Delius Society Journal no. 47 (1975): 16–17. Emanuel served as legal adviser to Sir Thomas Beecham for nearly four decades. Includes portrait.

241. Armour-Chélu, Jane. “1901 Census Results for ‘Delius.’” Delius Society Journal no. 133 (2003): 60–61. Provides a summary of information connected with the name “Delius” from the 1901 census for England and Wales. Delius’s parents were listed as still living at 1 Claremont, Bradford. Bibliography 71

242. Armour-Chélu, Jane. “Cecily Arnold and Norah Barr Adams: Correspondence and Discussions on Delius, 1932–34.” Delius Society Journal no. 134 (2003): 21–28. Reprints selected correspondence between singer Cecily Arnold and Norah Barr Adams, a critic who wrote under the name “Norman Cameron.” Adams was known for her tireless efforts on behalf of the music of Delius. A reproduction of a poster advertising a concert by Arnold and two facsimiles of letters are included.

243. Armour-Chélu, Jane. “Dancing to Delius.” Delius Society Journal no. 133 (2003): 13–18. Provides further information about several Delius-related dance productions: Antony Tudor’s Romeo and Juliet, ’s Nocturne and The Walk to the Paradise Garden, Ronald Hynd’s In A Summer Garden, Eddy Toussaint’s Florida Suite, and a list of various dance performances to music of Delius that have taken place at the Jacksonville Delius Festival. Includes a photograph of “The Rainbow Pas de Deux” from Florida Suite. Later in the issue, correspondence from Robert Matthew-Walker describes a planned performance of the Romeo and Juliet ballet during the 1943–1944 season of the Minneapolis Symphony Orchestra (now the Minnesota Orchestra). The performance, however, never took place and the reason for its disappearance from the schedule remains a mystery (p. 71).

244. Armour-Chélu, Jane. “A Forgotten Ballet?” Delius Society Journal no. 129 (2001): 40–48. The receipt of a letter and theater program from a longtime member of the Delius Society prompted the author’s investigation into Antony Tudor’s Romeo and Juliet, with music by Frederick Delius arranged by Antal Dorati. The ballet makes use of works by Delius including Over the Hills and Far Away, The Walk to the Paradise Garden, Eventyr, Irmelin Prelude, and Brigg Fair7KHVSHFL¿FSHUIRUPDQFHZDVDWRXULQJ production of the Ballet Theatre, which took place in Seattle on 24 July 1944.

245. Armour-Chélu, Jane. “Love’s Last Gift: Rossetti and Delius.” Delius Society Journal no. 123 (1998): 7–12. Notes that the 1911 score of In a Summer Garden contains a dedication to Jelka that includes a quotation from Dante Gabriel Rossetti. The author points out some interesting parallels between the lives of Delius and Rossetti. Two illustrations and references are included. 72 Frederick Delius: A Research and Information Guide

246. Armour-Chélu, Jane. “Marking a Centenary: The Delius Concert of 1899.” Delius Society Journal no. 126 (1999): 8–13. Adapted from the introduction to Frederick Delius: Music, Art and Literature, by Lionel Carley. Aldershot: Ashgate, 1998. 'HVFULEHV'HOLXV¶VVHOI¿QDQFHG¿UVWFRQFHUWRIKLVRZQZRUNV 0D\ 1899, St. James’s Hall, London), and the reception of Delius’s music at that time.

247. Armour-Chélu, Jane. “The ‘Old Cheshire Cheese’ Connection: An Unwritten Chapter.” Delius Society Journal no. 127 (2000): 22–29. Delius visited Richard and Mildred Le Gallienne in England. Le Gallienne was a member of the Rhymers’ Club, which occasionally met DWWKH&KHVKLUH&KHHVHLQ)OHHW6WUHHW'HOLXVPD\KDYHEHHQLQÀXHQFHG by the works of some of the Rhymers’ Club members.

248. Armour-Chélu, Jane. “Summer Holiday 1890: Delius in Jersey.” Delius Society Journal no. 130 (2001): 22–28. Instead of joining his Norwegian friends for the summer of 1890, Delius spent time in Jersey, Normandy, and Brittany. The author focuses on Delius’s three weeks in Jersey, where he stayed at Ceylon Villa, Havre de Pas. Includes excerpts from Delius’s notebook and correspondence, illustrations, and references.

249. Attwell, Geoffrey. “Irmelin: A Neglected Opera.” Delius Society Journal no. 102 (1989): 15–20. An extract from the author’s thesis, “The Enigma of Delius” (Trinity College of Music, London).

250. Attwell, Geoffrey. “Sea Drift: Triumph or Tragedy?” Delius Society Journal no. 108 (1992): 9–14. A discussion of Delius’s setting of Whitman’s text.

251. Barnett, H. “Delius and Religion.” Delius Society Journal no. 53 (1976): 7–11. The author begins his article with an examination of Nietzsche’s philosophy. Once Delius was able to master the art of contemplation and composition, he was inspired by Nietzsche’s vision to create his unique music. Includes bibliographical references. Bibliography 73

252. Bates, Margaret, and Eugene Cronin. “Some Scenes from ‘The Paris Years’ Revisited.” Delius Society Journal no. 70 (1981): 17–19. The authors track down various Parisian locations with a Delius connection, including Gaugin’s studio, Madame Charlotte’s cremerie, and the apartment of Theodor Delius.

253. Baughan, E. A. “A New British Work: Delius’s Appalachia Performed at Queen’s Hall. Delius Society Journal no. 141 (2007): 67–68. Reprint of a review published in the Daily News (23 November 1907) of a performance by the New Symphony Orchestra conducted by Fritz Cassirer.

254. Beckhard, Robert, and Don Gillespie. “The First American Essay on Frederick Delius.” Delius Society Journal no. 118 (1996): 4–16. Background information on the American composer and critic Edward Burlingame Hill, who wrote a lengthy article on Delius and his music for the Boston Evening Transcript (24 November 1909). Hill’s article is reprinted in its entirety.

255. Beecham, Thomas. “Delius at Rest, Burial in a Surrey Churchyard: Sir Thomas Beecham’s Eulogy.” Delius Society Journal no. 87 (1985): 19. First published The Times, London (May 1935). Text of the eulogy delivered by Beecham at Delius’s reburial in England.

256. Beecham, Thomas. “How Delius Came to Fame.” Delius Society Journal no. 135 (2004): 46. Reprint of an article that accompanied Delius’s death notice from the Daily Mail (11 June 1934); gives brief biographical details of his early life, compositions, and his terminal illness.

257. Bergsagel, John. “An English Composer and Danish Authors in the Year 1899.” Delius Society Journal no. 142 (2007): 44–54. This paper was originally given at the Royal Danish Academy of 6FLHQFHVDQG/HWWHUVLQWRFRPPHPRUDWHWKHFHQWHQDU\RIWKH¿UVW concert of Delius’s music in London. His associations with Denmark were quite evident in the program.

258. Bialic, Alan. “And Bradford’s Worst.” Delius Society Journal no. 137 (2005): 63–64. 74 Frederick Delius: A Research and Information Guide

The author recounts his visit to Delius’s birthplace (No. 6 Claremont), now an Islamic center. The pub next door (Nos. 8–10 Claremont), however, is named “Delius.” Includes several color photographs.

259. Black, Margaret. “Delius at Home.” Delius Society Journal no. 82 (1984): 7–10. Describes the author’s visit to Grez around 1927. The author is the daughter of Delius’s sister Clare.

260. Boden, Anthony. “The Inaugural Delius Prize Competition.” Delius Society Journal no. 137 (2005): 17–22. David Worswick was awarded the inaugural Delius Prize, in the David Josefowitz Recital Hall at the Royal Academy of Music, on 12 November 2004. The aim of the competition is to generate interest in performing the music of Delius. David Lloyd-Jones, conductor and chairman of the Delius Trust, served as adjudicator.

261. Bond, Leslie. “Paris, the Song of a Great City: A Delius Society Recording Session.” Delius Society Journal no. 59 (1978): 9–10. Reprint, Delius Society Journal no. 143 (2008): 72–73. Describes the recording of this work in a session on 9 April 1934 with Sir Thomas Beecham and the London Philharmonic Orchestra. A letter to the editor in issue no. 59 sheds further light on the identity of the RUFKHVWUD¶V¿UVWKRUQSOD\HU

262. Boyle, Andrew J. “Delius and Grieg: Aspects of Apprenticeship.” Delius Society Journal no. 76 (1982): 5–14. Tracing the connection between the two composers provides some insight into Delius’s creative process. Includes musical examples and footnotes.

263. Brauer, Bonnie. “The Visit to Grez: An American Near Paris.” Delius Society Journal no. 141 (2007): 12–17. The author recalls the trip sponsored by the Delius Society to Grez-sur- Loing to visit Delius’s former home.

264. Bridgeman-Sutton, David. “Delius and Bridge House, Arthington, Yorkshire.” Delius Society Journal no. 141 (2007): 116–117. Local residents frequently mentioned a Delius connection to Bridge House, but it was unclear what the exact connection was. The author Bibliography 75

surmises that the Delius family may have rented the house for the summer months.

265. Buckley, Roger. “The 24th Annual Delius Festival: Pages from a Festival Diary.” Delius Society Journal no. 84 (1984): 6–9. The festival, held 7–10 March 1984 in Jacksonville, Florida, FRPPHPRUDWHG WKH ¿IWLHWK DQQLYHUVDU\ RI 'HOLXV¶V GHDWK DQG WKH centennial anniversary of his arrival in Florida. Includes accounts of the excursion to Solano Grove and of the gala anniversary concert.

266. Buckley, Roger. “City of Pleasures?” Delius Society Journal no. 143 (2008): 66–71. Probes the impact of the city of Paris on Delius and the consequences of its hedonistic lifestyle on Delius.

267. Buckley, Roger. “The Delius Association of Florida 39th Annual Delius Festival.” Delius Society Journal no. 125 (1999): 40–48. Report of festival events, held 4–6 March 1999 in Jacksonville, Florida. Includes eleven illustrations.

268. Buckley, Roger. “The Delius Association of Florida 40th Annual Delius Festival.” Delius Society Journal no. 128 (2000): 55–56. Report of festival events, held 6–8 April 2000 in Jacksonville, Florida, including the Delius Composition Award Contest, lecture by Jeff Driggers on the discovery of a foreword by Delius in James Weldon Johnson’s The Autobiography of an Ex-Coloured Man (1928), the Friday Musicale concert featuring Nora Sirbaugh (mezzo-soprano), and Fenby Lecture, delivered by David Lloyd-Jones.

269. Buckley, Roger. “An Evening with Tasmin Little, in Conversation with Lyndon Jenkins.” Delius Society Journal no. 125 (1999): 24–25. Summary of a question-and-answer session with the violinist and noted Delius interpreter Tasmin Little.

270. Buckley, Roger. “Notes on the from Fennimore and Gerda.” Delius Society Journal no. 105 (1990): 3–8. Commentary and analysis.

271. Buckley, Roger. “The Society’s Visit to Grez-sur-Loing – 15–17 September 2006.” Delius Society Journal no. 141 (2007): 9–11. 76 Frederick Delius: A Research and Information Guide

Highlights of the Delius Society’s trip to Grez-sur-Loing to visit Delius’s former home.

272. Buckley, Roger. “Through Norway in Delius’s Footsteps,” parts 1 and 2. Delius Society Journal no. 99 (1989): 3–18; no. 100 (1989): 3–15. Recounts the author’s recreation of Delius’s 1887 Norwegian trip.

273. Buckley, Roger. “A Visit to Solana Grove.” Delius Society Journal no. 77 (1982): 15–19. Recounts a visit to Solano Grove and the “Delius House” at Jacksonville University in Florida. Includes a bibliography.

274. Cameron, Norman. “A Memorable Mass of Life.” Delius Society Journal no. 44 (1974): 5–9. Provides information on two performances omitted from Stephen Lloyd’s survey of performances in issue no. 42 (see no. 159).

275. Cameron, Norman. “The Reinterment: A Personal Memory.” Delius Society Journal no. 57 (1977): 9–11, 13–16. An eyewitness account of Delius’s reinterment in the cemetery at /LPSV¿HOG6XUUH\,QFOXGHVWKHOLVWRIPRXUQHUVUHFRUGHGE\WKHSurrey Mirror and map of the cemetery. Photographs of the gravesite appear on pp. 13–16.

276. Cardus, Neville. “ on Appalachia.” Delius Society Journal no. 141 (2007): 74–75. Reprints an excerpt from Sir Neville Cardus’s Ten Composers (1945; see no. 871) that examines the structure of the Appalachia theme and its variations.

277. Carley, Lionel. “Carl Larsson and Grez-sur-Loing in the 1880s.” Delius Society Journal no. 45 (1974): 8–25. Survey of Swedish artistic activity in Grez centering around artist Carl Larsson (1853–1919). A corrupted version of this article was published without the author’s approval in Adam International Review, 455–467 (1985): 58–67 under the title “The Swedish Artists’ Colony at Grez-sur- Loing in the 1880s.”

278. Carley, Lionel. “Eric Fenby.” Delius Society Journal no. 139 (2006): 11–12. Bibliography 77

Tribute originally published in issue no. 121 (1997); reprinted here for the hundredth anniversary of Fenby’s birth.

279. Carley, Lionel. “Genial Fastness: Clews and His Castle.” Delius Society Journal no. 90 (1986): 5–9. $ SUR¿OH RI WKH VFXOSWRU +HQU\ &OHZV ZKR PDGH D PDVN RI 'HOLXV shortly after the two met.

280. Carley, Lionel. “Life at Grez: A Marriage Among the Artists.” Delius Society Journal no. 141 (2007): 85–99. Background information on the wedding of Frederick Delius and Jelka Rosen in 1903. The many artists with ties to Grez and the Deliuses are discussed, including the sculptors and Caroline Benedicks Bruce and the painters Edvard Munch, William Blair Bruce, Francis Brook Chadwick, Ida Gerhardi, Arthur Heseltine, and . This article was originally prepared as an illustrated lecture delivered in 2003 at an event marking the centennial anniversary of the Delius’s wedding.

281. Carley, Lionel. “Musical Patrons at Palsgaard.” Delius Society Journal no. 142 (2007): 75–79. Originally published in Danish translation in Danish Radio’s P2 Magazine in 1998 and was revised for publication in this issue. Discusses the activities of Einar and Anna Schou, residents of Palsgaard Slot (Palsgaard Castle)—musical patrons, friends and admirers of Delius and his music. Includes several illustrations.

282. Carley, Lionel. “Old or New Grove?” Delius Society Journal no. 101 (1989): 19–20. Explains the differing names of Delius’s orange plantation. The property was originally known as “Solana Grove,” but over the years has become known as “Solano Grove.”

283. Carley, Lionel. “On the Trail of Delius in Paris and Grez.” Delius Society Journal no. 143 (2008): 79–88. Carley recounts an early research trip to Paris and Grez-sur-Loing, where he visited various places associated with Delius, the Salon des Indépendants (where Jelka had exhibited her paintings), the Musée Rodin, and the former Delius home now owned by Mme Anna Merle d’Aubigné. 78 Frederick Delius: A Research and Information Guide

284. Carley, Lionel. “Palsgaard: History and Musical Heritage.” Delius Society Journal no. 123 (1998): 14–26. 'HVFULEHV3DOVJDDUG&DVWOHLQ'HQPDUNDQGSUR¿OHVWKHRZQHUV(LQDU and Elisabeth Schou and their relationships with Delius, the singer and composer , and the conductor Paul von Klenau. Includes four illustrations.

285. Carley, Lionel. “A Village Romeo and Juliet (1899–1901): A Brief Account of Delius’s Operatic Masterpiece from Its Inception to Its First Performance.” Delius Society Journal no. 73 (1981): 11–16. $VOLJKWO\PRGL¿HGYHUVLRQRIWKHDUWLFOHWKDWRULJLQDOO\DSSHDUHGLQWKH program for the Zurich production of the opera.

286. Carley, Lionel, and Robert Threlfall. “Dating a Delius Song.” Delius Society Journal no. 51 (1976): 11–14. Discussion of dates for the song “Dream roses” (“Traum Rosen”) as given in Sir Thomas Beecham’s book on Delius (see no. 843). Examination of the handwriting and harmony seem to point to 1898 rather than 1888 DV%HHFKDPOLVWHGLQKLVERRN7KHVRQJLVSULQWHGIRUWKH¿UVWWLPHE\ permission of the trustees of the Delius estate.

287. Chennell, Paul. “Delius, Munch and a Visual Autobiography.” Delius Society Journal no. 139 (2006): 127–129. Report of an exhibition held at the Royal Academy, London, in 1RYHPEHU)LYHZRUNVE\0XQFKLGHQWL¿HGDVEHLQJDW'HOLXV¶V house in Grez were included in this exhibition.

288. Chennell, Paul. “The Deliuses and Rodin.” Delius Society Journal no. 141 (2007): 100–101. Report of the Rodin Exhibition at the Royal Academy of Arts, held 23 September 2006 to 1 January 2007. The sculptor was a friend of Jelka, and admired Delius’s work.

289. Chennell, Paul. “Gwen John and Augustus John: An Exhibition.” Delius Society Journal no. 137 (2005): 93–95. Report of the exhibition held at the Tate Britain, and explanation of the artists’ connection to Delius.

290. Chennell, Paul. “Sargent, Delius and Grez.” Delius Society Journal no. 125 (1995): 15–18. Bibliography 79

Compares Delius’s approach to his work with that of the painter John Singer Sargent (1856–1925). Both men had links to Grez-sur-Loing. Includes three illustrations.

291. Cooke, Deryck. “Delius the Unknown.” Delius Society Journal no. 137 (2005): 41–53. Reprint of the text of a lecture given by Cooke in 1962. Cooke refutes several common criticisms of Delius’s music and compositional style.

292. Cox, Derek. “Correspondances.” Delius Society Journal no. 47 (1975): 6–9. The author suggests looking to Symbolist poetry rather than to Impressionist painting for a fuller appreciation of Delius’s music. Delius was exposed to Symbolism during his Paris years. The title of the article refers to a Baudelaire poem.

293. Cox, Derek. “: All That Jazz!” Delius Society Journal no. 128 (2000): 9–16. An interview with the jazz pianist George Shearing, Delius Society member and musical partner of the late Mel Tormé (also a Society member).

294. Cox, Derek. “Koanga in Trinidad 1995.” Delius Society Journal no. 119 (1996): 46–47. Excerpts of critical reaction to a production of the opera in Port of Spain, Trinidad, accompanied by steel band, brass, and synthesizers. The handbill for the production is reproduced on the back cover of the Journal.

295. Cox, Derek. “Sur les routes de France . . . on the Road to Grez.” Delius Society Journal no. 118 (1996): 52–54. Travel diary of the author’s trip to France, including a stop in Grez- sur-Loing. Also includes a brief overview of Les Amis de Delius, an organization founded to promote the music of Delius in France.

296. Delius, Frederick. “Delius on Ballet.” Delius Society Journal no. 143 (2008): 91. An excerpt from Delius’s article “The Present Cult—Charlatanism and Humbug in Music” (see no. 1) in which he expresses his distaste for ballet. 80 Frederick Delius: A Research and Information Guide

297. Dieren, Bernard van. “ on Delius.” Delius Society Journal no. 103 (1990): 3–14. A short discussion of Delius’s relationship with the composer Bernard van Dieren. The two men shared a friendship with Philip Heseltine. Includes a reprint of van Dieren’s tribute to Delius published in the Musical Times (see no. 918).

298. Driggers, Jeff. “News from America: The Delius Association of Florida: Delius Festival 2004.” Delius Society Journal no. 134 (2003): 77–78. Schedule of events for the upcoming Delius Festival to be held in Jacksonville, Florida. The Festival will feature the world première of Two Negro Songs.

 'ULJJHUV-HII³(DUO\9LVLWVWR/LPSV¿HOG´Delius Society Journal no. 131 (2002): 28–36. Describes seven letters in the Delius Collection at the Jacksonville Public /LEUDU\UHODWHGWRYLVLWVWR'HOLXV¶VJUDYHVLWHDW/LPSV¿HOG7KHOHWWHUV were gifts of Martha Bullard Richmond, a local Delius enthusiast who was responsible for the rediscovery of the Solano Grove property and the establishment of the library’s Delius Collection. Includes references and three illustrations.

300. Driggers, Jeff. “Solano Grove to World Golf Village: Notes on the Growth of a Florida County.” Delius Society Journal no. 124 (1998): 11–15. Describes changes in the area surrounding Solano Grove. Includes four illustrations and references.

301. Driggers, Jeff. “Zu Johnsons Buch: A Forgotten Literary Piece by Frederick Delius.” Delius Society Journal no. 126 (1999): 23–29. Describes Delius’s two-page foreword to the German translation of The Autobiography of an Ex-Coloured Man by the Jacksonville native James Weldon Johnson. The German translation, Der weisse Neger, ein Leben zwischen den Rasse, was published in 1928. The author serendipitously found the previously undiscovered foreword while searching the Internet. The entire text of the foreword is given in the original German, along with an English translation prepared by Lionel Carley and Evelin Gerhardi. Includes bibliographical references.

302. Eccott, David J. “Le Chant De La Nuit and Il Pleure Dans Mon Coeur.” Delius Society Journal no. 112 (1993): 3–7. Bibliography 81

Compares these two works by Florent Schmitt with similarly titled works by Delius. Includes six handwritten musical examples.

303. Eccott, David J. “Florent Schmitt (1870–1958).” Delius Society Journal no. 111 (1993): 3–15. 3UR¿OHRIWKH)UHQFKFRPSRVHU,QFOXGHVDGLVFXVVLRQRIKLVUHODWLRQVKLS with Delius and a select discography.

304. Eccott, David J. “Margot La Rouge,” parts 1 and 2. Delius Society Journal no. 69 (1980): 9–14, no. 70 (1981): 8–15. An examination of the libretto and music of this one-act opera, written for an Italian publisher’s competition. Many years later Delius used some music from this opera to form Idyll for soprano and baritone soloists and orchestra. Includes musical examples, references, and a concordance between the vocal score of the opera and the full score of Idyll. Two corrections to the musical examples appear in issue no. 71.

305. Eccott, David J. “Mel Tormé and George Shearing: Their Tributes to Delius.” Delius Society Journal no. 134 (2003): 29–42. Examines the use of Brigg Fair and On Hearing the First Cuckoo in Spring in an arrangement of Richard Roger’s “It Might As Well Be Spring” as performed by Mel Tormé and George Shearing. Includes musical examples and footnotes.

306. Eccott, David J. “The Missing Trombone.” Delius Society Journal no. 48 (1975): 5–13. A discussion of trombone parts in Appalachia and various other works. Includes musical examples. Related correspondence appears in issue no. 49 (pp. 22–23).

307. Eccott, David J. “Nelson Riddle’s Orchestrations of Delius’s Three Preludes for Piano.” Delius Society Journal no. 143 (2008): 110–115. Description and analysis of Riddle’s score, now housed at the Nelson Riddle Memorial Library at the University of Arizona School of Music. Includes musical examples.

308. Eccott, David J. “The Tonalities and Harmonization of Delius’s Brigg Fair.” Delius Society Journal no. 136 (2004): 20–30. Eccott revisits and expands upon previous harmonic analyses of this work. Tony Summers offers an alternative interpretation of the tonality 82 Frederick Delius: A Research and Information Guide

of the “Introduction” section of the work in a letter to the editor in the following issue (no. 137, 2005).

309. Eriksen, Asbjorn O. “Delius and Norway.” Delius Society Journal no. 138 (2005): 18–27. A discussion of Delius’s relationships with Norwegians, his visits to Norway, Norwegian elements found in his music, and an evaluation of KLV FXUUHQW UHSXWDWLRQ LQ 1RUZD\ 'HVSLWH KLV VLJQL¿FDQW FRQQHFWLRQV with the country, Delius’s music is not widely known or performed.

310. Faulkner, Helen, and Richard Kitching. “Frederick Delius and Friends: A British–Danish Music Festival.” Delius Society Journal no. 124 (1998): 35–41. Report of festival events, held in Aarhus and Palsgaard, Denmark, 18–20 June 1998. Includes six illustrations.

311. Fenby, Eric. “A Critical Study of Delius and His Music.” Delius Society Journal no. 55 (1977): 23. Fenby notes that he has been commissioned to write a critical study of Delius and his music; he hopes that it will be published in 1978, the ¿IWLHWKDQQLYHUVDU\RIWKHEHJLQQLQJRIKLVZRUNDV'HOLXV¶VDPDQXHQVLV

312. Fenby, Eric. “Jelka Delius: A Recollection.” Delius Society Journal no. 79 (1983): 7–12. Edited transcript of a talk given to the Delius Society, 21 September 1982.

313. Fenby, Eric. “The President’s Address.” Delius Society Journal no. 71 (1981): 6–8. Reprint, “Some Changes of Mind” in Lloyd, Stephen, ed. Fenby on Delius: Collected Writings on Delius to Mark Eric Fenby’s Ninetieth Birthday (see no. 58), pp. 102–105. An edited version of a talk given to the Delius Society in January 1981. Fenby recounts his introduction and attraction to Delius’s music.

314. Fenby, Eric. “Rudolf Kempe (1919–1976): A Personal Recollection” Delius Society Journal no. 54 (1977): 19–20. Despite the lack of any mention of Delius in the many obituaries of the late conductor, Fenby relates how his memories of Kempe are always associated with Delius’s music. Bibliography 83

315. Fenby, Eric. “Visitors to Grez.” Delius Society Journal no. 106 (1991): 21–30. Reprint, Lloyd, Stephen, ed. Fenby on Delius: Collected Writings on Delius to Mark Eric Fenby’s Ninetieth Birthday (see no. 58), pp. 112–116. An edited transcript of a talk given to the Delius Society, 22 September 1983. Some of the Grez guests discussed include cellist Alexandre Barjansky, Philip Heseltine, Percy and Ella Grainger, Norman O’Neill, Thomas Beecham, and Balfour Gardiner.

316. Ferry, Elisabeth. “The 1880s [sic]: The Ambience & Artistic Life of Paris.” Delius Society Journal no. 143 (2008): 22–31. Describes the artistic life of ¿QGHVLqFOHParis and the extent of Frederick and Jelka’s activities there. The article is enhanced by the period illustrations added by the journal editor.

 )RUG'HQKDP³7KH'HOLXV)HVWLYDO6RPH%DFNVWDJH5HÀHFWLRQV´ Delius Society Journal no. 88 (1986): 12–13. Reminiscences by the festival orchestral manager.

318. Foreman, Lewis. “The 1904 Production at Elberfeld.” Delius Society Journal no. 113 (1994): 17–24. Includes background information and excerpts of critical reaction to this production of Koanga.

319. Foreman, Lewis. “Felix Aprahamian: A Tribute.” Delius Society Journal no. 137 (2005): 9–10. Obituary.

320. Foreman, Lewis. “Koanga: History and Background.” Delius Society Journal no. 113 (1994): 9–15. Excerpts from contemporary press reports are included along with background information on the opera.

321. Foreman, Lewis. “Koanga: The 1935 Production of Frederick Delius’s Opera in the Context of Its Performance History: Documentation and Sources.” parts 1 and 2. Delius Society Journal no. 113 (1994): 5–64; no. 116 (1995): 3–44. This entire issue of the Delius Society Journal is focused on the opera Koanga, and includes articles on the libretto, a performance chronology by Stephen Lloyd, and information on the 1904 Elberfeld and 1935 Covent Garden productions. Includes a representative selection of 84 Frederick Delius: A Research and Information Guide

reviews of the Covent Garden production and reprints of three articles by Eric Fenby.

322. Foreman, Lewis. “The Lure of the Documentary Sources.” Delius Society Journal no. 113 (1994): 5. A brief discussion of the available documentary material concerning Delius’s opera Koanga.

323. Foreman, Lewis. “Oskar Fried: Delius and the Late Romantic School.” Delius Society Journal no. 86 (1985): 4–22. An examination of German conductor and composer Oskar Fried (1871–1941) and other continental composer-conductors associated in some way with Delius’s music. Includes musical examples, portraits, and footnotes.

324. Foreman, Lewis. “The Song of the High Hills: The Recordings.” Delius Society Journal no. 138 (2005): 85–91. An overview of the recordings of this work, dating from 1946 to 2001. Includes discography.

325. Foreman, Lewis. “The ‘Summer Pieces’: The Recordings.” Delius Society Journal no. 140 (2006): 66–70. A discussion of various recordings of Summer Evening, In a Summer Garden, Summer Night on the River, and A Song of Summer. Includes discography.

326. Foreman, Lewis. “Watford sur Gade: Delius in Watford during the First World War.” Delius Society Journal no. 130 (2001): 8–18. The conductor Thomas Beecham arranged a short lease on The Mill +RXVH RQ 7KH *URYH (VWDWH LQ :DWIRUG ZKHQ WKH 'HOLXVHV ÀHG WR England at the outbreak of World War I. The house and grounds bore some similarity to the Deliuses’ home in Grez-sur-Loing, and Delius was able to continue his composition during his stay. Several illustrations of The Grove Estate and quotations from his correspondence enhance the article.

327. Foreman, Lewis. “Working Towards the 1935 Production.” Delius Society Journal no. 113 (1994): 25–28. Covers the years between the 1904 Elberfeld and 1935 Covent Garden productions of Koanga. Includes transcriptions of remarks made by Jelka Delius to the critic Edward Evans about the opera and a broadcast Bibliography 85

talk by Eric Fenby. Reprints of the Gramophone review of the Delius 6RFLHW\UHFRUGLQJRIWKH¿QDOVFHQHDQGFRQWHPSRUDU\SUHVVUHYLHZVRI the production are also included.

328. Fountain, Katrina. “In a Surrey Garden: The Story of the Harrison Sisters.” Delius Society Journal no. 87 (1985): 3–12. 3UR¿OH RI WKH WDOHQWHG +DUULVRQ VLVWHUV²0D\ %HDWULFH 0RQLFD DQG Margaret. Delius wrote his double concerto for Beatrice and May, and , concerto, and Caprice and Elegy for Beatrice.

 )UHGHULFNV 5R\ ³7KH 0XVLFLDQV¶ :LQGRZ DW /LPSV¿HOG &KXUFK´ Delius Society Journal no. 143 (2008): 121–122. Report of the dedication service held 22 November 2007 at St. Peter’s &KXUFK/LPSV¿HOG7KHSODTXHDFFRPSDQ\LQJWKH³0XVLFLDQV¶:LQGRZ´ pays tribute to Frederick and Jelka Delius, Sir Thomas Beecham, the Harrison family, Norman Del Mar, Denis Stevens, Eileen Joyce, and Jack Brymer. Includes color photographs of the window and plaque.

330. Gartz, Michael. “Anthony Collins Conducts Brigg Fair: An Important Interpretation Re-Assessed.” Delius Society Journal no. 78 (1983): 20–21. Compares the 1953 performance with the London Symphony Orchestra conducted by Anthony Collins with the recording made by Sir Thomas Beecham. The Collins performance was issued on Decca Eclipse ECS 633.

331. Gerhardi, Evelin. “Delius and Ida Gerhardi: Evelin Gerhardi Remembers.” Delius Society Journal no. 101 (1989): 3–8. Edited excerpts from a 1988 interview with Evelin Gerhardi, niece of Delius family friend and artist Ida Gerhardi.

332. Gillespie, Don. “Gunther Schuller & Delius.” Delius Society Journal no. 141 (2007): 130–131. Edited extract from an interview with Gunther Schuller, who conducted a performance of Appalachia with the University of Texas Symphony Orchestra, November 2004.

333. Gooch, Bryan N. S. “Delius and Dowson: On Songs of Sunset as Mentioned in Arthur Hutchings’ Delius.” Delius Society Journal no. 43 (1974): 14–16. Reprint, “Ernest Dowson and Frederick Delius: Songs of Sunset as Mentioned in Arthur Hutchings’s Delius.” Music Review 36 (May 1975): 140–141. 86 Frederick Delius: A Research and Information Guide

Notes an error made by Hutchings in appendix A, p. 186 (Hutchings, Arthur. Delius, see no. 858). The text of Songs of Sunset is attributed to Arthur Symons rather than Ernest Dowson. This error has unfortunately been perpetuated in other sources. Includes additional background information on this work.

334. Gordon, H. S. “Delius: The Story of an Amazing Partnership.” Delius Society Journal no. 134 (2003): 65–67. First published in the News Chronicle (25 July 1932). Reprint of a story about the collaboration between Eric Fenby and Delius. Includes a facsimile reproduction of the newspaper article.

335. Green, Michael. “Delius and the Dance.” Delius Society Journal no. 140 (2006): 91–102. *UHHQFRQVLGHUVHDUO\LQÀXHQFHVRIWKHGDQFHWKHXVHRI'HOLXV¶VPXVLF for ballet (despite his avowed dislike of the same), and the various dance elements found in Delius’s music and texts.

 *UHHQ0LFKDHO³,QÀXHQWLDO'DQLVK3RHWV´Delius Society Journal no. 142 (2007): 55–60. 7KH'DQLVKLQÀXHQFHRQ'HOLXVZDVDUJXDEO\WKHJUHDWHVWDVVHHQLQ WKH'DQLVKVRQJVDQGRWKHUZRUNVLQVSLUHGE\¿YH'DQLVKSRHWV+HOJH Rode (1870–1937), Hans Christian Andersen (1805–1875), Jens Peter Jacobsen (1847–1885), Holger Drachmann (1846–1908), and Ludwig Holstein (1864–1943).

 *UHHQ¿HOG(GZDUG³'HOLXVRQ5HFRUG´Delius Society Journal no. 46 (1975): 25–27. First published in The Guardian. 5HYLHZRIWKH¿UVWFRPSOHWHUHFRUGLQJRIWKHRSHUDKoanga.

338. Gregory, H. W. “Delius and the Cinema.” Delius Society Journal no. 43 (1974): 20–21. 1RWHV WKH XVH RI 'HOLXV¶V PXVLF LQ WKH $PHULFDQ ¿OP The Yearling (1946), based on the novel by Marjorie Kinnan Rawlings.

339. Guinery, Paul. “Appalachia: A Musical Analysis.” Delius Society Journal no. 141 (2007): 36–51. $ GHWDLOHG DQDO\VLV RI WKH ZRUN LQFOXGHV PXVLFDO H[DPSOHV FKLHÀ\ from the piano reduction by Otto Singer for the vocal score (Boosey & Hawkes, 2001). Bibliography 87

340. Guinery, Paul. “Building a Library—Delius’s Brigg Fair.” Delius Society Journal no. 133 (2003): 19–23. Describes and compares several recordings of “one of his most typical— and accessible—pieces.” This summary of a script, written for the “Building a Library” program, BBC Radio 3, 30 November 2002, was reprinted from the February 2003 issue of BBC Music Magazine. On WKHSDJHIDFLQJWKH¿QDOSDJHRIWKHDUWLFOHLVDTXRWHIURPDUHYLHZ by “Norman Cameron” (Norah Barr Adams [Norah Barnaby], honorary press representative for the Delius Society), September 1930, along with two recommended recordings (Columbia L2294–5 conducted by Beecham and HMV D1442–3 conducted by ).

341. Guinery, Paul. “The Danish Songs.” Delius Society Journal no. 142 (2007): 25–35. An introduction to the songs popularly referred to as the “Danish Songs,” although these were not published as such during Delius’s lifetime. Includes a list of the songs plus brief notes on the individual songs.

342. Guinery, Paul. “‘Margot Le [sic] Rouge’.” Delius Society Journal no. 140 (2006): 86–88. An interview with David Lloyd-Jones conducted in connection with the BBC Radio 3 broadcast of the opera Margot la Rouge.

343. Guinery, Paul. “Paris: Musical Analysis.” Delius Society Journal no. 143 (2008): 47–52. An analysis divides the work into seven sections of alternating length and character.

344. Guinery, Paul. “Sea Drift: A Musical Analysis.” Delius Society Journal no. 139 (2006): 38–51. Analysis with musical examples.

345. Guinery, Paul. “The Song of the High Hills: A Musical Analysis.” Delius Society Journal no. 138 (2005): 56–67. Provides a conceptual look at this work, which does not lend itself to a traditional theoretical analysis. Includes musical examples.

346. Guinery, Paul. “The ‘Summer Pieces’: A Musical Analysis.” Delius Society Journal no. 140 (2006): 35–40. 88 Frederick Delius: A Research and Information Guide

Individual analyses of Summer Evening, Summer Night on the River, and A Song of Summer. Includes musical examples.

347. Gunn, Thomas H. “The 38th Annual Delius Festival in Jacksonville, Florida, USA.” Delius Society Journal no. 123 (1998): 45–49. Gunn, the Festival chair, provides information on the genesis of the festival theme and events.

348. Gunn, Thomas H. “Delius Monument Dedicated at the 23rd [sic] Annual Festival.” Delius Society Journal no. 109 (1992): 14–16. Report of the dedication of the Delius monument placed at the original site of the Solano Grove cottage.

349. Hamilton-Brown, Alex. “Elegy: The Birth of a Ballet.” Delius Society Journal no. 139 (2006): 102–105. The author relates the genesis of this Canadian ballet set to Delius’s Paris. 7KH ¿OP RI WKH EDOOHW ZDV VKRZQ RQ &DQDGLDQ WHOHYLVLRQ  February 2005, with Karen Kain in the principal role.

350. Henderson, Roy. “A Mass of Life from the Singer’s Standpoint.” Delius Society Journal no. 44 (1974): 7–8. First published in the Wrexham Leader (1933). An interview with “Norman Cameron” (Norah Barr Adams [Norah Barnaby]), honorary press representative for the Delius Society.

351. Heseltine, Philip. “Philip Heseltine on Appalachia.” Delius Society Journal no. 141 (2007): 32–33. Reprint of an article originally published in the Musical Times, March 1915.

352. Heseltine, Philip. “Philip Heseltine on An Arabesque.” Delius Society Journal no. 142 (2007): 61. Excerpts from a Radio Times article (11 October 1929) and program note from the 1929 Delius Festival are reprinted here.

353. Heseltine, Philip. “The Published Writings of Philip Heseltine on Delius.” Delius Society Journal no. 94 (1987): 2–64. Reprints all of Heseltine’s published writings about Delius, spanning the years 1915 to 1929. Bibliography 89

354. Heseltine, Philip. “The Songs of Delius.” Delius Society Journal no. 142 (2007): 16–17. Reprints Heseltine’s note for the 1929 Delius Festival program.

355. Hickox, Richard. “Richard Hickox Talks to the Editor About Conducting Sea Drift.” Delius Society Journal no. 139 (2006): 81–84. Hickox recounts meeting John Shirley-Quirk, noted Sea Drift soloist, recording the work with him, and makes some general comments on the work.

356. Hill, Lionel. “Delius, Moeran, Albert Sammons.” Delius Society Journal no. 78 (1983): 4–11. The author reminisces about his acquaintance with Delius, the composer E. J. Moeran, and the violinist Albert Sammons, the author’s father-in- law. Includes some discussion of Sammons’s performances of the Delius YLROLQ FRQFHUWR DQG VRQDWDV DQG RI 'HOLXV¶V LQÀXHQFH RQ 0RHUDQ¶V compositions.

357. Hoare, Geoffrey G. “Irmelin: A Bitter Pill for Beecham.” Delius Society Journal no. 63 (1979): 15–20. An account of the premiere of the opera, presented by Sir Thomas Beecham at Oxford in 1953. Includes some of Beecham’s remarks about the work from the television program The Conductor Speaks, and a copy RIWKH³3UR¿WDQG/RVV$FFRXQWRIWKH3URGXFWLRQRIIrmelin.”

358. Hoare, Geoffrey G. “Once I Stayed in a Populous City: A Bradford Idyll.” Delius Society Journal no. 58 (1978): 12–17. The author recalls his business trips made to Yorkshire in the mid-1950s. He frequently stayed at the Wedgwood Hotel, at no. 1–3 Claremont (the former Delius house). He laments the lack of Delius commemorative sites in Bradford and the lack of knowledge of the composer by Bradfordians, including the proprietors of the Wedgwood Hotel. Includes a photograph of the Wedgwood Hotel, and a drawing indicating the layout of the principal rooms when the Delius family were in residence.

359. Hoare, Geoffrey G. “Winter Landscape.” Delius Society Journal no. 60 (1978): 22–23. Describes a visit to the Stroud, Gloucestershire, house where Delius reportedly stayed in 1881. Includes related illustration of Rudolf Sauter’s 1957 painting of the house on p. 16. 90 Frederick Delius: A Research and Information Guide

360. “Eric Fenby: Three Nordic Musicians Reminisce.” Delius Society Journal no. 143 (2008): 93–103. Reminiscences of Eric Fenby by the conductor Bo Holten, composer Tommie Haglund, and cellist John Ehde with a short introduction by Lionel Carley.

361. Holten, Bo. “On Conducting The Song of the High Hills.” Delius Society Journal no. 138 (2005): 75–84. Bo Holten injects a conductor’s insight into this analysis of The Song of the High Hills.

362. Hutchings, Arthur. “Arthur Hutchings on Paris.” Delius Society Journal no. 143 (2008): 20–21. An excerpt from Hutching’s biography of Delius (see no. 858).

363. Ibbott, Mike. “Delius’s Piano Concerto: The Early Three-Movement Version.” Delius Society Journal no. 118 (1996): 29–33. Background information on the origin, revisions, and publication of this work in preparation for a performance of the three-movement version (Karl Pendlebury, soloist with the Bromley Symphony Orchestra conducted by , 20 January 1996).

364. Inkster, Ray. “Frederick Delius and Alfred Sisley.” Delius Society Journal no. 129 (2001): 30–34. A comparison of the similarities between Delius and English painter Alfred Sisley (1839–1899). From July 1897 to January 1899 Delius and Sisley lived a short distance away from each other. Although there is no evidence that the two ever met, Delius owned one of Sisley’s paintings according to Sisley’s biographer.

365. Jefferson, Alan. “Ballets to the Music of Delius.” Delius Society Journal no. 53 (1976): 22. Jefferson provides further information on the Antony Tudor ballet Romeo and Juliet, in response to inquiries made in previous issues of the Journal.

366. Jefferson, Alan. “Delius’s Four Violin Sonatas.” Delius Society Journal no. 117 (1995): 23–25. Traces the origin and performance history of the numbered violin sonatas plus the Sonata in B (op. posth.), which precedes the other three. Bibliography 91

367. Jenkins, Lyndon. “70 Years Ago: The Delius Festival of 1929.” Delius Society Journal no. 126 (1999): 15–22. A collage of images associated with the 1929 Delius Festival (including reproductions from the program books, portraits of Delius, Beecham, Heseltine, and various soloists, etc.) with linking text selected from the writings of Sir Thomas Beecham and Eric Fenby.

368. Jenkins, Lyndon. “The Danish Songs and the Orchestra.” Delius Society Journal no. 142 (2007): 38–43. A survey of the orchestrations (by others) and recordings of Delius’s Danish songs.

369. Jenkins, Lyndon. “Delius on Record: Some Newer Delius Recordings in Retrospect.” Delius Society Journal no. 57 (1977): 21–23. $ URXQGXS RI VLJQL¿FDQW QHZ UHFRUGLQJV LQFOXGLQJ Fennimore and Gerda (HMV SLS991), North Country Sketches (HMV ASD3139), the Violin and Double (HMV ASD3343), shorter orchestral works (RCA RL 25079), and the Beecham reissues (SHD 32).

370. Jenkins, Lyndon. “Delius on Record: The Beecham Reissues.” Delius Society Journal no. 44 (1974): 12–15. Description of the reissues including a list of original recording numbers.

371. Jenkins, Lyndon. “Leslie Heward: A Delius Champion.” Delius Society Journal no. 81 (1984): 13–15. A survey of Delius works conducted by Heward.

372. Jenkins, Lyndon. “The Recordings.” Delius Society Journal no. 143 (2008): 74–78. A survey of recordings of the orchestral work Paris. Includes discography.

373. Jenkins, Lyndon. “The ‘Summer Pieces’: In a Summer Garden.” Delius Society Journal no. 140 (2006): 29–34. 2YHUYLHZRIWKHRUFKHVWUDOSLHFHFRPSRVHGDQG¿UVWSHUIRUPHGLQ Delius extensively revised the score in 1911 into the version most usually heard today. His compositional technique adopted that of the pointilliste painters making the piece that Beecham called “the quintessence of Delius” (p. 33, quoted from Beecham’s biography of Delius, no. 842, p. 167). 92 Frederick Delius: A Research and Information Guide

374. Jenkins, Lyndon. “When Delius was a Repertory Composer in England ...”Delius Society Journal no. 138 (2005): 94–98. Jenkins surveys the years between 1930 and 1970 when Delius’s music was heard regularly in the concert halls. Delius’s music has not been eclipsed, thanks in part to the steady stream of publications and recordings, and promotion work by the Delius Trust.

375. Jessel, Katherine. “The O’Neills and Appalachia.” Delius Society Journal no. 143 (2008): 109. Recounts the role that Delius’s friends Norman and Adine O’Neill played in supporting Delius and his music. Norman wrote the program notes for the performance of Appalachia at the Queen’s Hall in November 1907.

376. Jessel, Katherine. “Recollections of Delius: Yvonne Hudson in Conversation with Stephen Lloyd.” Delius Society Journal no. 132 (2002): 33–38. Yvonne Hudson, daughter of composer Norman O’Neill and his wife, the pianist Adine O’Neill, was Delius’s goddaughter. These recollections were recorded in 1991. Includes a previously unpublished photograph of Frederick and Jelka Delius and Norman O’Neill on the terrace at Grez- sur-Loing.

377. Jones, David Lloyd. “Messa Zhizniv Moskv’ye.” Delius Society Journal no. 140 (2006): 83–85. 5HSRUWVWKH¿UVW5XVVLDQSHUIRUPDQFHRIA Mass of Life (sung in German). The performance, given by the chorus of the Academy of Choral Art with the National Philharmonic Orchestra of Russia conducted by Vladimir Spivakov, took place in the International Concert Hall, Moscow, on 20 April 2006.

378. Jones, Philip. “The Delius Centre.” Delius Society Journal no. 58 (1978): 18–21. Description of a proposed “Delius Centre,” which would serve as a tribute to Delius as well as providing needed space for musical activities at the University of Bradford.

379. Jones, Philip. “Delius’s Leipzig Connections: 1886–1888.” Delius Society Journal no. 102 (1989): 3–14. An overview of Delius’s student days in Leipzig and his study at the conservatory. Bibliography 93

380. Jones, Philip. “A Reluctant Apprentice: Delius and Chemnitz.” Delius Society Journal no. 118 (1996): 17–29. Describes Delius’s association with Chemnitz, where Julius Delius sent his eighteen-year-old son to gain work experience in a textile mill. Includes background information about the city and its musical life.

381. Jones, Philip, and J. R. Heron. “A Fever Diluted by Time.” Delius Society Journal no. 98 (1988): 3–8. A review of the evidence regarding the diagnosis of Delius’s illness as syphilis and a reprint of a 1910 report by a Dr. Bothe.

382. Kent, Elaine. “News from America.” Delius Society Journal no. 44 (1974): 22–24. First published in the Florida Times-Union (Jacksonville). Report of Eric Fenby’s presentation, titled “No One Else for Me . . .” for the Woman’s Club of Jacksonville, which was part of the 1974 Delius Festival. Includes photograph of Fenby with two Delius Society members.

383. King, Alec Hyatt. “A Note on Carl Deichmann: Delius’s Violin Teacher.” Delius Society Journal no. 97 (1988): 3–6. $ SUR¿OH RI RQH RI 'HOLXV¶V ER\KRRG YLROLQ WHDFKHUV ,QFOXGHV bibliographical references.

384. Kirkman, Ron. “French Awakenings: Critical Reactions to the Latest Delius CD Releases.” Delius Society Journal no. 107 (1991): 26–27. A discussion of reviews by the French media of recent recordings of various works by Delius.

385. Kitching, Richard. “Looking Back: 1962 and 1980 . . . and 1920.” Delius Society Journal no. 72 (1981): 16–17. Kitching compares a 1962 English National production of the opera A Village Romeo and Juliet in Bradford with current productions in Zurich and Darmstadt. Eugene Goossens adds his recollections of participating in a 1920 production that earned him a rebuke from conductor Sir Thomas Beecham over a missed cue. The passage is taken from Goossens’s Overtures and Beginners: A Musical Autobiography. Appended to the article are cast lists from the Bradford, Zurich, and Darmstadt productions. 94 Frederick Delius: A Research and Information Guide

386. Lace, Ian. “Appalachia – A Postscript: Film Music – by Delius?” Delius Society Journal no. 141 (2007): 84. ([SODLQVWKHXVHRI'HOLXV¶VPXVLFLQ+HUEHUW6WRWKDUW¶V¿OPVFRUHIRUWKH movie The Yearling (MGM, 1946).

387. Lambert, Constant. “Constant Lambert on Negro Music.” Delius Society Journal no. 141 (2007): 76–77. An extract from Lambert’s BBC talk given on “The Origin of Modern Dance Music” in April 1936.

388. Lee-Browne, Martin. “Conducting Paris: David Lloyd-Jones Talks to the Editor.” Delius Society Journal no. 143 (2008): 57–65. Discussion of the background, and his approach to conducting the orchestral work.

389. Lee-Browne, Martin. “A Brief Introduction to Delius’s Danish Works.” Delius Society Journal no. 142 (2007): 18–24. %DFNJURXQG LQIRUPDWLRQ RQ WKH 'DQLVKLQÀXHQFHG ZRUNV Sakuntala, Seven Danish Songs, Lebenstanz (Life’s Dance – Ronde de la vie), An Arabesque, and individual songs. Another Danish-inspired work, the opera Fennimore and Gerda, is not discussed for reasons of space.

390. Lee-Browne, Martin. “The Delius Prize.” Delius Society Journal no. 143 (2008): 12–15. A report of the 2007 Delius Prize competition, held 23 November 2007 at the Royal Academy of Music, David Josefowitz Recital Hall. The adjudicator, , awarded the prize to the cellist Jessica Hayes and accompanist Christopher White.

391. Lee-Browne, Martin. “The Delius Prize 2005.” Delius Society Journal no. 139 (2006): 13–16. Report of the event held at the Royal Academy of Music, 25 November 2005. The adjudicator, Lionel Friend, awarded the prize to the Cappa Quartet, with Shula Olivera as runner-up.

392. Lee-Browne, Martin. “Four Conductors.” Delius Society Journal no. 141 (2007): 52–66. Surveys the four German conductors responsible for bringing Delius’s music to a wider audience: Hans Haym (1860–1921), Bibliography 95

(1851–1920), Fritz Cassirer (1871–1926), and Oskar Fried (1871–1941). These conductors had all given performances of Appalachia.

393. Lee-Browne, Martin. “Koanga: Jean Allister and Talk to the Editor.” Delius Society Journal no. 142 (2007): 92–94. Allister and Herincx discuss their involvement with the opera in the 1970s.

394. Lee-Browne, Martin. “Lunch with Sir Charles Mackerras.” Delius Society Journal no. 141 (2007): 69–73. An interview with the conductor Sir Charles Mackerras about Delius’s Appalachia.

395. Lee-Browne, Martin. “Mark Elder Talks to the Editor.” Delius Society Journal no. 140 (2006): 58–60. The conductor Mark Elder discusses his introduction to the music of Delius and conducting works such as Summer Night on the River and A Song of Summer.

396. Lee-Browne, Martin. “Paris: Origins and First Performances.” Delius Society Journal no. 143 (2008): 32–45. Traces the publication and performance history of the orchestral work Paris. 'HOLXV¿QLVKHGWKHZRUNLQDQGLWZDV¿UVWSXEOLVKHGLQ 1909 (Leipzig: FEC Leuckart). Includes facsimiles of several period advertisements.

397. Lee-Browne, Martin. “Sea Drift: Origins and the First Performances.” Delius Society Journal no. 139 (2006): 52–80. This survey of the work’s performances includes many excerpts from the press and illustrations.

398. Lee-Browne, Martin. “The Song of the High Hills: Origins and First Performances – and Some Puzzles.” Delius Society Journal no. 138 (2005): 28–55. Discusses the Norwegian inspiration, correspondence, sketches, editions, and performances of this work.

399. Lee-Browne, Martin. “The ‘Summer Pieces’: Their Origins and First Performances.” Delius Society Journal no. 140 (2006): 42–57. 96 Frederick Delius: A Research and Information Guide

Surveys the pieces often collectively referred to as the “Summer Pieces:” Summer Evening, In a Summer Garden, Summer Night on the River, and A Song of Summer. Includes facsimiles from various issues of the scores.

400. Lee-Browne, Martin. “Two American Painters: Winslow Homer & George Catlin.” Delius Society Journal no. 141 (2007): 34–35. Background information on two painters whose styles are reminiscent of Delius’s music. Two of Homer’s paintings were used as cover illustrations for the Delius Society Journal, and Catlin was known for his paintings of American Indians.

401. Lee-Browne, Martin, and Stephen Lloyd. “‘Come Hither, Lass’ – Some Other Musical Gardens.” Delius Society Journal no. 140 (2006): 73–76. A survey of musical garden imagery.

402. Little, George. “Delius and the American Connections.” Delius Society Journal no. 127 (2000): 30–32. $Q DQDO\VLV RI WKH $PHULFDQ LQÀXHQFHV IRXQG LQ PDQ\ RI 'HOLXV¶V compositions.

403. Little, George. “Delius’s Violin Sonatas: A Personal Assessment.” Delius Society Journal no. 132 (2002): 9–20. Examines the Violin Sonatas for clues about Delius, why he wrote the VRQDWDVDQGWKHLUVLJQL¿FDQFH,QFOXGHVELEOLRJUDSKLFDOUHIHUHQFHVDQG a discography.

404. Little, George. “Koanga: ‘In at the Deep End.’” Delius Society Journal no. 128 (2000): 12–16. An interview with the baritone opera singer John Rawnsley. Rawnsley sang the lead role in Koanga on 20 May 1995 with the Chelsea Opera Group.

405. Little, Tasmin. “Delius and His Violin Concerto: A Performer’s Viewpoint.” Delius Society Journal no. 91 (1986): 3–19. Provides an interesting look at the Violin Concerto through the eyes of DQRWHGLQWHUSUHWHURIWKHZRUN/LWWOHH[DPLQHVYDULRXVLQÀXHQFHVRQ Delius’s musical personality, namely his father Julius Delius and teacher Thomas Ward.

406. Little, Tasmin. “Recollections of Florida.” Delius Society Journal no. 120 (1997): 23–28. Bibliography 97

Recounts the author’s trip to Florida researching the impact of the state on Delius’s music.

407. Little, Tasmin. “Tasmin Little Replies.” Delius Society Journal no. 96 (1988): 14–22. A response to William Randel’s article (see no. 478) questioning the evidence that Delius had a black mistress while living in Florida, and /LWWOH¶VFRQMHFWXUHWKDWKLVWULSWR$PHULFDZDVWR¿QGWKLVZRPDQ and a possible child he had fathered.

408. Llewellyn, Redvers. “Redvers Llewellyn and Sea Drift.” Delius Society Journal no. 88 (1986): 4–10. An abbreviated version of a talk given by the baritone Redvers Llewellyn to the Eastbourne Gramophone Society in January 1975.

409. Lloyd, Stephen. “Beecham: The Delius Repertoire,” parts 1–3. Delius Society Journal no. 71 (1981): 9–18; no. 75 (1982): 12–22; no. 79 (1983): 13–20. An examination of Sir Thomas Beecham’s Delius repertoire. The list of works is arranged according to the order found in the Threlfall catalog; discographical information is taken from the Malcolm Walker discography published in the 1975 reprint of Beecham’s Delius (see no. 844). Includes addenda and corrigenda; additional addenda and corrigenda appear in Delius Society Journal no. 82.

410. Lloyd, Stephen. “Before and after Grez: An Interview with Dr. Fenby.” Delius Society Journal no. 89 (1986): 14–23. Reprint, Lloyd, Stephen, ed. Fenby on Delius: Collected Writings on Delius to Mark Eric Fenby’s Ninetieth Birthday (see no. 58), pp. 134–143. Transcript of an interview marking Fenby’s eightieth birthday.

411. Lloyd, Stephen. “The Collected Edition of the Works of Frederick Delius.” Delius Society Journal no. 110 (1993): 3–9. Traces the development of the collected edition issued by the Delius Trust. Includes a list of the volumes in the edition and list of recent publications not part of the collected works.

412. Lloyd, Stephen. “Delius as Conductor.” Delius Society Journal no. 46 (1975): 4–20. Reprint, Le Grand Baton 15 (December 1978): 3–12. An evaluation of Delius’s abilities as a conductor. 98 Frederick Delius: A Research and Information Guide

413. Lloyd, Stephen. “Delius at .” Delius Society Journal no. 50 (1976): 15–21. A checklist of performances of Delius’s music at the Promenade Concerts, 1907–1975. Works are divided by genre; includes information on conductors, soloists, and miscellaneous information (e.g., planned but FDQFHOOHGSHUIRUPDQFHV¿UVWSHUIRUPDQFHVH[FHUSWVSHUIRUPHGLQVWHDG of full works).

414. Lloyd, Stephen. “Eric Fenby: An 85th Birthday Documentation.” Delius Society Journal no. 106 (1991): 31–56. Discography of recordings featuring Eric Fenby as conductor, accompanist, speaker, or composer; and a bibliography of his articles, album notes, concert program notes, and broadcast scripts. Also includes a short bibliography of articles about Dr. Fenby and a Fenby–Delius summary that lists Fenby’s work on the scores, arrangements, recordings, ZULWLQJVDQGUHFRUGHGWDONVRQVSHFL¿F'HOLXVZRUNV

415. Lloyd, Stephen. “Festival Report.” Delius Society Journal no. 75 (1982): 4–11. Report of events at the Delius Festival held in Keele, England, 8–14 March 1982. Includes six photographs.

416. Lloyd, Stephen. “: A Biographical Note.” Delius Society Journal no. 72 (1981): 18–20. 3UR¿OHRI*RWWIULHG.HOOHUDXWKRURIWKHVWRU\XSRQZKLFK'HOLXV¶VRSHUD A Village Romeo and Juliet is based.

417. Lloyd, Stephen. “Grainger Plays Delius on Piano Rolls.” Delius Society Journal no. 76 (1982): 17–19. Review of two recordings of Percy Grainger’s transcription for piano, four hands, of North Country Sketches (Klavier KS132) and Brigg Fair (Larrikin LRP 034). Includes a photograph of Delius and Grainger in Frankfurt, 1923.

418. Lloyd, Stephen. “Koanga: A Performance Chronology.” Delius Society Journal no. 113 (1994): 6–8. A list of performances.

419. Lloyd, Stephen. “A Mass of Life: A Postscript.” Delius Society Journal no. 44 (1974): 9–12. Bibliography 99

Provides information about a performance omitted from a list of performances compiled in an earlier issue (no. 42, see no. 158). A correction follows in issue no. 45 (p. 2).

420. Lloyd, Stephen. “Music from the Heart.” Delius Society Journal no. 65 (1979): 3–7. This centenary tribute for the composer and conductor Sir Hamilton Harty includes a brief discussion of Harty’s connections with Delius. Includes bibliographical references.

421. Lloyd, Stephen. “‘The Others Are Just Harpers . . .’: An Afternoon with Sidonie Goossens.” Delius Society Journal no. 109 (1992): 3–7. Harpist Sidonie Goossens reminisces about her life and career, including performances of Delius’s Hassan and other works.

422. Lloyd, Stephen. “A Partnership of Genius.” Delius Society Journal no. 63 (1979): 5–15. Describes the championship of Delius’s works by the conductor Sir Thomas Beecham.

423. Lloyd, Stephen. “Roy Henderson’s Delius.” Delius Society Journal no. 92 (1987): 12–31. A non-exhaustive list of Henderson’s performances of Delius works along with reprints of selected reviews.

424. Lloyd, Stephen. “The Rumble of a Distant Drum: Granville Bantock 1868–1946.” Delius Society Journal no. 80 (1983): 5–28. Includes discussion of the composer Granville Bantock’s relationship with Delius and formation of the Musical League in England. Includes several photographs and a bibliography.

425. Lloyd, Stephen. “Sea Drift: The History of Performances on Record.” Delius Society Journal no. 139 (2006): 85–100. A survey of the recordings, 1928–1993.

426. Lloyd, Stephen. “Thus Spake Zarathustra . . . Roy Henderson in Conversation.” Delius Society Journal no. 92 (1987): 3–11. Edited transcript of an interview with the baritone Roy Henderson. Henderson was a notable Delius interpreter, having sung the part of Zarathustra in all British performances of A Mass of Life from 1925 until 1944. Includes bibliographical references and a portrait. 100 Frederick Delius: A Research and Information Guide

427. Lloyd-Jones, David. “Felix Aprahamian: A Personal Memoir.” Delius Society Journal no. 137 (2005): 11–14. Tribute.

428. Lloyd Webber, Julian. “ and Delius’s Cello Music.” Delius Society Journal no. 109 (1992): 10–13. $ SUR¿OH RI WKH FHOOLVW %HDWULFH +DUULVRQ E\ KHU IHOORZ FHOOLVW /OR\G Webber, and a short survey of Delius’s works for violoncello.

429. Lovgreen, Gordon. “BBC and Delius.” Delius Society Journal no. 43 (1974): 25–26. The author notes an error in a brief news item reported in Delius Society Newsletter no. 42 (1974): 13. In the news item, the editor laments Delius being represented in a radio broadcast “Cross Section: 1900” with only an “old mono recording” of the song The Violet; Lovgreen points out that it is an appropriate choice, as Delius composed only two songs during 1900. He further notes that Delius has been well represented in previous broadcasts in the series.

430. Lovgreen, Gordon. “Delius & BBC Symphony Orchestra.” Delius Society Journal no. 46 (1975): 20–22. Survey of music performed by the BBC Symphony Orchestra between 1 January 1965 and 31 July 1974.

431. Lovgreen, Gordon. “Delius in Liverpool.” Delius Society Journal no. 43 (1974): 12–14. A survey of performances in Liverpool by Sir Charles Groves and the Royal Liverpool Philharmonic Orchestra. “A Postscript,” published in issue no. 53, gives additional information.

432. Lovgreen, Gordon. “The Leaving of Liverpool, or Farewell, Sir Charles: An Appreciation.” Delius Society Journal no. 57 (1977): 12–20. The author notes the appropriateness of Sir Charles Groves choosing a work of Delius on his farewell concert as Musical Director of the Royal Liverpool Philharmonic Orchestra. Groves had programmed many Delius works during his tenure with the orchestra—only Mozart and Beethoven had more individual works performed, and Delius comes in seventh in total number of performances! Bibliography 101

433. Lovgreen, Gordon. “That Opera in Retrospect.” Delius Society Journal no. 62 (1979): 7–10. Remarks on The Magic Fountain.

434. Lowe-Dugmore, Rachel. “Some Notes on the Flecker–Delius Hassan in Perth, W.A. 1975.” Delius Society Journal no. 66 (1980): 6–10. 'HVFULEHV WKH VHW VWDJLQJ DQG PXVLFDO VFRUH IRU WKH ¿UVW $XVWUDOLDQ attempt at staging the Flecker–Delius version of Hassan. Includes musical examples.

435. Lyons, Bob. “Report from New York City.” Delius Society Journal no. 47 (1975): 13–15. Describes a program of Delius works and a work inspired by Delius— Backward Tracings by Ralph Stang with words by Gloria Jahoda.

436. Marsh, Bill. “Philadelphia Branch Acquires Rare LP.” Delius Society Journal no. 133 (2003): 57. Report of the group’s acquisition of a recording of Violin Sonata no. 1 by Louis Kaufman and Thomas Saidenberg (Concert Hall CUS-1062). Discussion continued in the following issue (“Rare LP—Which Came First?” Delius Society Journal no. 134 (2003): 82–83).

437. Matthew-Walker, Robert. “Appalachia: Recordings of a Masterpiece.” Delius Society Journal no. 141 (2007): 78–83. Compares eight recordings of this work.

438. Matthew-Walker, Robert. “Aspects of The Song of the High Hills: A ‘Symphony for Two ’ (in Tribute to Edvard Grieg).” Delius Society Journal no. 138 (2005): 68–74. The author feels that The Song of the High Hills can be viewed as Delius’s WULEXWHWR*ULHJFKLHÀ\EHFDXVHRI'HOLXV¶VXVHRITXRWDWLRQDQGDOOXVLRQ to Grieg’s music.

439. Matthew-Walker, Robert. “Delius Today.” Delius Society Journal no. 136 (2004): 31–36. An essay on the reception history of Delius’s music, and an appeal for a more detailed analytical study of Delius’s music.

440. Matthew-Walker, Robert. “Delius’s Brigg Fair in Words and Music.” Delius Society Journal no. 129 (2001): 7–29. 102 Frederick Delius: A Research and Information Guide

An analysis of the text and music of the folk song that inspired the orchestral work.

441. Matthew-Walker, Robert. “Rescuing In a Summer Garden.” Delius Society Journal no. 119 (1996): 16–21. Recounts the story behind the reissue of some Delius recordings despite the loss of the original tapes.

442. Matthew-Walker, Robert. “Similar Cities? Delius’s Paris, Vaughan Williams’s London Symphony and Stravinsky’s Petrushka.” Delius Society Journal no. 122 (1997): 8–19. Looks for similarities between Delius’s orchestral nocturne and the two later works.

 0DWWKHZ:DONHU 5REHUW ³µ6WDUWOHG DQG (OHFWUL¿HG¶´ Delius Society Journal no. 142 (2007): 104–108. The title of the article stems from Sir Thomas Beecham’s remarks upon hearing the music of Appalachia. The author notes the uniqueness of this FRPSRVLWLRQDQGZLWKD¿QHSHUIRUPDQFHZHWRRFDQEH³VWDUWOHGDQG HOHFWUL¿HG´

444. Matthews, David. “A Village Romeo and Juliet Suite.” Delius Society Journal no. 99 (1989): 18–19. Describes the construction of an orchestral suite from Delius’s opera A Village Romeo and Juliet.

445. McPherson, Ian, and Jane Armour-Chélu. “Another Forgotten Ballet.” Delius Society Journal no. 131 (2002): 19–27. Reprint (edited), Delius Society Journal no. 143 (2008): 89–90. Background information on the Frederick Ashton ballet Nocturne (Sadler’s Wells Ballet, November 1936), set to Delius’s Paris. Includes reproductions of the program and handbill, and pictures from the 1944 production.

446. Meadows, Rodney. “The Munch Exhibition in London.” Delius Society Journal no. 43 (1974): 16–17. Brief survey of the Munch–Delius relationship, prompted by a recent performance of Delius’s Piano Concerto and a Munch exhibition held at the Hayward Gallery 12 January–3 March 1974. Bibliography 103

 0HH$UWKXU³/LPSV¿HOG´Delius Society Journal no. 138 (2005): 17. This excerpt from the “Surrey” volume of The King’s England (London: Hodder & Stoughton, 1966), a popular travel series from the late 1930s, GHVFULEHV'HOLXV¶VFRQQHFWLRQZLWK/LPSV¿HOG

448. Mellers, Wilfrid. “A Preface.” Delius Society Journal no. 139 (2006): 18–19. An excerpt from Mellers’s Celestial Music? (Woodbridge, Suffolk: Boydell Press, 2002, pp. 180–181) regarding Delius’s Sea Drift.

449. Merle d’Aubigné, Jean. “Madame Anna Merle-d’Aubigné (“Bibka”): Bibka and Grez-sur-Loing.” Delius Society Journal no. 140 (2006): 20–21. The author describes the acquisition of the former Delius house in Grez- sur-Loing by his parents (Robert and Anna, known as “Bibka”) in 1936, DQGKRZWKH\FDPHWR¿QGRXWDERXWLWVSUHYLRXVRZQHU

450. Michaud, Suzanne. “Jean Michaud: Publisher Extraordinary.” Delius Society Journal no. 143 (2008): 127–131. Jean Michaud (1884–1961), a native Dutchman, served as the London agent for two of Delius’s German publishers (Universal Edition and Leuckart).

451. Miller, Malcolm. “Pilgrimage to the Past: A Meeting with Margaret Harrison.” Delius Society Journal no. 117 (1995): 18–22. Ninety-four-year-old Margaret Harrison, the last surviving sister of the famous musical Harrison sisters, gives her recollections of Delius.

452. Montgomery, Robert. “ or Bass : Which Did Delius Intend?” Delius Society Journal no. 140 (2006): 77–82. An attempt to set out the facts regarding Delius’s intentions regarding the use of heckelphone or in seven works (A Mass of Life, Songs of Sunset, A Dance Rhapsody no. 1, Fennimore and Gerda, An Arabesque, and the Requiem).

453. Munro, Robert F. “Delius and Berg.” Delius Society Journal no. 65 (1979): 18–19. Munro quotes from a reminiscence of Jascha Horenstein (as recorded in an 1971 interview with Alan Blyth) that points to the possibility of the FRPSRVHU$OEDQ%HUJEHLQJLQÀXHQFHGE\'HOLXV 104 Frederick Delius: A Research and Information Guide

454. Neesam, Malcolm. “Delius in Harrogate: A Story of Error and Confusion.” Delius Society Journal no. 131 (2002): 11–18. Delius’s supposed Harrogate connection is traced to Dr. J. Sutcliffe Smith’s A Musical Pilgrimage in Yorkshire (1928) (see no. 978), and has been repeated in later sources such as Kenneth Young’s Music in Spas and Watering Places (Macmillan, 1968). The author found no evidence to support a connection between Delius and Harrogate. Includes correspondence among Sutcliffe-Smith, Eric Fenby, and Delius from the Yorkshire Post regarding inaccuracies in Sutcliffe-Smith’s book.

455. Nettel, Reginald. “In League for the Sake of Music.” Delius Society Journal no. 60 (1978): 5–17. Background information on the Musical League, a group devised by the critic and the composers Granville Bantock and Delius to promote new musical compositions and neglected works. Delius served as vice president of the short-lived organization.

456. Newman, Ernest. “His Country at Last Claims Delius.” Delius Society Journal no. 143 (2008): 105–111. Reprinted from Magazine (16 March 1930); Newman discusses Delius’s rise in popularity following the recently held Delius Festival.

457. Orr, C. W. “Debussy and Delius: A Comparison.” Delius Society Journal no. 104 (1990): 13–14. First published in the Daily Telegraph, London (12 October 1929). &RPSDUHVWKHLQÀXHQFHVDQGFRPSRVLWLRQDOVW\OHVRIWKHWZRFRPSRVHUV

458. Osborne, R. J. W. “Delius Recordings Currently Available.” Delius Society Journal no. 48 (1975): 14–23. Discography arranged by genre and subarranged by title. An addendum was published in the next issue of the Delius Society Journal.

 2VERUQH5D\³9LVLWWRWKH'HOLXV*UDYHDW/LPSV¿HOG´Delius Society Journal no. 53 (1976): 16. An account of the author’s visit to the gravesite.

460. Page, Frederick. “Delius in New Zealand.” Delius Society Journal no. 65 (1979): 19–21. Bibliography 105

5HFROOHFWLRQV RI 3DJH¶V SHUIRUPDQFH RI WKH 3LDQR &RQFHUWR WKH ¿UVW performance of a Delius work in New Zealand. Includes correspondence between Page and Delius, and a list of major Delius works performed in New Zealand between 1946 and 1961.

461. Palmer, Christopher. “In Memoriam C. W. Orr.” Delius Society Journal no. 55 (1977): 10–15. Palmer recounts his acquaintance with Orr and discusses his connections with Delius.

462. Palmer, Christopher. “James Farrar: Poet, Airman and Delian.” Delius Society Journal no. 81 (1984): 4–12. Adapted from a BBC Radio 4 feature titled “Spring Returning,” broadcast 0D\([SORUHVWKHWZRPDMRULQÀXHQFHVRQSRHWDQGSLORW-DPHV Farrar, who was tragically killed at age 20 during World War II: Delius and the novelist Henry Williamson (1895–1977).

463. Palmer, Christopher. “Rapsodie Floridienne: A Travel Diary, 23–30 July 1982.” Delius Society Journal no. 77 (1982): 6–14. Recounts travel to Florida for a performance by the London Philharmonic Orchestra conducted by Eric Fenby in Daytona Beach, and visits to Jacksonville and Solano Grove. The title of the article is taken from the subtitle of the second movement of Delius’s unpublished Suite d’orchestre (1889–1890).

464. Palmer, Christopher. “Recording the Fenby Legacy.” Delius Society Journal no. 73 (1981): 6–10. Describes the making of the Unicorn-Kanchana recordings, which preserve Eric Fenby’s interpretation of the works dictated to him by Delius. Includes two photographs of the recording session.

465. Palmley, Estelle. “Delius at Drury Lane.” Delius Society Journal no. 74 (1982): 19. Recalls meeting Mel Tormé after a performance at Drury Lane Theatre that included a piano version of Delius’s On Hearing the First Cuckoo in Spring. Tormé, a Delius Society member, also spoke about Delius in a radio interview.

 3DOPOH\(VWHOOH³9LVLWWR/LPSV¿HOG´Delius Society Journal no. 69 (1980): 21–22. 106 Frederick Delius: A Research and Information Guide

Report of a visit to the Delius gravesite by several Delius Society members. Includes a photograph of the gravestone.

467. Payne, Anthony. “Delian Inspiration: Anthony Payne’s Springs Shining Wake.” Delius Society Journal no. 140 (2006): 71–72. Originally published as a program note for Payne’s work inspired by Delius’s In a Summer Garden.

468. Prentice, Ron. “Through Norway in (Some) of Delius’s and Roger Buckley’s Footsteps.” Delius Society Journal no. 128 (2000): 29–32. The author describes his recreation of a trip made by Roger Buckley in the late 1980s, which retraced Delius’s 1887 summer visit to Norway. Prentice’s journey included stops at Bergen, Troldhaugen (the home of Edvard Grieg), and Ulvik, at the top of the Hardanger Fjord.

469. Price, Roy. “A Visit to Scalby.” Delius Society Journal no. 137 (2005): 58–60. Price recalls his trip to Scalby to visit the grave of Eric Fenby and reminisces about their acquaintance.

470. Radford, Brian. “Delius Society Visit to Grez-sur-Loing: 6 to 8 September 1991.” Delius Society Journal no. 108 (1992): 15–24. Recounts a visit made by members of the Delius Society to Grez to see Delius’s house. Includes a discussion of the changes made to the house and grounds since Delius’s time.

471. Radford, Brian. “The Delius Week-End at Bradford.” Delius Society Journal no. 95 (1988): 3–7. Reports events at the City of Bradford Delius weekend, culminating in the presentation by the Delius Trust of a copy of a bust of Delius (by Eleuterio Ricci) to the city.

472. Radford, Brian. “Felix Aprahamian’s Funeral.” Delius Society Journal no. 137 (2005): 15–16. Report of the ceremony, which took place in the chapel of St. Marylebone Crematorium, East Finchley, 28 January 2005.

473. Radford, Brian. “Grez 1933: Felix Aprahamian’s Diary.” Delius Society Journal no. 136 (2004): 9–19. Transcript of Aprahamian’s diary entry for 8 August 1933, the day he visited Delius in Grez, read aloud by Aprahamian at a meeting of the Delius Society in 1989. Bibliography 107

474. Radford, Brian. “‘Nevermore: A Film Script About Delius’s Early Life in Florida, by George Little.” Delius Society Journal no. 123 (1997): 37–38. George Little presented a solo performance of his script to the Delius Society, 27 January 1998. The script begins with Delius attending the Delius Festival, 18 October 1929, and tells the story of the composer’s )ORULGD\HDUVWKURXJKDVHULHVRIÀDVKEDFNV

475. Radford, Brian. “Ray Osborne: The Artist and the Painting.” Delius Society Journal no. 128 (2000): 81. Provides background information to Osborne’s painting depicting Delius’s house at Grez. Radford compares it with other illustrations of the house.

476. Radford, Brian. “Some Impressions of the Bradford Festival.” Delius Society Journal no. 88 (1986): 17–19. A report of festival events, with two photographs.

477. Radford, Brian, and Stewart Winstanley. “‘Hommage à Frederick Delius et à Jelka Rosen:’ Grez-sur-Loing, 20 September 2003.” Delius Society Journal no. 135 (2004): 39–45. Report of an event organized by l’Association Artistes du Bout du Monde, a group local to Grez-sur-Loing, to commemorate the centennial anniversary of the marriage of Frederick Delius and Jelka Rosen.

478. Randel, William. “More on That Long Lost Mistress.” Delius Society Journal no. 96 (1988): 8–13. Questions the idea that Delius had a black mistress and an illegitimate child while he lived in Florida.

479. Redwood, Christopher. “1979 Norwich Festival.” Delius Society Journal no. 66 (1980): 16–19. Discussion of press reviews by Alan Blyth and Wilfrid Mellers of the festival performance of A Mass of Life.

480. Redwood, Christopher. “Delius, His Sister and His Songs.” Delius Society Journal no. 68 (1980): 6–9. Delius apparently enjoyed a warm relationship with his sister Clare despite his discouragement of a career for her as a singer specializing in the interpretation of his songs. Includes a photograph of Frederick and Clare in the garden at Grez. 108 Frederick Delius: A Research and Information Guide

481. Redwood, Christopher. “Delius on Record.” Delius Society Journal no. 56 (1977): 18–20. 5HGZRRGFRPPHQWVRQWKHUHOHDVHRIWKH¿UVWER[RI%HHFKDP±'HOLXV transfers to LP.

482. Redwood, Christopher. “Delius’s Last Known Relative.” Delius Society Journal no. 60 (1978): 18–20. The author recounts meeting Delius’s niece Margaret (“Peggy”) de Vesci, the daughter of Delius’s sister Clare. Two photographs of Margaret can be found on page 13.

483. Redwood, Christopher. “Did Delius Live Here?” Delius Society Journal no. 61 (1978): 12–13. Speculates whether the two houses pictured on p. 47 of Edward Rice’s Journey to Upolu: Robert Louis Stevenson, Victorian Rebel (Dodd, Mead, 1974) were joined together to form the building where Delius later took up residence. Includes the aforementioned picture plus a picture of Delius’s house in 1937.

484. Redwood, Christopher. “Editorial.” Delius Society Journal no. 43 (1974): 3. Reprints a review by Stephen Walsh from the Times of a performance of the Piano Concerto. John Ogdon was the soloist with the Royal Philharmonic Orchestra conducted by Charles Groves.

485. Redwood, Christopher. “Five Songs from Tennyson’s ‘Maud’ by Delius.” Delius Society Journal no. 127 (2000): 16–21. Discussion of the settings based on Tennyson’s monodrama, Maud.

486. Redwood, Christopher. “Grez-sur-Loing, 1932.” Delius Society Journal no. 52 (1976): 4–12. 7KH¿UVWSDUWRIWKHDUWLFOHUHODWHV(YHOLQ*HUKDUGL¶VPHPRULHVRIYLVLWLQJ the Deliuses at Grez. The second part of the article describes a visit to Grez by the singer Cecily Arnold. Includes several photographs.

487. Redwood, Christopher. “L’heure de l’absinthe.” Delius Society Journal no. 108 (1992): 26. Redwood speculates on whether Delius was an absinthe drinker based on the composer’s application of this phrase (see title of this article) to one of a group of sketches for Paris. Bibliography 109

488. Redwood, Christopher. “A Legendary Village Romeo.” Delius Society Journal no. 63 (1979): 21–24. Describes a student production of A Village Romeo and Juliet presented at the Royal College of Music just seventeen days after Delius’s death. Includes reminiscences of Ralph Nicholson, student leader of the orchestra, about the production.

489. Redwood, Christopher. “A Production That Might Have Been.” Delius Society Journal no. 136 (2004): 49–50. The author theorizes that Sir Thomas Beecham had contemplated a performance of the opera Fennimore and Gerda.

490. Redwood, Christopher. “Send for the Girl Tubb . . . !” Delius Society Journal no. 46 (1975): 23–24. The author recalls having tea with two ladies who had met Delius in his younger, healthier years—Vally Lasker and the singer Carrie Tubb.

491. Redwood, Christopher. “Some Other Delius Descendants.” Delius Society Journal no. 68 (1980): 9–10. (OHDQRU ,QJOH¿HOG GDXJKWHU RI 'HOLXV¶V \RXQJHVW VLVWHU (OIULHGD DQG Mrs. Amory Leggatt, granddaughter of Clare Delius Black, are members RI WKH 'HOLXV 6RFLHW\ ,QFOXGHV D SKRWRJUDSK RI 0LVV ,QJOH¿HOG 0UV Leggatt, and Mrs. Elizabeth Lovibond (granddaughter of Delius’s cousin Daniel Delius).

492. Redwood, Christopher. “Strindberg, Munch and Delius: A Sequel to ‘Grez before Delius Part II.’” Delius Society Journal no. 44 (1974): 15–21. Offers additional information on the writer August Strindberg, focusing on his move to Paris, where Delius met him. Includes two illustrations.

493. Redwood, Christopher. “Tormé on Delius.” Delius Society Journal no. 55 (1977): 4–9. An edited version of an interview with the singer Mel Tormé, who attended the 1976 annual general meeting of the Delius Society.

494. Redwood, Dawn. “Flecker, Dean and Delius: The History of Hassan,” parts 1 and 2. Delius Society Journal no. 50 (1976): 6–15; no. 51 (1976): 4–10. Explores the “Flecker, Dean and Delius triangle.” Extensively footnoted. 110 Frederick Delius: A Research and Information Guide

495. Richmond, Martha Bullard. “Solano Grove Rediscovered: A Personal Account.” Delius Society Journal no. 82 (1984): 3–5. Reprint, Delius Festival Program Book (Jacksonville) 27th Annual Festival (1987): 5–6 (see no. 104). Mrs. Richmond’s account of the rediscovery of the Solano Grove property was recorded in a letter written in August 1966 and presented to the Delius Collection, Swisher Library, Jacksonville University in December of that year. The letter, edited for publication by Thomas H. Gunn, provides information on the rediscovery of Delius’s cottage, its purchase, and the subsequent move to its present home at Jacksonville University.

496. Ridderbusch, Michael R. “The ‘Delius in Danville’ Festival.” Delius Society Journal no. 122 (1997): 35–49. A very thorough report of festival events, held in Danville, Virginia, 29 0D\±-XQH7KHDXWKRUDGGVKLVUHÀHFWLRQVRQ'HOLXV¶VVWD\LQ Danville. Includes a bibliography and several photographs of the area and festival participants.

497. Roberts, T. Ian. “Delius the Cricketer: May 31, 1882.” Delius Society Journal no. 135 (2004): 32–35. While researching for a new history of Giggleswick School, the author happened upon a report of a cricket match played against a team from Bradford. The name “F Delius” was among the list of players on that team.

498. Rowe, E. E. “Delius and Brahms.” Delius Society Journal no. 88 (1986): 21–22. A talk given by Roland Gibson to the Delius Society Midlands Branch, 20 April 1985.

499. Russell, Francis. “Some Musical Recollections.” Delius Society Journal no. 59 (1978): 5–8. At age eighty-two the author dictated these recollections of singing the tenor role in A Mass of Life (under Sir Thomas Beecham at the 1931 Leeds Festival and at the Albert Hall, 1946).

500. Sabine, Robert. “Bradford: In Search of Delius.” Delius Society Journal no. 62 (1979): 10–12. Among the disappointments of the author on a trip to Bradford seeking Delius-related sites and information was having to descend into the Bibliography 111

basement of a city building in order to view the famous James Gunn portrait of Delius.

501. Sabine, Robert. “Scarborough and Saxby All Saints.” Delius Society Journal no. 133 (2003): 24–26. Retraces Eric Fenby’s footsteps through his hometown of Scarborough. The author was able to meet Miss Alice Barton of Saxby Hall, Saxby All Saints, Lincolnshire, whose family had employed Joseph Taylor (the singer of the folk song used in Brigg Fair). Includes four illustrations.

502. Salmon, Michael. “A Window to English Music.” Delius Society Journal no. 51 (1976): 20–21. Describes the Finzi memorial window in the Parish Church of Ashmansworth, Berkshire. The window, designed by Laurence Whistler, LQFRUSRUDWHV WKH LQLWLDOV RI ¿IW\ (QJOLVK FRPSRVHUV ZKRVH QDPHV DUH SDLQWHGRQHLWKHUVLGHRIWKHZLQGRZ'HOLXVLVRQHRIWKH¿IW\FRPSRVHUV Includes a photograph of the window.

503. Sanderson, Terry. “Delius Association of Florida: Festival 2004.” Delius Society Journal no. 136 (2004): 85–89. Highlights from the festival held in Jacksonville, Florida.

504. Scott-Sutherland, Colin. “‘Spirit of Place’: Grez-sur-Loing.” Delius Society Journal no. 136 (2004): 41–48. Describes the attractions of Grez-sur-Loing not only for Frederick and Jelka Delius, but also for other artists.

505. Seeley, Paul. “Fritz Delius: The Bradford Years.” Delius Society Journal no. 58 (1978): 5–11. Gives a detailed account of the Delius family’s connections with Bradford. The author notes that at the time the article was written, there was virtually nothing commemorating Delius in Bradford. Includes references and two illustrations.

506. Simmons, David. “Bernard Hermann: A Personal Memoir.” Delius Society Journal no. 55 (1977): 16–19. Hermann was known for his devotion to British composers, including Delius. Simmons contrasts Hermann’s music with that of Delius.

507. Shore, Bernard. “Beecham Rehearses Paris.” Delius Society Journal no. 143 (2008): 53–56. 112 Frederick Delius: A Research and Information Guide

An excerpt from Shore’s volume of reminiscences on life as an orchestral viola player.

508. Sirbaugh, Nora. “Danish Saga: Performing Delius in Denmark.” Delius Society Journal no. 128 (2000): 17–23. A diary of the soprano Nora Sirbaugh’s recital tour to Denmark. The concert took place at the Drachmann Hus, and featured Delius’s settings of Drachmann.

509. Spicer, Paul. “Two Unaccompanied Partsongs: A Conductor’s Perspective.” Delius Society Journal no. 140 (2006): 61–65. Analysis of the two compositions written in 1917. Includes musical examples.

510. Stang, Rolf. “Delius in Danville: A Centenary Celebration.” Delius Society Journal no. 90 (1986): 13–17. Recounts events of the centenary festival held in Danville, Virginia, 24 February–2 March 1986.

511. Stang, Rolf. “Paa Vidderne in Historical Perspective.” Delius Society Journal no. 108 (1992): 3–8. Provides background information on Henrik Ibsen’s poem and Delius’s setting. Includes an English translation of the poem.

512. Stone, Mark. “Two of Delius’s Songs: The Mysteries.” Delius Society Journal no. 143 (2008): 123–126. Reveals some new information about the texts of the songs Over the Mountains High and $XVGHLQHQ$XJHQÀLHVVHQPHLQH/LHGHU.

513. Suddath, Richard H. “A Favour for a Friend: An Account of the Restoration of the Delius House.” Delius Society Journal no. 96 (1988): 3–7. Edited by Thomas H. Gunn, who provides an afternote. Suddath provides his account of the process used to relocate the Delius cottage from its original location on the St. Johns River to the grounds of Jacksonville University.

514. Tall, David. “The Fenby Legacy.” Delius Society Journal no. 61 (1978): 5–20. Bibliography 113

$VWXG\RI'HOLXV¶VGUDIWVDQGVNHWFKHVRQWKHRFFDVLRQRIWKH¿IWLHWK anniversary of the arrival of Fenby at Grez-sur-Loing.

515. Tall, David. “Five Little Pieces.” Delius Society Journal no. 56 (1977): 6–17. Description and commentary on the Five Pieces for Piano, later orchestrated by Eric Fenby. Includes musical examples.

516. Thomas, Claude Nathalie. “Bibka and Great Britain.” Delius Society Journal no. 140 (2006): 21–22. Reminiscences of the author’s aunt, Mme Anna Merle d’Aubigné (known as “Bibka”), who had purchased the former Delius home in Grez.

517. Thornton, R. K. R. “Whitman: Leaves of Grass and Sea Drift.” Delius Society Journal no. 139 (2006): 20–28. Examines the life of poet Walt Whitman in an effort to understand why Delius came to choose Whitman’s poetry as the text for Sea Drift. Includes two portraits of Whitman.

518. Threlfall, Robert. “After Editing Delius’s Hassan.” Delius Society Journal no. 64 (1979): 8–11. Describes the editorial and technical problems faced while preparing a printed orchestral score for Delius’s incidental music for Hassan.

519. Threlfall, Robert. “The Collected Edition: A Postscript.” Delius Society Journal no. 120 (1997): 32–33. A few supplementary volumes are to be issued for the collected edition RI'HOLXV¶VZRUNV7KH¿UVWYROXPHZLOOFRQWDLQWKHIXOOVFRUHRIPoem of Life and LoveOHIWXQ¿QLVKHGDW'HOLXV¶VGHDWK2WKHUYROXPHVDUHLQ preparation.

520. Threlfall, Robert. “Delius and Verlaine.” Delius Society Journal no. 127 (2000): 7–10. An examination of Delius’s settings of the poetry of Paul Verlaine, including one written many years later than the others (“Chanson d’automne”).

521. Threlfall, Robert. “Delius as They Saw Him: A Further Attempt at an Iconography.” Delius Society Journal no. 83 (1984): 5–18. 114 Frederick Delius: A Research and Information Guide

A chronological list of portraits. Each entry includes the artist’s name, date, size, description, provenance, and references to appearances in exhibition and the Delius literature. Includes seven photographs.

522. Threlfall, Robert. “Delius, Berlioz and the (French) Horn.” Delius Society Journal no. 123 (1998): 27–29. Examines the horn parts in the Florida Suite and speculates whether Delius actually acquired a copy of Berlioz’s Treatise on Modern Instrumentation and Orchestration while resident in America. A copy of the book held by Jacksonville University bears markings that point to possible ownership by Delius.

523. Threlfall, Robert. “Delius in London: 75 Years Later.” Delius Society Journal no. 43 (1974): 5–7. $VXUYH\RI'HOLXVZRUNVKHDUGLQ/RQGRQVHYHQW\¿YH\HDUVDIWHUWKH “notable one-man concert which publicly introduced the music of Delius to the land of his birth.”

524. Threlfall, Robert. “Delius’s Songs in His Own Orchestrations.” Delius Society Journal no. 142 (2007): 36–37. Delius’s songs with orchestral accompaniment can be considered the ¿UVW³PRGHUQ´RUFKHVWUDOVRQJV7KHRUFKHVWUDWLRQVRIWKH'DQLVKVRQJV add unexpected touches of color.

525. Threlfall, Robert. “Delius’s Student Exercises.” Delius Society Journal no. 104 (1990): 3–5. Examines Delius’s Leipzig sketchbooks and outlines some problems in dating the sketchbooks.

526. Threlfall, Robert. “Delius’s Violin Sonata (No. 1): Some Notes on the Notes.” Delius Society Journal no. 74 (1982): 5–12. A list and evaluation of available source material. Includes musical examples.

527. Threlfall, Robert. “An Early Manuscript Reappears.” Delius Society Journal no. 130 (2001): 19–21. Negro Songs appeared in some early listings of Delius’s works, and had been grouped with material from the opera Koanga. The manuscript has since been rediscovered, and Threlfall provides a complete description along with some discussion on the dating of the manuscript. Bibliography 115

528. Threlfall, Robert. “‘The Fenby Legacy’: A Postscript.” Delius Society Journal no. 124 (1998): 7–10. Summarizes the information surrounding Delius’s original sketches. The title of this article refers to an earlier study by David Tall of Delius’s drafts and sketches (see no. 514). References are given to Threlfall’s original catalog of works and supplement.

529. Threlfall, Robert. “Florida – Tropical Scenes for Orchestra.” Delius Society Journal no. 136 (2004): 37–40. Charts the history of this suite between its premiere (Leipzig, 1888) and the present day.

530. Threlfall, Robert. “Frederick Delius: Air and Dance, an Historical Note.” Delius Society Journal no. 109 (1992): 8–9. Traces the publication history and arrangements of this work for string orchestra.

531. Threlfall, Robert. “Hiawatha: A Postscript.” Delius Society Journal no. 143 (2008): 92. 3URJUHVVUHSRUWRQWKHSUHSDUDWLRQRIDGH¿QLWLYHVFRUHIRUWKLVXQSXEOLVKHG work. A full score has been issued as Supplementary Volume 6 of the Collected Edition (see no. 27).

532. Threlfall, Robert. “Hiawatha: A Tone Poem for Orchestra after Longfellow’s Poem.” Delius Society Journal no. 133 (2003): 7–10. A detailed study of the manuscript of this early work, which dates from Delius’s Leipzig period (January 1888). Includes a facsimile of the title page of the manuscript.

533. Threlfall, Robert. “A Note on Watawa: Last of Her Race?” Delius Society Journal no. 118 (1996): 34–35. Explains why the heroine of Delius’s second opera, The Magic Fountain, could not have been a Seminole Indian, even though that is the description Delius gave. The article also discusses Delius’s Paris friendship with the Canadian painter William Blair Bruce (1859–1906).

534. Threlfall, Robert. “A Note on the Copyright Position Regarding Delius’s Works.” Delius Society Journal no. 85 (1985): 5. Outlines the various copyright laws governing Delius’s printed musical works. 116 Frederick Delius: A Research and Information Guide

535. Threlfall, Robert. “Progress on the Collected Edition.” Delius Society Journal no. 91 (1986): 20–21. Outlines the progress being made on the publication of the collected edition of Delius’s works.

536. Threlfall, Robert. “Some Further Thoughts on Appalachia.” Delius Society Journal no. 141 (2007): 100–104. Threlfall provides an introduction to the reprint of Ernest Newman’s UHYLHZRIWKH¿UVW(QJOLVKSHUIRUPDQFHRIAppalachia, published in the Birmingham Post on 25 November 1907 (“Frederick Delius: A New English Composer”).

537. Threlfall, Robert. “Some Thoughts on Fennimore and Gerda.” Delius Society Journal no. 62 (1979): 5–7. Remarks on the opera.

538. Threlfall, Robert. “Some Thoughts on the Publications of Sea Drift.” Delius Society Journal no. 139 (2006): 30–37. Threlfall summarizes a number of details regarding Sea Drift, including the issue of the hyphen in the title, text underlay, changes to Delius’s orchestration, errors in the printed scores, and a brief survey on the various published editions.

539. Threlfall, Robert. “Sonata for String Orchestra.” Delius Society Journal no. 57 (1977): 4–6. Discusses Eric Fenby’s transcription of the 1916 String Quartet for string orchestra.

540. Threlfall, Robert. “A Village Romeo and Juliet: A Lyric Drama in Six Scenes by Frederick Delius.” Delius Society Journal no. 134 (2003): 7–20. This study of Delius’s opera focuses on the manuscript orchestral parts, transferred in 2002 to the Delius Trust Archive by the present copyright holder, Boosey & Hawkes. Threlfall gives an introduction to the work, outlines changes made to the music and staging (including a list of WKHSULQFLSDOPRGL¿FDWLRQVWRWKHPXVLFDOWH[WLQFRPSDULVRQZLWKWKH RULJLQDO YRFDO VFRUH DQG WKH ODWHU GH¿QLWLYH LVVXHV  DQG GHVFULEHV WKH history and fate of the original performance parts, manuscript full score, and early vocal scores. Illustrated with two facsimiles from the “Paris Version” of the work’s vocal score, one musical example, and a picture of Leslie Hurry’s set design for scene six from the Delius Centenary Festival production, Bradford and Sadler’s Wells. Bibliography 117

541. Threlfall, Robert. “A Village Romeo and Juliet at Darmstadt: A Note on the Music.” Delius Society Journal no. 72 (1981): 13–14. Describes cuts made to the music to reduce the overall length of the opera to one and one-half hours for this production.

542. Threlfall, Robert, and Stephen Lloyd. “When did the Air Acquire a Dance?” Delius Society Journal no. 140 (2006): 103–104. The original manuscript of Air and Dance consists of seventy bars; however, the published version was ninety-six bars in length. Correspondence reveals that Delius was uncertain over the ending but unable to go about altering it. The authors surmise that Eric Fenby must KDYHEHHQWKHP\VWHU\FROODERUDWRULQSURGXFWLRQRIWKHGH¿QLWLYHVFRUH

543. Torrens, Hugh. “A Delius Disciple in New Zealand.” Delius Society Journal no. 135 (2004): 36–38. Recorded in the journal of Frederick Page (1905–1983) was his love of Delius’s music. Includes a reproduction of a note received by Page from Delius.

544. Tyre, J. Bennet. “Coming to America? Delius’s War, Horatio Parker, and Two Songs for Children.” Delius Society Journal no. 137 (2005): 23–40. Explores the relationship between Delius and American composer Horatio Parker and the genesis of Two Songs for Children. Includes several illustrations and musical examples.

545. Vernon, Peter. “Delius’s Second Burial.” Delius Society Journal no. 57 (1977): 8–10. *LYHV DQ DFFRXQW RI 'HOLXV¶V UHEXULDO LQ WKH FHPHWHU\ DW /LPSV¿HOG Surrey. Includes directions to the gravesite.

546. Walker, Malcolm. “Unpublished Delius Recordings.” Delius Society Journal no. 45 (1974): 6–7. A survey of unreleased recordings providing matrix numbers (when known) and dates. Additions to the list are given in issue no. 47.

547. White, John. “Delius and America.” Delius Society Journal no. 141 (2007): 26–31. Explores Delius’s trips to America and the compositions that resulted from these trips. Although Sea Drift is arguably Delius’s greatest 118 Frederick Delius: A Research and Information Guide

American work, Appalachia is his ultimate tribute to Florida and his time spent there.

548. White, John. “The Delius Concertos: A Survey,” parts 1 and 2. Delius Society Journal no. 125 (1999): 8–14; no. 126 (1999): 30–37. Part one of the article traces the origin and evolution of the three versions of Delius’s Piano Concerto. The second part covers the Double Concerto, Violin Concerto, and Cello Concerto. Includes musical examples and references.

549. White, John. “The Hidden Meaning of An Arabesque.” Delius Society Journal no. 142 (2007): 62–72. $VKRUWHQHGYHUVLRQRIDQDUWLFOHWKDW¿UVWDSSHDUHGLQLVVXHQRV and 120. This composition provides a challenge to listeners because of its infrequent performance and to interpreters as well, due to the large performing forces required. Appended to the article is a translation by Jeremy Lee-Browne of Jacobsen’s original poem.

550. White, John. “The Metamorphosis of Margot.” Delius Society Journal no. 132 (2002): 21–32. Explains how the text of Idyll (Once I Passed through a Populous City) was compiled by Robert Nichols from works by Walt Whitman. Includes a chart listing the Whitman source, line text, and text of the Nichols adaptation, and a comparison of Margot la Rouge (the source of the Idyll music), the Prelude, and Idyll.

551. White, John. “Record Review.” Delius Society Journal no. 74 (1982): 12–15. Feature review of “The Fenby Legacy” (Unicorn-Kanchana DKP 9008/09; see no. D120). Includes one photograph from the recording session.

552. White, John. “Some Thoughts on A Village Romeo and Juliet and the Nature of Criticism.” Delius Society Journal no. 110 (1993): 19–22. Raises questions about several points in the program notes by Christopher Palmer, which accompany the Decca videorecording of the opera.

553. White, John. “Words without Music: The Literary Sources of the Delius Operas.” Delius Society Journal no. 135 (2004): 7–31. Bibliography 119

A comprehensive analysis of the literary sources of Delius’s six operas.

554. White, John. “Worth a Guinea in a Box.” Delius Society Journal no. 67 (1980): 10–13. The author feels that reception of a composer’s music is facilitated by knowledge of it, and thus questions the inclusion of a reprint of Sir Thomas Beecham’s biography of Delius in a recent EMI boxed recording set release. He recommends the recently published Delius: A Life in Pictures (see no. 847) as a “corrective” remedy.

555. Winstanley, Stewart. “Elegy for the Common Man.” Delius Society Journal no. 133 (2003): 11–12. Speculates that St. Leonard’s Church, Chapel-Le Dale, Yorkshire, may have been the inspiration for Delius’s Elegy for solo violoncello and chamber orchestra.

 :LQVWDQOH\6WHZDUW³/LPSV¿HOG5HYLVLWHG´Delius Society Journal no. 129 (2001): 35–39. Recounts the author’s visit to the Delius gravesite at St. Peter’s Church, /LPSV¿HOG6XUUH\(QJODQG,QFOXGHVUHIHUHQFHVDQGWZRLOOXVWUDWLRQV

557. Wright, R. O. “Deryck Cooke (1919–1976): A Personal Tribute.” Delius Society Journal no. 54 (1977): 12–16. Recounts Cooke’s contributions to Delius scholarship and his admiration for Delius’s music.

Delius Society Meeting Summaries Published in The Delius Society Journal

558. “Appalachia.” Delius Society Journal no. 107 (1991): 8. Summary of a talk given by John White, 3 October 1990.

559. “Charles Barnard on the Life of Granville Bantock.” Delius Society Journal no. 114 (1994): 17–18. Summary of a talk given at the Midlands Society Branch meeting.

560. “Conductors I Have Known.” Delius Society Journal no. 93 (1987): 3–6. Report of a talk given by Eric Fenby to the Delius Society, 22 October 1986. Fenby reminisces about various conductors he had known or worked with, giving particular attention to the works of Delius in their repertoire. 120 Frederick Delius: A Research and Information Guide

561. “Delius at the Piano.” Delius Society Journal no. 101 (1989): 9–10. Summary of the presentation given by Robert Threlfall, 28 October 1988.

562. “The Delius–Warlock Piano Transcriptions.” Delius Society Journal no. 101 (1989): 11–12. Summary of a presentation by Fred Tomlinson and Lionel Carley, given 22 March 1989.

563. “Eric Fenby on Elgar.” Delius Society Journal no. 59 (1978): 13–14. Summary of a talk given by Fenby to a combined meeting of the Delius DQG(OJDU6RFLHWLHV$W¿UVWJODQFHWKHWZRFRPSRVHUVZRXOGVHHPWR have little in common, but their music shows some interesting parallels.

564. “Felix Aprahamian.” Delius Society Journal no. 104 (1990): 6–7. Felix Aprahamian’s memories of Delius were recorded in this report of a talk given to the Delius Society, 8 November 1989.

565. “Margaret Harrison on Her Sister May.” Delius Society Journal no. 107 (1991): 7–8. Summary of a talk given by Margaret Harrison to the Delius Society, 25 April 1990.

566. “Memories of Irmelin.” Delius Society Journal no. 107 (1991): 8–10. Summary of a talk given by to the Delius Society, 29 January 1991. Round sang the role of Nils in Beecham’s 1953 Oxford production of the opera. Includes a reproduction of the opera handbill.

567. “Norman O’Neill and Friends.” Delius Society Journal no. 107 (1991): 10–11. Summary of a talk given to the Delius Society, 30 April 1991, by O’Neill’s granddaughter Katherine Jessel. Norman O’Neill was one of Delius’s closest friends and a member of the “” of composers.

568. “‘Please, no Delius!’“ Delius Society Journal no. 101 (1989): 10–11. Summary of a talk given by Harry Legge, former viola player in Beecham’s Royal Philharmonic Orchestra, 10 January 1989. Bibliography 121

569. “A Singer’s Life.” Delius Society Journal no. 101 (1989): 12–13. Summary of a talk given by the baritone and noted Delius interpreter Roy Henderson, 25 April 1989.

570. Armour-Chélu, Jane. “Delius’s Songs: No Longer Neglected?” Delius Society Journal no. 131 (2002): 51–52. Summary of a talk on the recording history of the songs, given by Lyndon Jenkins to the Delius Society, 22 November 2001.

571. Armour-Chélu, Jane. “‘From the Archive’ by Paul Guinery.” Delius Society Journal no. 127 (2000): 41–42. Summary of a presentation given to the Delius Society, London, 3 February 2000, featuring notable broadcast and recording excerpts.

572. Baker, James. “‘Some Less Appreciated Aspects of Delius’: A Talk by Tony Summers.” Delius Society Journal no. 136 (2004): 66–68. Summary of a talk given to the Delius Society on 20 April 2004.

573. Boden, Anthony. “‘Balfour Gardiner—Friend of Delius’: A Talk by Stephen Lloyd.” Delius Society Journal no. 131 (2002): 45–48. Summary of a talk given to the Delius Society, 20 September 2001.

574. Buckley, Roger. “Delius and Fenby: A Photographic Journey.” Delius Society Journal no. 137 (2005): 111–113. Summary of a presentation given by Lyndon Jenkins and Paul Guinery for the Delius Society London Branch meeting, 19 April 2005.

575. Buckley, Roger. “‘My Compositional Involvement with Delius’: A Talk by the Composer Anthony Payne.” Delius Society Journal no. 131 (2002): 44–45. Summary of a talk given to the Delius Society, 24 April 2001.

576. Carley, Lionel. “Scandal in Christiania: The Story of Folkeraadet.” Delius Society Journal no. 59 (1978): 15–16. Summary of a lecture given by Dr. Carley to the Delius Society, 25 January 1978. In 1896 the Norwegian dramatist Gunnar Heiberg commissioned Delius to write incidental music for Folkeraadet, his satire on the Norwegian parliamentary system. Delius set the Norwegian national anthem in a minor key and used it as a funeral march, upsetting the citizenry. 122 Frederick Delius: A Research and Information Guide

577. Chennell, Paul. “A Breath of Fresh Mountain Air: The Friendship of Delius and Grieg.” Delius Society Journal no. 143 (2008): 137–138. Summary of a talk given by Roger Buckley to the Delius Society London Branch, 18 October 2007.

578. Chennell, Paul. “‘Margot la Rouge: A Talk on Delius’s Opera’ by Roger Buckley.” Delius Society Journal no. 129 (2001): 59–60. Summary of a talk given to the Delius Society, London, 6 February 2001.

579. Cox, Derek. “West of England Branch Meeting.” Delius Society Journal no. 127 (2000): 35. A report of the orchestral workshop that featured a rehearsal and “play- through” of Delius’s North Country Sketches.

580. Dunn, Brian. “‘Fifty Years of Iconoclasm’: A Talk by Rodney Meadows.” Delius Society Journal no. 131 (2002): 48–49. Summary of a talk given to the Delius Society Midlands Branch meeting, 20 October 2001.

581. Eastwood, Diane. “‘Strindberg, Delius and Their Friends’: A Talk by Christopher Redwood.” Delius Society Journal no. 137 (2005): 83–86. Summary of a talk given at the Delius Society West of England Branch Meeting, 5 March 2005.

582. Graham, John. “‘Frederick Delius, Friends and Associations’: A Talk by Anthony Lindsay.” Delius Society Journal no. 136 (2004): 58–59. Summary of a talk given 13 March 2004. Lindsay considered two IULHQGVLQÀXHQFHGE\'HOLXV 3KLOLS+HVHOWLQHDQG(ULF)HQE\ DQGWKH association of Scandinavia with Delius.

583. Green, David. “‘Delius and Elgar: Triumphs and Tragedies’: A Talk by Ian Lace.” Delius Society Journal no. 138 (2005): 106–108. Summary of a talk given to the Delius Society London Branch, 15 March 2005.

584. Green, Michael. “Delius: A Young Person’s View.” Delius Society Journal no. 137 (2005): 66–68. Summary of a presentation given by James Baker and Joanna O’Connor to the Delius Society London Branch, 10 February 2004. Bibliography 123

585. Green, Michael. “‘Dr. Louis Boyd Neel OBE (1905–1981)’: A Talk by Dr. David Green.” Delius Society Journal no. 142 (2007): 122–124. Summary of a talk given at the Delius Society London Branch meeting, 29 March 2007. Neel, a conductor, admired Delius and recorded the Two Aquarelles.

586. Green, Mike. “Delius’s Symphony for Two Orchestras: The Song of the High Hills.” Delius Society Journal no. 137 (2005): 77–80. Summary of a talk given by Robert Matthew-Walker at the Delius Society London Branch meeting, 18 November 2004.

587. Guinery, Paul. “‘A Delius Miscellany.’” Delius Society Journal no. 128 (2000): 40–42. Summary of a presentation given by Robert Threlfall to the Delius Society, London, on 21 March 2000.

588. Guinery, Paul. “On the Trail of Delius in Europe and America.” Delius Society Journal no. 129 (2001): 49–51. Summary of a presentation by Lionel Carley on his books and work for the Delius Trust, given to the Delius Society on 20 September 2000.

589. Guinery, Paul. “A Second Delius Miscellany: Looking at Some Less Familiar Works.” Delius Society Journal no. 131 (2002): 54–56. Summary of a presentation given by Robert Threlfall to the Delius Society, 12 February 2002.

590. Harvey, Raymond. “Delius in His Historical Setting.” Delius Society Journal no. 62 (1979): 12–15. Summary of a lecture given to the Delius Society by Roland Gibson, 23 February 1978. Discusses Delius’s contemporaries Richard Wagner, .DUO0DU[DQG)ULHGULFK1LHW]VFKHDQGWKHLULQÀXHQFHRQ'HOLXV

591. Jenkins, Lyndon. “‘Historic Delius Archive Recordings’ by Paul Guinery.” Delius Society Journal no. 125 (1999): 23–24. Summary of a talk given to the Delius Society, 26 November 1998.

592. Jenkins, Lyndon. “A Poem of Life and Love and Other Transcriptions.” Delius Society Journal no. 120 (1997): 42. Summary of a talk given to the Delius Society Midlands Branch, 23 November 1996. 124 Frederick Delius: A Research and Information Guide

593. Kitching, Richard. “‘Arrangements of Delius: Some Personal Views’ by Tony Summers.” Delius Society Journal no. 126 (1999): 43. Summary of a program given to the Delius Society, 18 March 1999.

594. Kitching, Richard. “Delius and Elgar.” Delius Society Journal no. 103 (1990): 20. Summary of a talk given by Christopher to the Delius Society, Midlands Branch, 14 October 1989.

595. Kitching, Richard. “Delius and La Belle Dame Sans Merci: The Hidden Meanings of An Arabesque.” Delius Society Journal no. 118 (1996): 47–48. Summary of a talk given by John White to the Delius Society Midlands Branch on 19 June 1994. The full text of the talk, split into two parts, appears in the following two issues (no. 119, pp. 7–15 and no. 120, pp. 11–22).

596. Kitching, Richard. “Delius, Wagner, .” Delius Society Journal no. 107 (1991): 14. Summary of a talk given by Fred Clements to the Delius Society Midlands Branch, 18 May 1991.

597. Kitching, Richard. “Delius’s Musical Apprenticeship.” Delius Society Journal no. 115 (1994): 16–17. Summary of a talk given by Robert Threlfall to the Delius Society Midlands Branch, 12 November 1994.

598. Kitching, Richard. “George Little: My Life with Fred.” Delius Society Journal no. 114 (1994): 14–15. Summary of a talk given by actor George Little to the Delius Society Midlands Branch, 23 October 1993.

599. Kitching, Richard. “‘Ida Gerhardi: Her Life and Paintings’ by Jerry Rowe.” Delius Society Journal no. 124 (1998): 27–28. Summary of a talk given to the Delius Society Midlands Branch (18 October 1997) and London Branch (23 April 1998).

600. Kitching, Richard. “‘An Introduction to Peter Warlock’s Music’ by Brian Collins.” Delius Society Journal no. 119 (1996): 35–36. Bibliography 125

Summary of a talk given to the Delius Society Midlands Branch, 2 March 1996.

601. Kitching, Richard. “Lionel Carley on Edvard Munch.” Delius Society Journal no. 110 (1993): 23–24. Summary of a talk given to the Midlands Branch, 10 October 1992.

602. Kitching, Richard. “‘Nothing so Charming as Musick’: An Illustrated Talk on the Life of Frederic Austin.” Delius Society Journal no. 127 (2000): 38–40. 7KH DXWKRU LV WKH JUDQGVRQ RI $XVWLQ ZKR JDYH WKH ¿UVW (QJOLVK performance of Sea Drift. Austin and Delius remained friends until Delius’s death.

603. Kitching, Richard. “Unto Brigg Fair.” Delius Society Journal no. 95 (1988): 7. Report of a talk given by John Bird to the Delius Society, Midlands Branch, 8 March 1986 about Percy Grainger and collecting folk songs, including Brigg Fair.

 /HH%URZQH0DUWLQ³µ7KH'HOLDQ,QÀXHQFH¶$7DONE\5RJHU%XFNOH\ Delius Society Journal no. 141 (2007): 109–113. Summary of a talk given to the Delius Society London Branch, 7 'HFHPEHU  %XFNOH\ VXUYH\HG WKH PXVLFDO IRUFHV WKDW LQÀXHQFHG 'HOLXV DQG LQ WXUQ KRZ 'HOLXV¶V PXVLFDO VW\OH LQÀXHQFHG RWKHU FRPSRVHUVSOXVVRPH¿OPPXVLFSRSXODUPXVLFDQGMD]]FRQQHFWLRQV

605. Lee-Browne, Martin. “‘Delius in Watford’: A Talk by Lewis Foreman.” Delius Society Journal no. 137 (2005): 81–82. Summary of a talk given to the Delius Society London Branch, 15 February 2005.

606. Lee-Browne, Martin. “‘Fifty Delius Years’: A Talk by Lyndon Jenkins.” Delius Society Journal no. 139 (2006): 118–120. Summary of a talk given to the Delius Society London Branch, 21 February 2006.

607. Lee-Browne, Martin. “Which Other Composers Did Delius Admire?” Delius Society Journal no. 143 (2008): 135–137. Summary of a talk given to the Delius Society London Branch, 27 126 Frederick Delius: A Research and Information Guide

September 2007. Delius was often contradictory in his assessment of other composers; however, he was shown to admire Chopin, Grieg, and Wagner, and admired many French composers

608. Lindsey, Anthony. “‘A Centenary Tribute to Leon Goossens’ by Carole Rosen.” Delius Society Journal no. 120 (1997): 43–46. Summary of a talk given to the Delius Society, 28 January 1997.

609. Lindsey, Anthony. “‘Music and History’: The Great War: A Talk by Ian Walker.” Delius Society Journal no. 141 (2006): 104–106. Summary of a talk given to the Delius Society London Branch meeting, 27 September 2006.

610. Lloyd, Stephen. “Delius and Grainger.” Delius Society Journal no. 67 (1980): 15–20. Summary of a talk given by John Bird to members of the Delius and Grainger Societies on 20 February 1980. Includes a facsimile of a concert program (Carnegie Hall, 30 April 1924) that featured American premieres of North Country Sketches and The Song of the High Hills, and a reprint of Grainger’s program note for a performance of Brigg Fair at the Hollywood Bowl, August 1928.

611. Lloyd, Stephen. “Delius Society Meeting.” Delius Society Journal no. 127 (2000): 36–38. The meeting held on 26 October 1999 featured the speaker Leslie Head talking about his musical life and conducting the works of Delius and other English composers.

612. Lloyd, Stephen. “Ida Gerhardi.” Delius Society Journal no. 74 (1982): 16–19. Summary of a talk given to the Delius Society, London, 5 June 1981. Evelin Gerhardi and Malve Steinweg presented a program of slides illustrating the work of Ida Gerhardi, their aunt and close friend of the Deliuses. Includes two photographs.

613. Lloyd, Stephen. “The Missing Years.” Delius Society Journal no. 97 (1988): 7–10. Summary of a talk given by Eric Fenby to the Delius Society, 27 October 1987, recounting Fenby’s activities after the death of Delius, including the arrangement of the exhumation of Delius’s body for reburial in England, the writing of his book on Delius, his lectures on Delius, and various other activities. Bibliography 127

614. Meadows, Rodney. “‘Delius in Performance and Copyright’ by Robert Montgomery.” Delius Society Journal no. 125 (1999): 22. Summary of a talk given to the Delius Society, 27 October 1998.

615. Newham, Godfrey. “Song of Life’s Joy.” Delius Society Journal no. 111 (1993): 19–20. Report of David Stone’s presentation on the life and works of Delius, a “thumb-nail sketch of a citizen of the world” given at the Metropole Arts Centre, Folkstone.

616. Osborne, Ray. “‘A Ramble Around Delius’: A Talk by Lyndon Jenkins.” The Delius Society Journal no. 135 (2004): 55–56. Summary of a talk given 17 January 2004 that focused on the debt Delius owed to Sir Thomas Beecham and Eric Fenby.

617. Parsons, Graham. “A Bitter Truth: Some British Composers and the Great War.” Delius Society Journal no. 129 (2001): 54–55. Summary of a talk given by Peter Harris to the Delius Society Midlands Branch, 4 November 2000.

618. Parsons, Graham. “‘Elgar and Delius: Enigma and Cosmopolitan’ by Lyndon Jenkins.” Delius Society Journal no. 123 (1998): 40–41. Summary of a talk given to the Delius Society Midlands Branch, 14 March 1998. A study of the two composers’ lives reveals many parallels.

619. Parsons, Graham. “A Recital by Bobby Chen (Piano).” Delius Society Journal no. 142 (2007): 124–125. The Midlands Branch hosted pianist Bobby Chen, whose program featured the Three Preludes and “Toccata” from the Five Piano Pieces.

620. Prentice, Ron. “Good Friends: Granville Bantock and Frederick Delius.” Delius Society Journal no. 130 (2001): 37–38. Summary of a talk given by Ronald Bleach (Elgar Society S.W. Branch Chairman) to the Delius Society West of England Branch, 17 March 2001.

621. Prentice, Ron. “A Recital by Christopher Redwood and Robert Threlfall.” Delius Society Journal no. 125 (1999): 26. Report of a program given for the Delius Society West of England Branch, 21 March 1999. The program included early piano pieces and 128 Frederick Delius: A Research and Information Guide

songs by Delius; comparisons were made with settings of the same texts by other composers.

622. Prentice, Ron. “Recital by Robert Threlfall (Piano) and Christopher Redwood (Tenor).” Delius Society Journal no. 128 (2000): 43. The program given to the West of England Branch included a piano solo version of On Hearing the First Cuckoo in SpringWKH¿YHMaud songs (from Tennyson), and Threlfall’s Scenes from the Operas (excerpts from Margot la Rouge and Irmelin).

623. Prentice, Ron. “Sakuntala and Other Songs Performed by Christopher Redwood and Robert Threlfall.” Delius Society Journal no. 130 (2001): 38. Summary of the program presented to the West of England Branch on 8 April 2001.

624. Radford, Brian. “Beecham, Derby and Delius.” Delius Society Journal no. 107 (1991): 13–14. Summary of a talk given by Denham Ford to the Delius Society Midlands Branch, 27 October 1990.

625. Radford, Brian. “‘Brigg Fair in Words and Music’ by Robert Matthew- Walker.” Delius Society Journal no. 123 (1998): 36. Summary of a talk given to the Delius Society, 4 December 1997. An expanded version appears in issue no. 129 (see no. 440).

626. Radford, Brian. “Delius, Grez and the Scandinavian Connection.” Delius Society Journal no. 118 (1996): 40–44. Summary of a talk given by Lionel Carley to the Delius Society, 9 November 1995.

627. Radford, Brian. “‘Delius, Paris and the ¿QGHVLqFOH’ by John White.” Delius Society Journal no. 126 (1999): 44–45. Summary of a talk given to the Delius Society Midlands Branch, 20 March 1999.

628. Radford, Brian. “Delius Society (Midlands Branch) Meeting.” Delius Society Journal no. 119 (1996): 28–32. Summary of a talk titled “The Text of A Mass of Life” by Jonathan Maddox, given 8 April 1995. Bibliography 129

629. Radford, Brian. “Delius Society Meeting.” Delius Society Journal no. 120 (1997): 34–38. Summary of a symposium presented by Lyndon Jenkins and Stephen Lloyd marking Eric Fenby’s ninetieth year.

630. Radford, Brian. “Delius Society Meeting.” Delius Society Journal no. 136 (2004): 60–64. Summary of an interview conducted by Lyndon Jenkins with English baritone Thomas Hemsley, 18 March 2004.

631. Radford, Brian. “Delius—the European Connection: A Talk by Tony Summers.” Delius Society Journal no. 133 (2003): 31–34. Summary of a talk given to the Delius Society, 26 November 2002. Compares Delius’s music with that of several of his contemporaries, including Zoltán Kodály, , Claude Debussy, and Richard Strauss.

632. Radford, Brian. “‘Frederick Delius: Some Friends and Associations’: A Talk by Tony Lindsey.” Delius Society Journal no. 139 (2006): 106–108. Summary of a talk given to the Delius Society London Branch meeting, 20 September 2005. Lindsey considered several friends and associations with Delius, including Albert Sammons, Philip Heseltine, William Lloyd Webber, Edvard Grieg, the composers of the “Frankfurt Group,” Sir Thomas Beecham, and Eric Fenby.

633. Radford, Brian. “In a Summer Garden.” Delius Society Journal no. 84 (1984): 14–15. Summary of a talk given by Barry Iliffe to the Delius Society Midlands Branch about Delius’s tone poem In a Summer Garden.

634. Radford, Brian. “‘The Music of Peter Warlock: The Delius Connection’ by Dr. Brian Collins.” Delius Society Journal no. 120 (1997): 39–41. Summary of a talk given to the Delius Society, 12 November 1996. Dr. Collins served as chairman of the Warlock Society and author of Peter Warlock, the Composer (Scolar, 1995).

635. Radford, Brian. “Paris: An Evocation and Tribute to a Great Work.” Delius Society Journal no. 129 (2001): 51–54. Summary of a presentation given by Derek Cox and Paul Guinery to the Delius Society, London, 19 October 2000. 130 Frederick Delius: A Research and Information Guide

636. Radford, Brian. “A Programme of Video Films.” Delius Society Journal no. 126 (1999): 46. Describes several Delius-related videos viewed at a recent Midlands %UDQFKPHHWLQJ $SULO D¿OPRISea Drift produced for Swedish television (1987); a documentary on the making of a Dinemec Classics disc of Delius’s works; a video made by Richard Kitching at the 39th Annual Delius Festival in Jacksonville, Florida; and the documentary Discovering Delius made for the Delius Trust (1993, see no. 1811).

637. Radford, Brian. “A Recital by Shula Oliver and Anya Fadina.” Delius Society Journal no. 142 (2007): 127–128. The Midlands Branch hosted the violinist Shula Oliver (2005 Delius 3UL]H¿QDOLVW ZKRSHUIRUPHG'HOLXV¶VLégende and the Violin Sonata no. 1, among other works.

638. Radford, Brian. “‘A Sense of Place’ by Rachel Lowe and Roger Buckley.” Delius Society Journal no. 119 (1996): 24–28. Summary of a talk given to the Delius Society on 7 March 1996. A discussion of Delius’s travel diaries, including the “Red Notebook” housed at the Grainger Museum in Melbourne, Australia.

639. Radford, Brian. “‘Songs of Farewell’: A Talk by Michael Green.” Delius Society Journal no. 118 (1996): 44–46. Summary of a talk given to the Delius Society, 5 December 1995.

640. Radford, Brian. “Songs of Grieg and Delius.” Delius Society Journal no. 114 (1994): 3–4. Summary of a lecture-recital given by Beryl Foster to a joint meeting of the Grieg, Delius and Anglo-Norse Societies.

641. Radford, Brian. “Walt Whitman and Delius.” Delius Society Journal no. 114 (1994): 9–12. Summary of a talk given by Dawn Redwood to the Delius Society Midlands Branch, 27 March 1993.

642. Redwood, Christopher. “Delius Society Lecture by Professor Arthur Hutchings.” Delius Society Journal no. 49 (1975): 6–9. Report of a lecture given 16 January 1975. Professor Hutchings spoke on Delius’s harmonic style and gave his recollections of the 1929 Delius Festival and meeting Delius at Grez. Bibliography 131

643. Redwood, Christopher. “Henry Balfour Gardiner.” Delius Society Journal no. 52 (1976): 13–14. Summary of a presentation given by Stephen Lloyd at a Delius Society meeting, 25 March 1976.

644. Redwood, Christopher. “Visit of Mr. Vernon Handley to the Society.” Delius Society Journal no. 43 (1974): 24–25. Summary of the conductor Vernon Handley’s remarks given at the Holborn Library, 28 November 1973.

645. Rowe, E. E. “‘—Delius’s Danish Contemporary’ by Graham Parsons.” Delius Society Journal no. 130 (2001): 39–40. Summary of a talk given to the Delius Society Midlands Branch, 21 April 2001. Although there is no evidence that Nielsen and Delius ever met, WKH\ZHUHERWKDWWUDFWHGWRDQGLQÀXHQFHGE\WKHVDPH'DQLVKZULWHUV

646. Rowe, E. E. “‘The Double Concerto, Margot la Rouge, and the Idyll’: A Personal View.” Delius Society Journal no. 114 (1994): 12–14. Summary of a talk given by Richard Kitching to the Delius Society Midlands Branch, 24 April 1993. Includes bibliographical references.

647. Rowe, E. E. “Song Recital.” Delius Society Journal no. 128 (2000): 47–48. Nora Sirbaugh (mezzo-soprano) and Roger Buckley (piano) presented a program to the Midlands Branch, 13 May 2000. The program featured four Scandinavian songs, four Verlaine settings, and Sakuntala.

648. Rowe, E. E. “Tales of Adventure.” Delius Society Journal no. 73 (1981): 20–21. Summary of a talk given by Barrie Iliffe on the orchestral work Eventyr at a Delius Society Midlands Branch meeting.

649. Rowe, Jerry. “‘Florent Schmitt’ by Brian Radford.” Delius Society Journal no. 119 (1996): 32–34. Summary of a talk given to the Delius Society Midlands Branch, 22 October 1996.

650. Rowe, Jerry. “‘Florent Schmitt’ by David Eccott.” Delius Society Journal no. 119 (1994): 21–24. Summary of a talk given to the Delius Society on 25 January 1996. The 132 Frederick Delius: A Research and Information Guide

summary is followed by Felix Aprahamian’s recollections of meeting Schmitt.

651. Rowe, Jerry. “Lionel Carley on Delius’s Village.” Delius Society Journal no. 122 (1997): 30–31. Summary of a talk to the Delius Society Midlands Branch, 22 March 1997 about Grez-sur-Loing and its artist colony.

652. Salmon, Michael. “Mrs. Dawn Redwood on Delius and Flecker” at Holborn, January 28th 1977.” Delius Society Journal no. 55 (1977): 21–22. Summary of Redwood’s presentation on the relationship of Delius’s music to Flecker’s words in Hassan.

653. Summers, Tony. “‘Conducting Delius and Others’: A Talk by Christopher Slater.” Delius Society Journal no. 137 (2005): 68–69. Summary of a talk given at the Delius Society London Branch meeting, 21 September 2004.

654. Summers, Tony. “‘Constant Lambert, Delius and Jazz’: A Talk by Stephen Lloyd.” Delius Society Journal no. 139 (2006): 109–111. Summary of a talk given to the Delius Society London Branch, 18 October 2005. Lloyd explored Lambert’s many achievements as a composer, broadcaster, writer, journalist, conductor, and jazz enthusiast. Lambert was known to be interested in Delius, and conducted several of his works.

655. Summers, Tony. “‘Historic Delius Archive Recordings’ Presented by Paul Guinery.” Delius Society Journal no. 131 (2002): 49–50. Summary of a talk given to the Delius Society, 23 October 2001. Some of the audio clips featured Margaret Vessey (Delius’s cousin), Eric Fenby, and other various British musicians.

656. Threlfall, Robert. “Delius Society Meeting.” Delius Society Journal no. 130 (2001): 36–37. Summary of the program presented by Alan Rowlands on 15 March 2001, featuring piano transcriptions of On Hearing the First Cuckoo in Spring, In a Summer Garden, and Brigg Fair.

657. Trotman, Peter. “Brigg Fair and In a Summer Garden.” Delius Society Journal no. 115 (1994): 15–16. Bibliography 133

Summary of a talk given by Lyndon Jenkins to the Delius Society Midlands Branch, 8 October 1994.

658. Walker, Ian. “The Delius Requiem—Neglected Masterpiece or . . . ?” Delius Society Journal no. 139 (2006): 113–117. Summary of a talk given by Tony Summers to the Delius Society London Branch meeting, 8 December 2008. Includes a facsimile of the program for a performance by the Liverpool Philharmonic Choir and Orchestra conducted by Charles Groves and a reprint of a program note by A. K. Holland for that same 1965 performances.

659. Walker, Ian. “Song of Farewell.” Delius Society Journal no. 143 (2008): 140–141. At the meeting of the London Branch, 22 January 2008, the Yorkshire 7HOHYLVLRQ¿OPSong of Farewell was shown, along with a talk by the ¿OP¶VGLUHFWRU1LFN*UD\

660. Walker, Malcolm. “An Evening with Norman Del Mar.” Delius Society Journal no. 71 (1981): 19–20. A summary of the conductor and Delius Society Vice President Del Mar’s talk on the music of Delius.

661. Watts, Tony. “Delius Society (West of England) Branch Meeting.” Delius Society Journal no. 136 (2004): 65–66. Summary of “Delius: A Young Person’s View” presented by James Baker and Joanna O’Connor.

662. Watts, Tony. “‘The Music of Delius, His Friends and Acquaintances’: A Talk by Ron Prentice.” Delius Society Journal no. 142 (2007): 120–121. Summary of a talk given at the Delius Society West of England Branch meeting, 17 March 2007.

663. Watts, Tony. “West of England Branch.” Delius Society Journal no. 139 (2006): 120–123. Summary of a talk given by Ian Lace about Delius and Elgar; the title of the talk is incorrectly given at the head of the article as “‘Frederick Delius: Some Friends and Associations’: A Talk by Tony Lindsey.”

664. White, John. “Delius and La Belle Dame Sans Merci: The Hidden Meanings of An Arabesque,” parts 1 and 2. Delius Society Journal no. 119 (1996): 7–15; no. 120 (1997): 11–22. 134 Frederick Delius: A Research and Information Guide

Text of a talk given to the Delius Society Midlands Branch, 19 June 7KH¿UVWSDUWRIWKHDUWLFOHFRQWDLQVDFRPSDULVRQRIWKHZRUGV and music of An Arabesque. The second part of the article looks at the literary background and the poem’s possible meanings. The original text of J. P. Jacobsen’s poem (En Arabesk) follows the article, along with a German translation and a literal English translation by Jelka Delius, and Philip Heseltine’s English translation as amended by Sir Thomas Beecham.

Reviews of Performances

Reviews of historical events that pre-date the Journal are contained in the list of articles above.

665. “Cynara.” Delius Society Journal no. 142 (2007): 137–138. Report of a performance featuring and the Boston Symphony Orchestra conducted by Mark Elder given 15 July 2007 at Tanglewood, Lennox, Massachusetts. Following the report is an excerpt about Cynara drawn from Eric Fenby’s Delius As I Knew Him (see no. 851).

666. “Delius: Songs of Farewell.” Delius Society Journal no. 111 (1993): 22–23, 5HYLHZ RI D SHUIRUPDQFH E\ WKH:D\QÀHWH6LQJHUV 6RXWKHUQ9RLFHV members of the Bournemouth Symphony Chorus and Orchestra conducted by Richard Hickox.

667. “Fennimore and Gerda.” Delius Society Journal no. 128 (2000): 61–64. Review of Kiel Opera House production, 14 May 2000. Includes cast list, one photograph from the production, and English translations of press notices from Opernwelt (July 2000) and Schleswig-Holsteinische Landeszeitung (16 May 2000).

668. “The Magic Fountain.” Delius Society Journal no. 122 (1997): 50–52. Includes cast list and photograph from the Kiel Opera House production plus a review by Stewart Manville, reprinted from The Delian (see no. 778), the Kieler Nachrichten, Schleswig-Holsteinische Landeszeitung, and Frankfurter Rundschau in English translation.

669. “Margot La Rouge.” Delius Society Journal no. 107 (1991): 19–20. Review of a production at the Guildhall School of Music and Drama, 5–12 June 1991. Includes cast list. Bibliography 135

670. “The Society’s Weekend, The Annual General Meeting & The Delius Inspired Festival.” Delius Society Journal no. 139 (2006): 12–19. Includes reviews of the “Delius Inspired” Festival concerts, held in Bradford, England.

671. “, Gloucester 1998.” Delius Society Journal no. 125 (1999): 42–48. Reviews of the concerts containing works by Delius: concerts featuring the Violoncello Concerto, Delius’s orchestration of Edvard Grieg’s Norwegian Bridal Procession, four posthumous songs, and Songs of Sunset are reviewed by Lyndon Jenkins, the concert featuring the Violin Sonata no. 2 is reviewed by Peter Ratcliffe, and the concerts featuring To be Sung of a Summer Night on the Water and the String Quartet are reviewed by Roger Buckley.

672. “Vladimir Ashkenazy Conducts Eventyr in Birmingham.” Delius Society Journal no. 127 (2000): 43–46. Includes a report on the rehearsal (by Roy Price), review of the performance by Anthony Boden, reprint of a review from the Birmingham Post (24 November 1999) by Christopher Morley, and a postscript by Lyndon Jenkins. The performance took place at Symphony Hall, Birmingham, 22 November 1999 and featured the Philharmonia Orchestra.

673. Aprahamian, Felix. “Two Related Recitals.” Delius Society Journal no. 126 (1999): 49. Review of performances by Tasmin Little and Martin Roscoe (30 March 1999) and the Bridge String Quartet (7 April 1999).

674. Aprahamian, Felix. “A Village Romeo and Juliet in Düsseldorf.” Delius Society Journal no. 88 (1986): 14–16. Review of a performance at Deutsche-Oper-am-Rhein, October 1985. Cast list appears on p. 22.

675. Armour-Chélu, Jane. “The Magic Fountain: Scottish Opera’s New Production.” Delius Society Journal no. 125 (1999): 29–39. Review of the Edinburgh Festival Theatre performance, 26 February 1999. Includes cast list and one picture from the production. Following the review is a reprint of an introductory article from the Scotsman and reviews from the Scotsman, the Spectator, the Observer, and the Sunday Telegraph, London. 136 Frederick Delius: A Research and Information Guide

676. Armour-Chélu, Jane. “North Staffordshire Triennial Music Festival Centenary Concert.” Delius Society Journal no. 127 (2000): 47–48. Review of a concert given by the Royal Liverpool Philharmonic Orchestra conducted by Donald Hunt, 16 October 1999. The program featured “Daybreak” from the Florida Suite, and Sea Drift (Laurence Albert, soloist).

677. Bird, John. “Memorial Recital for Eric Fenby (1922–1997): Wigmore Hall, London, Tuesday 16 September 1997.” Delius Society Journal no. 122 (1997): 61–65. Review of the concert that featured works by Fenby and Delius. Followed by reprints of two reviews from the Daily Telegraph, London, and Independent, London.

678. Bradbury, Ernest. “A Mass of Life at Bradford Saturday 10 April 1976.” Delius Society Journal no. 52 (1976): 15. Review reprinted from the Yorkshire Post.

679. Buckley, Roger. “40th Anniversary Recital.” Delius Society Journal no. 137 (2005): 73–76. This recital commemorated the 40th anniversary of the Delius Society Midlands Branch. The program, featuring works by Delius and Grieg, was held at the Voicebox Arts Centre, Derby, on 17 October 2004.

680. Buckley, Roger. “An Audience with Frederick Delius, Hosted by Roderick Swanston.” Delius Society Journal no. 136 (2004): 76. Review of a concert devoted to the music of Delius, given at the Royal College of Music, 7 May 2004.

681. Buckley, Roger. “Cello Sonata.” Delius Society Journal no. 141 (2007): 126. Review of a concert given by the Nash Ensemble at Wigmore Hall, 20 January 2007.

682. Buckley, Roger. “Concert Reviews.” Delius Society Journal no. 129 (2001): 71–72. Review of a performance of the Violin Concerto, given by violinist Tasmin Little with the Royal Liverpool Philharmonic Orchestra conducted by Sir Charles Mackerras, 24 February 2001. Bibliography 137

683. Buckley, Roger. “Delius: Concerto for Violin, Violoncello and Orchestra.” Delius Society Journal no. 122 (1997): 65–66. Review of the concert ‘Delius and His Contemporaries’ by the Orchestra and Choir of St. John’s, Smith Square, 11 November 1997.

684. Buckley, Roger. “Fennimore and Gerda.” Delius Society Journal no. 107 (1991): 15–19. Review of the English National Opera production. Includes cast list and review excerpts.

685. Buckley, Roger. “Opera Review.” Delius Society Journal no. 132 (2002): 65–69. Review of a performance of A Village Romeo and Juliet given at the Teatro Lirico di Cagliari (Sardinia, Italy), 26 April to 5 May 2002. Several excerpts from the Italian press (in English translation) follow the review. Includes two photographs.

686. Candlin, David. “Delius: Songs.” Delius Society Journal no. 120 (1997): 49–51. Review of a recital given at the Salle des Fêtes, Bourron-Marlotte, France, 28 September 1996. Includes a reproduction of the program’s handbill and a review (in French) from a local newspaper.

687. Carley, Lionel. “Some Notes on A Village Romeo and Juliet in Zurich and Darmstadt.” Delius Society Journal no. 72 (1981): 6–13. This extended review includes photographs of both productions, summary of the critics’ reviews, and background material on the opera.

688. Chennell, Paul. “American Rhapsody.” Delius Society Journal no. 142 (2007): 134–135. Review of a performance of Delius’s Appalachia by the BBC Concert Orchestra conducted by Charles Hazlewood, given at the Queen Elizabeth Hall, London, 3 April 2007.

689. Chennell, Paul. “Concert Reviews.” Delius Society Journal no. 131 (2002): 57. Review of a performance of the “Intermezzo” from Fennimore and Gerda given by the Nash Ensemble at Wigmore Hall, London.

690. Chennell, Paul. “A Mass of Life.” Delius Society Journal no. 109 (1992): 27–28. 138 Frederick Delius: A Research and Information Guide

Review of a performance at the Brighton Festival, 9 May 1992.

691. Cox, Derek. “Un embarras de Del Mars!” Delius Society Journal no. 66 (1980): 20–21. Review of a performance of the Double Concerto by the Mid-Sussex Sinfonia conducted by Jonathan Del Mar.

692. Dixon, Ann. “Concert Reviews.” Delius Society Journal no. 128 (2000): 59. Review of a recital given by the violinist Tasmin Little accompanied by Martin Roscoe on 30 April 2000. On the program was Delius’s Légende.

693. Eccott, David J. “Margot la Rouge.” Delius Society Journal no. 75 (1982): 22–24. Review of the world premiere broadcast, 21 February 1982 on BBC Radio 3.

694. Fredericks, Roy. “Concert Reviews.” Delius Society Journal no. 133 (2003): 39–40. Review of a performance of the Double Concerto given by Alexandra Wood, violin, and Naomi Williams, violoncello, with the Slater Symphony Orchestra conducted by Christopher Slater, 14 December 2002.

695. Green, David. “Cello Sonata.” Delius Society Journal no. 141 (2007): 128–129. Review of a concert featuring Julian Lloyd Webber and John Lenehan at Radley College; this concert was part of the inaugural “English Music Festival” held 20–24 October 2006.

696. Green, David. “Delius and his Friends: Music by Delius and Those who Knew and Loved Him.” Delius Society Journal no. 141 (2007): 123–124. Review of a piano recital given by Paul Guinery at Steinway Hall, 31 October 2006.

697. Green, Michael. “Concert Reviews.” Delius Society Journal no. 120 (1997): 48. Review of Sea Drift, performed at the Three Choirs Festival by Paul Whelan with the BBC Philharmonic Orchestra and Festival Chorus conducted by Donald Hunt. Bibliography 139

698. Guinery, Paul. “Delius: A Mass of Life.” Delius Society Journal no. 130 (2001): 46–49. Review of the performance given at the Three Choirs Festival by soloists Claire Rutter, Catherine Wyn-Rogers, Adrian Thompson, and Alan Opie with the Festival Choir and the Philharmonia Orchestra conducted by Richard Hickox. Following the review is a reprint of Michael Kennedy’s review from the Sunday Telegraph (26 August 2001).

699. Hall, Denis. “Piano Recital by Malcolm Binns.” Delius Society Journal no. 126 (1999): 50. Review of a recital given at Wigmore Hall, 23 June 1999. The program featured Delius’s Five Piano Pieces and Ravel’s arrangement of the “Prelude” to Margot la Rouge.

700. Kirkman, Ron. “Eine Messe des Lebens in Lucerne.” Delius Society Journal no. 77 (1982): 22. Review of a Lucerne Festival performance of A Mass of Life on 18 August 1982.

701. Kitching, Richard. “Concert and Festival Reviews.” Delius Society Journal no. 125 (1999): 27. Review of a concert given by the City of Birmingham Symphony Orchestra conducted by Christopher Robinson, with soloists Tasmin Little (violin) and Lars Anders Tomter (viola). The program featured the Double Concerto (arranged by Lionel Tertis) and took place on 14 November 1998.

702. Kitching, Richard. “Concert Reviews.” Delius Society Journal no. 131 (2002): 59. Review of a performance of Sea Drift given by Ashley Holland with the Derby Bach Choir and Orchestra conducted by Richard Roddis.

703. Lee-Browne, Martin. “And Still More Duets at Bath.” Delius Society Journal no. 143 (2008): 147–148. Review of a recital given by duo pianists Simon Callaghan and Hiroaki Takenouchi at The Pump Room, Bath, 23 September 2007. The program featured arrangements of In a Summer Garden by Philip Heseltine and Eventyr by Benjamin Dale.

704. Lee-Browne, Martin. “Appalachia.” Delius Society Journal no. 142 (2007): 14–15. 140 Frederick Delius: A Research and Information Guide

Review of Cheltenham Music Festival performance by the Brno Symphony Orchestra and Cheltenham Bach Choir, featuring the mezzo- soprano Sarah Connolly, and conducted by Petr Altrichterat at the Cheltenham Town Hall, 21 July 2007.

705. Lee-Browne, Martin. “Concert Reviews.” Delius Society Journal no. 132 (2002): 55–61. Review of a performance of A Mass of Life given by the Bonn Philharmonic Choir and Köln Philharmonic Orchestra conducted by Thomas Neuhoff. Two reminiscences (“Bonn and A Mass of Life: A Brief Memoir” by Lionel Carley and “Eine Messe des Lebens in Bonn” by Hans Peter Dieterling) follow the review.

706. Lee-Browne, Martin. “The English Music Festival: Part Songs.” Delius Society Journal no. 141 (2007): 127–128. Review of a festival concert given by the choral group CC21 conducted by Howard Williams. The festival was based at The Abbey, Dorchester- on-Thames, Oxfordshire, 20–24 October 2006.

707. Lee-Browne, Martin. “Lebenstanz.” Delius Society Journal no. 141 (2007): 125–126. Review of a concert given by the St. Giles Orchestra, conducted by Geoffrey Bushell, that included the rarely performed Lebenstanz.

708. Lee-Browne, Martin. “More Piano Duets at Bath.” Delius Society Journal no. 141 (2007): 121–122. 5HYLHZV WZR FRQFHUWV RI SLDQR GXHWV WKH ¿UVW RQH E\ 0DULH /HH Gustaffson and Jessica Chan on 26 August 2006, and the second by Simon Callaghan and Hiraoaki Takenouchi. The concerts took place at The Pump Room, Bath and featured two-piano arrangements of various Delius works.

709. Lee-Browne, Martin. “Two Performances of the Violin Concerto.” Delius Society Journal no. 143 (2008): 149–151. Reviews two performances: Lucy Baker with the Guildford Symphony Orchestra conducted by Darrel Davison (Guildford Cathedral, 1 December 2007) and Tasmin Little with the Royal Philharmonic Orchestra conducted by Vernon Handley (Cadogan Hall, London, 18 February 2008).

710. Lee-Browne, Martin. “The Violin Concerto.” Delius Society Journal no. 137 (2005): 87–89. Bibliography 141

Review of a concert given by the Lambeth Orchestra, conducted by &KULVWRSKHU )L¿HOG  )HEUXDU\  &KDUORWWH 6FRWW ZDV WKH YLROLQ soloist.

711. Limming, Paul. “Sea Drift.” Delius Society Journal no. 137 (2005): 124–125. Review of a concert given at Peterborough Cathedral, 21 May 2005 by the Stamford Choral Society and Chameleon Arts Orchestra, conducted by Paul White. Roderick Williams was the baritone soloist.

712. Little, George. “Delius: Requiem.” Delius Society Journal no. 119 (1996): 45. Review of a performance given 8 June 1996 in Winchester Cathedral.

713. Lloyd, Stephen. “Fennimore and Gerda at Saint Louis: Triumphant American Premiere.” Delius Society Journal no. 73 (1981): 17–20. Review; includes cast list.

714. Lloyd, Stephen. “Fennimore and Gerda: The New York Premiere.” Delius Society Journal no. 109 (1992): 17–18. Review of the New York premiere of the work, given at the Juilliard School Opera Centre, 29 April to 3 May 1992. Includes a summary of critical reaction from the New York media and a cast list.

715. Lloyd, Stephen. “Koanga.” Delius Society Journal no. 115 (1994): 12–13. Review of a production given by the Leeds Youth Opera at the Civic Theatre, 6–9 July 1994. Includes cast list.

716. Lloyd, Stephen. “Koanga.” Delius Society Journal no. 142 (2007): 84–85. Review of the Pegasus Opera production at Sadler Wells, 11–14 April 2007 directed by Helena Kaut-Howson. Following the review are excerpts from the press, including Opera, the Sunday Telegraph, The Stage, and Opera Now.

717. Lloyd, Stephen. “Margot la Rouge.” Delius Society Journal no. 83 (1984): 21–23. Review of the European stage premiere at the Camden Festival, March 1984. Includes a cast list and a summary of critical reaction. 142 Frederick Delius: A Research and Information Guide

718. Lloyd, Stephen. “Margot la Rouge: World Premiere at St. Louis.” Delius Society Journal no. 80 (1983): 42–45. Review of the performance by Opera Theatre of St. Louis at Webster University. Includes cast list and summary of critical reaction.

719. Lloyd, Stephen. “Mass of Life at the Proms.” Delius Society Journal no. 98 (1988): 9. Review of a performance at the Promenade Concert, 31 July 1988. Includes excerpts from press reviews.

720. Lloyd, Stephen. “A Pillaged Romeo and Juliet.” Delius Society Journal no. 84 (1984): 10–14. Review of the Opera North production. Includes cast lists from previous productions (Sadler’s Wells, 1962, Opera North, 1980 and 1984) and excerpts from critical reaction.

721. Lloyd, Stephen. “A Suite from Hassan.” Delius Society Journal no. 105 (1990): 15. Review of a performance at the 1990 Wooburn Festival, 13 October 1990.

722. Lovgreen, Gordon. “Delius at the Phil.” Delius Society Journal no. 107 (1991): 22–24. Review of concerts by the Royal Liverpool Philharmonic Orchestra, 29–30 May 1991, which featured works by Delius.

723. Lovgreen, Gordon. “Fennimore and Gerda at the Edinburgh Festival.” Delius Society Journal no. 81 (1984): 16–20. Review of the performance at the Edinburgh Festival, 8–10 September 1983. Includes cast list and excerpts from press reviews.

724. Maddox, Jonathan. “A Mass of Life at Cambridge.” Delius Society Journal no. 114 (1994): 22. Review of a performance at King’s College Chapel, Cambridge, 5 June 1993.

725. Maddox, Jonathan. “A Mass of Life in Leeds.” Delius Society Journal no. 108 (1992): 32–33. Review of a performance at Leeds Town Hall, 2 November 1991. Bibliography 143

726. Maddox, Jonathan. “Eine Messe des Lebens in Bielefeld.” Delius Society Journal no. 105 (1990): 14. Review of a performance of A Mass of Life in the opening concert of the 1990 Westphalian Music Festival, Bielefeld, Germany, 25 May 1990.

727. Maddox, Jonathan. “Sakuntala and A Late Lark at Chipping Norton.” Delius Society Journal no. 101 (1989): 16–17. 5HYLHZRIWKH¿UVWSHUIRUPDQFHRISakuntala in York, given by the North Oxfordshire Scratch Orchestra conducted by Raymond Head, with the tenor Ian Barratt.

728. Marsh, Bill. “Song Recital.” Delius Society Journal no. 130 (2001): 44–46. Review of a recital given by Helen Withers (mezzo-soprano) and Roger Buckley (piano) at the Three Choirs Festival, 19 August 2001. The program featured four of Delius’s Verlaine songs, Five Songs from the Danish, and Sakuntala (the latter two sung in German).

729. Matthew-Walker, Robert. “Delius: Seven Danish Songs.” Delius Society Journal no. 120 (1997): 51–53. Review of a performance given in Clerkenwell, England, 7 November 1996.

730. McPherson, Ian. “All Delius Concert.” Delius Society Journal no. 132 (2002): 62. Review of a concert given at the Royal Academy of Music, 10 March 2002. The concert was organized by Bettina Delius, who also performed some of the Norwegian songs.

731. McPherson, Ian, and Jilly Little. “Concert Reviews.” Delius Society Journal no. 129 (2001): 70–71. Review of a performance of A Mass of Life given by the London Choral Society and conducted by Ronald Corp. The 12 October 2000 performance featured the soloists Claire Rutter, Jean Rigby, Martyn Hill, and Paul Whelan.

732. Newham, Godfrey. “Delius: Poem of Life and Love.” Delius Society Journal no. 132 (2002): 63. Review of a concert given by the Havehill Sinfonia conducted by Kevin Hill, 17 March 2002. 144 Frederick Delius: A Research and Information Guide

733. Newham, Godfrey. “A New Arrangement of The Cuckoo.” Delius Society Journal no. 143 (2008): 147. Review of a recital by pianist Martin Offord given on 22 September 2007 in St. Mary’s Church, Roecliffe, Cumbria. The program featured a new arrangement by Gerard Bunk of On Hearing the First Cuckoo in Spring.

734. Nicholson, Ralph. “A Mass of Life in Somerset.” Delius Society Journal no. 60 (1978): 25. Review of the performance given by the Somerset Opera Group and Orchestra, in part reprinted from the Somerset Country Gazette (28 April 1978).

735. Packer, Richard. “Violin Sonata no. 2.” Delius Society Journal no. 142 (2007): 135–136. Review of a recital given by the 2007 Delius Prize winner Liv-Marie Fletcher at the Henleaze United Reformed Church, Bristol, 10 June 2007.

 3DU¿WW*LOEHUW³$6WXGHQWV¶Appalachia.” Delius Society Journal no. 57 (1977): 6–8. Review of a performance given on 7 July 1977 by the Royal College of Music First Orchestra conducted by Norman Del Mar.

737. Parsons, Graham, and Richard Kitching. “Delius on Humberside: Impressions of a Performance of A Village Romeo and Juliet.” Delius Society Journal no. 111 (1993): 18–19. Review of a performance by the University of Hull Opera Group, 10 February 1993. Includes a cast list.

738. Prentice, Ron. “Concert and Festival Reviews.” Delius Society Journal no. 125 (1999): 32–33. Review of a recital given by Julian Lloyd Webber (cello) and John Lenehan (piano), 16 May 1998. The program included the Violoncello Sonata.

739. Prentice, Ron. “Concert Reviews.” Delius Society Journal no. 130 (2001): 43–44. Review of a concert given by the Huntingdonshire Philharmonic Choir and Orchestra conducted by Marcus Pashley, with soloist Richard Edgar Wilson. The program, given 30 June 2001, featured A Song of Summer, Bibliography 145

A Late Lark, and Delius’s orchestration of Edvard Grieg’s Norwegian Bridal Procession.

740. Prentice, Ron. “Delius 2 and 4-Hand Arrangements.” Delius Society Journal no. 139 (2006): 124–125. Review of a performance 24 September 2005 by Simon Callaghan and Hiroaki Takenouchi, pianists.

741. Prentice, Ron. “Somerset Chamber Orchestra.” Delius Society Journal no. 125 (1999): 48. Review of a concert given 29 August 1998; on the program were On Hearing the First Cuckoo in Spring and Summer Night on the River.

742. Radford, Brian. “The Delius Society Weekend at Hatherley Manor: The Two ‘Three Choirs’ Concerts.” Delius Society Journal no. 136 (2004): 77–79. &RQFHUWUHYLHZV2QHFRQFHUWIHDWXUHGWKH¿UVWSXEOLFSHUIRUPDQFHRI Delius’s Five Songs from the Norwegian with the original Norwegian texts.

743. Redwood, Christopher. “Concert Reports.” Delius Society Journal no. 101 (1989): 16–18. Reviews of a performance of the Requiem (Saffron Walden Choral Society and Walden Sinfonia), and various Delius works at the Nottingham Festival.

744. Redwood, Christopher. “Concert Reviews.” Delius Society Journal no. 128 (2000): 60. Review of a performance of the Violin Concerto given by Rustom Pomery with the Somerset County Orchestra conducted by David Hedges, 24 June 2000 at Queen’s College Hall, Taunton.

745. Redwood, Christopher. “A Mass of Life at Birmingham.” Delius Society Journal no. 114 (1994): 20–21. Review of a performance at Symphony Hall, Birmingham, 22 May 1993.

746. Redwood, Christopher. “A Mass of LifeDWWKH)DLU¿HOG+DOOV&UR\GRQ 17 May 1980.” Delius Society Journal no. 68 (1980): 18–19. Review. 146 Frederick Delius: A Research and Information Guide

747. Redwood, Christopher. “A Village Romeo and Juliet at Leeds, 31st May 1980.” Delius Society Journal no. 68 (1980): 17–18. Review of the English National Opera North’s touring production.

748. Redwood, Christopher. “Wooburn Festival 1974.” Delius Society Journal no. 47 (1975): 22–23. 5HYLHZ RI WKH ¿QDO FRQFHUW ZKLFK IHDWXUHG Sea Drift (John Shirley- Quirk, soloist, and Richard Hickox, conductor).

749. Redwood, Dawn. “Hassan at the Minack Theatre.” Delius Society Journal no. 57 (1977): 26–27. Review of the production by Jean Howell.

750. Rogers, Raymond. “Concert and Festival Reviews.” Delius Society Journal no. 125 (1999): 28. Review of a recital given by the mezzo-soprano Helen Withers and the Guildhall School of Music and Drama Student Conductors’ Orchestra conducted by Michael Sonnen. The program featured songs of Delius with orchestral accompaniments.

751. Rogers, Raymond. “Concert Reviews.” Delius Society Journal no. 131 (2002): 58. Review of a performance of the Songs of Sunset given by Jean Rigby, Stephen Roberts, and the Philharmonia Orchestra conducted by David Hill at The Royal Festival Hall, London.

752. Shaw, J. R. “Hassan in Manchester.” Delius Society Journal no. 62 (1979): 26–27. Review.

753. Stang, Rolf. “Benjamin Luxon’s New York Recital.” Delius Society Journal no. 97 (1988): 15. 5HYLHZRIDUHFLWDORI(QJOLVKVRQJ LQFOXGLQJ¿YHE\'HOLXV SUHVHQWHG coincidentally on the 126th anniversary of Delius’s birth.

754. Stang, Rolf. “Philadelphia Orchestra Performs Eventyr.” Delius Society Journal no. 100 (1989): 15–18. Review. Bibliography 147

755. Stang, Rolf. “Sea Drift at Carnegie Hall.” Delius Society Journal no. 115 (1994): 6–9. Comments on Delius’s text setting and how singers might approach this work. Includes a review of the concert by Stang, followed by excerpts of a review by Harold Diamond reprinted from The Delian.

756. Summers, Tony. “Concert Reviews.” Delius Society Journal no. 123 (1998): 42–43. Review of a concert by the Nash Ensemble at Wigmore Hall, 10 January 1998. The program featured Eric Fenby’s arrangements of La Calinda and Air and Dance.

757. Summers, Tony. “Delius: Paris.” Delius Society Journal no. 120 (1997): 53–54. Review of the performance given by the London Philharmonic conducted by Bramwell Tovey; the concert was part of the “Great Cities of the World” series.

758. Summers, Tony. “Performance on 3.” Delius Society Journal no. 125 (1999): 49–50. Review of a live broadcast from BBC Radio 3 Studio One, Maida Vale, 22 March 1999, given by the BBC Symphony Orchestra conducted by Andrew Davis (who also served as piano accompanist), Lisa Milne (soprano), and Ashley Holland (baritone). The program featured Dance Rhapsody, no. 1, Prelude and Idyll, Four Old English Lyrics, and North Country Sketches.

759. Thornton, Joyce, and Bill Thornton. “Delius in Leipzig 1986.” Delius Society Journal no. 93 (1987): 12. Review of a performance of the Violin Concerto by Tasmin Little with the Gewandhaus Orchestra, 12 October 1986.

760. Threlfall, Robert. “World Premiere of 1890 ‘Petite Suite d’Orchestre.’” Delius Society Journal no. 60 (1978): 23–24. Review of the premiere given by the Beauchamp Sinfonietta conducted by David Tall, 13 May 1978.

761. Wall, Patricia. “Concert Reviews.” Delius Society Journal no. 133 (2003): 38–39. 148 Frederick Delius: A Research and Information Guide

Review of a performance of the Violin Concerto given by Alan Smale with the National Symphony Orchestra conducted by Gerhard Markson at the National Concert Hall, Dublin, 22 November 2002.

762. White, John. “Delius the Song-Writer—Song Recital: Delius and His Contemporaries.” Delius Society Journal no. 59 (1978): 10–12. Reviews two song recitals: Carole Rosen, accompanied by Paul Hamburger (Purcell Room, 17 November 1977), and Carol Leatherby, accompanied by Gary Peacock (British Institute of Recorded Sound, 20 January 1978).

763. Winstanley, Stewart. “Appalachia.” Delius Society Journal no. 139 (2006): 125–127. Review of a performance held 4 February 2006 by the Viva Voce &KDPEHU&KRLUDQGWKH6KHI¿HOG6\PSKRQ\2UFKHVWUDFRQGXFWHGE\ John Longstaff.

The Delian

764. “Delius is Composer of the Month in the October Issue of BBC Music Magazine.” The Delian (October 2002): 11. Points out a few shortcomings in the feature article (see no. 935).

765. “Delius Society 25th Anniversary.” The Delian (March 2002): 3. Description of special events to mark the anniversary, including the U.S. WHOHYLVLRQSUHPLHUHRIWKH¿OP³'LVFRYHULQJ'HOLXV´DQGDSKRWRJUDSKRI the special message that appeared on the local PECO Energy Building’s crown lights.

766. “Eric Fenby Dies February 18 at Age 90.” The Delian (April 1997): 1–4. Obituary. Includes a section on Fenby’s connections with Philadelphia and two photographs.

767. “Highlights of our First 25 Years.” The Delian (October 2001): 15–18. &KURQRORJ\ RI VLJQL¿FDQW HYHQWV IRU WKH 3KLODGHOSKLD 'HOLXV 6RFLHW\ 1976–2001.

768. “Maurice Spector’s Painting ‘Autobiography’ Includes Delius.” The Delian (April 1997): 30. Painting reprinted in black and white from the full color reproduction published in American Artist 54 (August 1990): 55. The painting includes Bibliography 149

images of objects, including Delius, that are “personally important” to the artist.

769. “Recent Photos of the Delius House.” The Delian (April 2008): 10. Two photographs taken March 2008 reveal a need for painting the house.

770. Buckley, Roger. “Delius Society Visit to Grez-sur-Loing, 15–17 September 2006.” The Delian (June 2007): 3. Reprinted (without photographs) from the Delius Society Journal no. 141 (2007).

771. Carley, Lionel. “Walt Whitman, Frederick Delius and English Music.” The Delian (June 1995): 3–9. A revised version of a talk given for the symposium of the same title, held some ten years previously. Surveys Whitman settings by various English composers, focusing on Delius’s Sea Drift.

772. Connock, Stephen. “From Down Ampney to Paumanok: Delius, Vaughan Williams and Walt Whitman.” The Delian (June 2001): 9–11. A discussion of the Whitman settings of Delius and Ralph Vaughan :LOOLDPV 'LIIHUHQFHV LQ DSSURDFKHV UHÀHFW WKH GLIIHUHQW EDFNJURXQGV of the composers.

773. Diamond, Harold J. “American Premiere of Delius’s Cynara.” The Delian (November 2007):12. Review of a performance that took place during the Tanglewood Music Festival on 15 July 2007, with Thomas Hampson as soloist. As noted in the June 2008 issue, Cynara had been previously performed in the United States in 1966, but with piano accompaniment.

774. Diamond, Harold J. “The Finest Description of Delius’ Music I Have Ever Heard.” The Delian (June 2002): 5–6. Reprints a review of Delius’s In a Summer Garden written for the Boston Evening Transcript (25 February 1918) by critic Henry Taylor Parker (1867–1934).

775. Driggers, Jeff. “Organist Cameron Carpenter Transcribes Delius’s American Rhapsody.” The Delian (June 2007): 7. Review of Carpenter’s transcription of this early work. Copies of the transcription are to be given to collections at the Jacksonville Public Library and Jacksonville University Swisher Library. 150 Frederick Delius: A Research and Information Guide

776. Faulkner, Helen. “Delius Inspired, Bradford England, 1–8 July 2006.” The Delian (October 2006): 5–11. Review of the festival “Delius Inspired” organized by violinist Tasmin Little. Includes photographs and programs of the festival concerts and events.

777. Gentieu, Norman. “A Letter from Member Norman Gentieu.” The Delian (December 2005): 4–6. *HQWLHXZULWHVDERXWWKHGHWDLOVRIWKH¿UVWUHFRUGLQJRISea Drift (Decca, 1929) featuring Roy Henderson with the New English Symphony Orchestra and Chorus and conducted by .

778. Manville, Stewart. “The Magic Fountain Debuts in Kiel.” The Delian (October 1997): 7. Reprint, Delius Society Journal no. 122 (1997): 51–52. Reports on The Magic Fountain world premiere, which took place 22 June 1997 (Buehnen der Landeshauptstadt Kiel, Andreas K. W. Meyer, conductor). This work was the last of Delius’s operas to receive a fully staged production.

779. Manville, Stewart. “Frederick Delius and Friends: A British–Danish Music Festival.” The Delian (September 1998): 3–4. Report of the “Dansk–engelsk musik festival” conceived by Lionel Carley and sponsored by the Delius Trust, the Grainger Archive, the Danish Music Information Center, the Palsgaard Foundation, Danish Radio, the Vejle Amt, the Schur Group, the Danish Bank, and the communes of Aarhus and Juelsminde. Held 18–20 June, 1998.

780. Marsh, Bill. “30th Anniversary Dinner.” The Delian (March 2007): 3. A pictorial report of the branch’s thirtieth anniversary celebration.

781. Marsh, Bill. “44th Annual Delius Festival, Jacksonville, Florida, March 4–7, 2004.” The Delian (April 2004): 1–6. A report of Festival events, including the Friday Musicale concert, journey to Solano Grove, and a concert by the Jacksonville Symphony Orchestra conducted by David Lloyd-Jones that included the world premiere of two choral songs (“I Will Meet You When the Sun Goes Down” and “Let us Dance Tonight”) and the American premiere of American Rhapsody. Bibliography 151

782. Marsh, Bill. “Appalachia: A Most American Work by Frederick Delius.” The Delian (September 1995): 3. A brief discussion of the history, publication, and performances of this work.

783. Marsh, Bill. “Author of the Text for Delius’s Requiem Murdered in 1941.” The Delian (October 1997): 8. First published in the New York Times (7 May 1941). Recounts the story of Heinrich Simon’s murder. The original newspaper headline read “Anti-Nazi Editor is Slain in Capitol—Told Wife he was Beaten in Street.”

784. Marsh, Bill. “Delius Performances by the Philadelphia Orchestra.” The Delian (January 1997): 7–9; (April 1997): 7–10; (October 1997): 11–12; (January 1998): 6–9. A series of articles listing performances of Delius’s music given by WKH3KLODGHOSKLD2UFKHVWUD7KH¿UVW'HOLXVFRPSRVLWLRQSHUIRUPHGE\ the Orchestra was the Violoncello Concerto (28 October 1928), with Beatrice Harrison, violoncello, and Fritz Reiner, conductor. Includes selected press reports.

785. Marsh, Bill. “Delius, Warlock & Tonic-Sol-Fa.” The Delian (June 2004): 7–8. A description of a tonic-sol-fa edition of A Mass of Life (a page of the HGLWLRQLVUHSURGXFHGDVLVWKH¿UVWSDJHRIDWRQLFVROIDHGLWLRQRI3KLOLS Heseltine’s carol Benedicamus Domino).

786. Marsh, Bill. “The Early Years in Pictures,” parts 1 through 5. The Delian (March 2007): 11–12; (June 2007): 4–5; (November 2007): 14–15; (April 2008): 6–9; (June 2008): 8–11. A series of photographs capturing the history of the Philadelphia Branch, 1978–1997.

787. Marsh, Bill. “Honorary Life Member Felix Aprahamian Dies at 90.” The Delian (April 2005): 1–3. Obituary for the longtime advisor to the Delius Trust, former President of the Delius Society, and lifetime Philadelphia Branch member. Includes a reproduction of the order of ceremony for the funeral service.

788. Marsh, Bill. “Jacqueline du Pré and the Delius Cello Concerto.” The Delian (June 2000): 1–2. 152 Frederick Delius: A Research and Information Guide

A discussion of the violoncellist Jacqueline du Pré’s connection with this work. Includes bibliography.

789. Marsh, Bill. “Eine Messe des Lebens Given in Bonn.” The Delian (June 2002): 1–2. Report of a concert given 10 March 2002. Includes an English translation of the program notes.

790. Marsh, Bill. “No Delius from Stokowski.” The Delian (September 1995): 4–5. Looks at possible reasons why conductor Leopold Stokowski did not conduct any of Delius’s music during the conductor’s tenure in Philadelphia, despite the efforts of sculptor Henry Clews (Clews’s second wife was a wealthy Philadelphia socialite). Includes facsimiles of two letters about the possible inclusion of A Dance Rhapsody in a future program.

791. Marsh, Bill. “On the Hazards of Recording Delius in Winter.” The Delian (June 2000): 6. Recounts the making of the Delius Society Philadelphia Branch’s second Longwood Gardens recording (DTR2001) (see D22).

792. Marsh, Bill. “The Rev. Robert L. Jacoby’s Hymn to the Tune Appalachia.” The Delian (September 1996): 7. Describes the Marian hymn Jacoby arranged in 1954 while resident at 1DVKRWDK+RXVH'HOD¿HOG:LVFRQVLQ+HIRXQGDFROOHFWLRQRISRHPV by Frederick William Faber in the library and “somehow the tune from Appalachia came to mind, was in the right meter, hence the resulting hymn.” Includes a musical example and text.

793. Marsh, Bill. “Solano Grove is Saved; Delius Association of Florida Merges with Riverside Fine Arts Association.” The Delian (December 2004): 10. Relays the news that the Solano Grove property was purchased by a neighbor (thus saving it from potential developers) plus the demise of the Delius Association of Florida.

794. Marsh, Bill. “A Survey of the Works Dedicated to or Inspired by Frederick Delius,” parts 1 through 8. The Delian (October 1997): 15–16; (January 1998): 3–5; (April 1998): 9–11; (September 1998): 11, 24; (January 1999): 3–4; (April 1999): 11; (March 2000): 18; (October 2000): 2. Bibliography 153

A series of articles documenting musical works dedicated to or inspired by Delius.

795. Mendillo, Angelo. “Delius and Finzi at Newport Rhode Island 2004.” The Delian (June 2004): 9. 5HYLHZ RI WKH ¿UVW$PHULFDQ SHUIRUPDQFH RI WKH RULJLQDO YHUVLRQ RI Delius’s Piano Concerto (with orchestra reduced for piano), given at the Newport Music Festival, 23 July 2004.

796. Rudland, Malcolm. “A Mass of Life in St. Paul’s Cathedral in July Brings Controversy: Felix Aprahamian Saves the Day.” The Delian (January 1997): 6. Reprinted from the Peter Warlock Society Newsletter no. 59 (1996). A discussion of controversial remarks made by the Times critic Richard Morrison about Delius’s music made in relation to an upcoming performance of A Mass of Life. Aprahamian refuted the critic with a quote from the Philip Heseltine biography of Delius—thus “saving” the day.

797. Scott, Marion. “Mr. Delius Discourses on His Music to Hassan.” The Delian (December 2004): 11–12. Reprinted from the Christian Science Monitor (27 October 1923). Scott reports on her interview with Fred and Jelka Delius and gives a brief description of the incidental music composed for Hassan.

798. Sirbaugh, Nora. “A Village Romeo and Juliet by Frederick Delius.” The Delian (October 1997): 9–10. 7UDQVFULSWRIDOHFWXUHWKDWDFFRPSDQLHGDYLHZLQJRIWKH¿OPRI'HOLXV¶V A Village Romeo and Juliet. The 1996 event was cosponsored by the Delius Society Philadelphia Branch and the Opera Club of Philadelphia. The lecture covered Gottfried Keller’s story, the composer, and the music.

799. Thompson, Bill. “Solano Grove Photos.” The Delian (June 2005): 6, 25, 27. Recounts his purchase of a copy of Clare Delius’s Frederick Delius: Memories of My Brother that came with a few surprises: an inscription by Martha B. Richmond (who purchased the Solano Grove Delius house and arranged for its move to Jacksonville University), a period map with the location of the house marked, and two previously unpublished photographs of the house. 154 Frederick Delius: A Research and Information Guide

800. Threlfall, Robert. “A Note on Some Recent Delius Publications.” The Delian (June 2001): 5–6. Describes “various chamber versions of things that are relatively unknown” including the “Intermezzo” from Fennimore and Gerda, Air and Dance, Dance for harpsichord, La Calinda, Irmelin Prelude, Suite for violin and orchestra (arranged for violin and piano), and Five Songs from Tennyson’s “Maud” (with piano accompaniment). He also notes the recent publication of study scores of the String Quartet, Brigg Fair and YDULRXVRUFKHVWUDOZRUNV$PHULFDQLQÀXHQFHGFKRUDOZRUNVLQFOXGLQJ Appalachia, Sea Drift, and Songs of Sunset.

801. Zbinden, Arthur. “A Delius Festival.” The Delian (October 1997): 14. Report of the festival held in Danville, Virginia, 29 May through 1 June, 1997.

SECONDARY SOURCES

Reference Works

Biographical Dictionaries and Encyclopedias

802. “Frederick Delius.” Answers.com. http://www.answers.com/topic/ frederick-delius. (accessed 21 October 2008). Biographical sketches and discussions of works drawn from Allmusic, Allmovie, Concise Grove Dictionary of Music, Britannica Concise, Dictionary of British History, Wikipedia, and others.

803. “Frederick Delius.” Wikipedia. http://en.wikipedia.org/wiki/Frederick_ Delius (accessed 20 October 2008). Includes biographical sketch, discussion of his music and recording projects, list of works and sources.

804. “Delius, Frederick, 1862–1934.” In Hutchinson Encyclopedia of Biography. H. W. Wilson Biography Reference Bank. http://vnweb. KZZLOVRQZHEFRPÀR\GOLEXPQHGXKZZUHVXOWVJHW5HVXOWVMKWPO"B DARGS=/hww/results/results_common.jhtml.20 (by subscription, accessed 27 August 2008). %LRJUDSKLFDOSUR¿OHEULHIOLVWRIZRUNVDQGIRXULPDJHV

805. Anderson, Robert, Anthony Payne, and Lionel Carley. “Delius, Frederick [Fritz] (Theodore Albert).” In The New Grove Dictionary of Music and Musicians, Vol. 7, edited by Stanley Sadie and John Tyrrell, pp. 161–169. London: Macmillan, 2001. Bibliography 155

Includes authoritative biographical information prepared by Robert Anderson, a discussion of his works by Anthony Payne, a list of works, and a select bibliography compiled by Lionel Carley.

806. Anderson, Robert, Anthony Payne, and Lionel Carley. “Delius, Frederick [Fritz] (Theodore Albert).” In Grove Music Online. Oxford Music Online, http://www.oxfordmusiconline.com/subscriber/article/grove/ music/49095 (by subscription, accessed 20 October 2008). Authoritative biographical information has been prepared by Robert Anderson, a discussion of his works by Anthony Payne, and a list of works and select bibliography by Lionel Carley. There are links to two images in Grove Music Online. The Grove Music Online article comprises the same full text of the article from the print edition of The New Grove Encyclopedia of Music and Musicians.

807. Capell, Richard. “Frederick Delius.” In The International Cyclopedia of Music and Musicians, edited by Bruce Bohle, pp. 547–550. New York: Dodd, Mead, 1985. ISBN 0396084125. ML 100.I57 1985. This two-part article covers both Delius’s life and works. Includes a chronology, list of works (arranged by genre), and a bibliography. The PDLQDUWLFOHKDVQRWEHHQXSGDWHGVLQFHLW¿UVWDSSHDUHGLQWKHRULJLQDO edition of this work (1939), although an addenda does add some later information.

808. Gilder, Eric, and June G. Port. “Delius, Frederick.” In The Dictionary of Composers and Their Music, p. 73. New York: Paddington Press, 1978. 2nd ed., 1985. Also published: New York: Facts on File, 1978. ISBN 0448223643. ML 113.G4. Provides a chronological listing of selected works (primarily orchestral) including the date and the composer’s age at the time of composition. There is also a strictly chronological list combining the works of all of the composers in the dictionary and a timeline. There is no biographical information or index.

809. Graham-Dixon, Michael. “Delius, Frederick.” In Dictionary of Contemporary Music, edited by John Vinton, pp. 179–180. New York: Dutton, 1974. British ed., Dictionary of Twentieth-Century Music. London: Thames & Hudson, 1974. ISBN 0525091254. ML 100.V55. The entry for Delius contains a brief survey of his life and works, and a list of principal compositions (prepared by Robert Threlfall). Delius is noted in the entry for “Great Britain” as one of the “composers who represented the best in English music before 1945” and is mentioned 156 Frederick Delius: A Research and Information Guide

EULHÀ\LQWKHHQWU\RQ³,PSUHVVLRQLVP´7KHHQWU\IRU³0HORG\´ ZULWWHQ by Ton de Leeuw) uses measures 24–27 of Cynara as an example of a “traditional” melody.

810. Hadley, Patrick, “Delius, Frederick (1862–1934).” In The Dictionary of National Biography 1931–1940, edited by L. G. Wickham Legg, pp.218–220. London: Oxford University Press, 1949. DA 28.D48 Suppl. 1931–1940. Provides a concise biography followed by a discussion of Delius’s views on music. The locations of the three James Gunn portraits are noted. The author cites “personal knowledge” and six other titles as his sources of information.

811. Heseltine, Philip. “Delius, Frederick.” In A Dictionary of Modern Music and Musicians HGLWHG E\ $ (DJOH¿HOG+XOO SS ± /RQGRQ Dent, 1924. Reprint, New York: Da Capo, 1971; St. Clair Shores, Mich.: Scholarly Press, 1972. ML 100.D55 1924. Entry reprinted in Delius Society Journal no. 94 (1987): 30–31. Biography and selective list of works.

812. Kennedy, Michael. “Delius, Fritz.” In The Oxford Dictionary of Music, 2nd ed., pp. 227–229. Oxford: Oxford University Press, 1994. ISBN 0198691629. ML 100.K35 1994. &RQWDLQVDOHQJWK\ELRJUDSKLFDOVNHWFKDQGFODVVL¿HGOLVWRIZRUNVEXW no bibliography.

813. Lloyd, Stephen, and Guido Heldt. “Delius, Frederick (Theodor Albert).” In Die Musik in Geschichte und Gegenwart: allgemeine Enzyklopädie der Musik, Personenteil Vol. 5, edited by Ludwig Finscher, cols. 743– 754. Kassel: Bärenreiter, 2001. ISBN 3761811004. ML 100.M92 1994. Contains a survey of Delius’s life and works, a list of works (with references to volumes of the collected works), and a bibliography. In German.

814. McVeagh, Diana. “Delius, Frederick Theodor Albert (1862–1934).” In Oxford Dictionary of National Biography, edited by H. C. G. Matthew and Brian Harrison. Oxford: OUP, 2004. http://www.oxforddnb.com. ÀR\GOLEXPQHGXYLHZDUWLFOH E\ VXEVFULSWLRQ DFFHVVHG  October 2008). Biography and list of resources, including selected archives and images. $OVR LQFOXGHV D ³ZHDOWK DW GHDWK´ ¿JXUH EDVHG RQ GRFXPHQWV IURP probate. Bibliography 157

815. Palmer, Christopher. “Delius, Frederick.” In The Dictionary of Composers, edited by Charles Osborne, pp. 102–104. London: The Bodley Head, 1977. ISBN 0370300165. ML 105.D53 1977. An overview of Delius’s life and works along with a brief discussion of KLVFRPSRVLWLRQDOVW\OHDQGLQÀXHQFHV

816. Payne, Anthony, and H. Wiley Hitchcock. “Delius, Frederick [Fritz] (Theodore Albert).” In The New Grove Dictionary of American Music, Vol. 1, edited by H. Wiley Hitchcock and Stanley Sadie, pp. 595–596. London: Macmillan, 1986. Also published: New York: Grove’s Dictionaries of Music, 1986. ISBN 0333378792. ML 101.U6 N48 1986. 7KHELRJUDSKLFDOSUR¿OHIRFXVHVRQ'HOLXV¶V)ORULGD\HDUVZLWKKLVVWD\ in Danville mentioned only in passing. The discussion of his works FHQWHUV DJDLQ RQ WKH$PHULFDQ LQÀXHQFHV SULPDULO\ )ORULGD DQG:DOW Whitman. The bibliography of twenty items is also focused on these two topics. There is no separate list of works.

817. Redlich, Hans F. “Delius, Frederick.” In Die Musik in Geschichte und Gegenwart: allgemeine Enzyklopädie der Musik, Vol. 3, edited by Friedrich Blume, cols. 133–140. Kassel: Bärenreiter, 1954. ML 100. M92. Includes an extensive biography, a discussion of Delius’s compositional VW\OHDQGLQÀXHQFHVDQGDOLVWRIZRUNV DUUDQJHGE\JHQUH 7KHUHLVD bibliography of twelve items, a portrait, and a facsimile of the manuscript of Sea Drift. In German.

818. Slonimsky, Nicolas, Laura Kuhn, and Dennis McIntire. “Delius, Frederick.” In Baker’s Biographical Dictionary of Musicians, Vol. 2, edited by Nicolas Slonimsky and Laura Kuhn, pp. 837–838. New York: Schirmer Books, 2001. ISBN 0028655257. ML 105.B16 2001. Includes an in-depth biographical sketch, list of works (arranged by genre), and bibliography.

819. Streatfeild, R. A. “Delius, Frederick.” In Grove’s Dictionary of Music and Musicians, Vol. 2, edited by H. C. Colles, pp. 43–45. London: Macmillan, 1927. ML 100.G885 1927. 'HOLXV¶V¿UVWDSSHDUDQFHLQWKLVODQGPDUNPXVLFDOUHIHUHQFHZRUN7KH article focuses on biography and discussion of works, and includes a summarized list of works. There is no bibliography, but Streatfeild mentions both the Chop and Heseltine books within the article. 158 Frederick Delius: A Research and Information Guide

820. Streatfeild, R. A., and H. C. Colles. “Delius, Frederick.” In Grove’s Dictionary of Music and Musicians, Vol. 2, edited by , pp. 651–657. London: Macmillan, 1954. Also published: New York: St. Martin’s Press, 1954. ML 100.G885 1954. Biography and survey of works. Includes a list of works arranged by genre (with information on text, composition date, production, dedication, and scoring).

821. Thompson, Kenneth. “Frederick Delius (1862–1934).” In A Dictionary of Twentieth Century Composers (1911–1971), pp. 116–131. London: Faber & Faber, 1973. Also published: New York: St. Martin’s Press, 1973. ISBN 0571090028. ML 118.T5. Provides a biographical sketch and lengthy bibliography. The extensive catalog of works includes descriptive information, date, duration, RUFKHVWUDWLRQ ¿UVW SHUIRUPDQFH SXEOLFDWLRQ DQG FLWDWLRQV WR UHODWHG literature.

822. Wyndham, H. Saxe. “Delius, Frederick.” In Who’s Who in Music: A Biographical Record of Contemporary Musicians, 2nd ed., p. 80. London: Pitman, 1915. ML 106.G7 W91. Brief biographical information and a list of works. There is no entry for 'HOLXVLQWKH¿UVWHGLWLRQ  

823. Young, Percy M. “Delius, Frederick (1862–1934).” In Biographical 'LFWLRQDU\RI&RPSRVHUV:LWK&ODVVL¿HG/LVWRI0XVLFIRU3HUIRUPDQFH and Study, p. 102. New York: Crowell, 1954. ML 390.Y6. A brief discussion of Delius’s musical style and his works along with a short list of scores for study and bibliography.

General Reference Sources 824. “Delius, Frederick.” In The Dance Encyclopedia, edited by Anatole Chujoy and P. W. Manchester, p. 280. New York: Simon and Schuster, 1967. GV 1585.C5 1967. Includes brief information on two ballets that use music by Delius: Nocturne and Romeo and Juliet. Both ballets also have their own entries under their titles.

825. “Delius.” In A Dictionary of Musical Quotations, edited by Ian Crofton and Donald Fraser, pp. 50–51, 129. London: Croom Helm, 1985. First American ed., New York: Schirmer, 1985. ISBN 0709910355. ML 66.C86 1985. Bibliography 159

7KHUH DUH ¿YH TXRWDWLRQV RI 'HOLXV PRVWO\ GUDZQ IURP (ULF )HQE\¶V Delius As I Knew Him (see nos. 851–853), and seven quotations concerning Delius by Claude Debussy, Richard Strauss, Edward Elgar, Thomas Beecham, Colin Wilson, and Bernard Levin. Delius’s name is also mentioned in a Philip Heseltine quote on Romanticism.

826. “Delius, Frederick.” The Oxford Dictionary of Quotations, edited by Elizabeth Knowles. Oxford University Press, 2004. Oxford Reference Online. http://www.oxfordreference.com/views/ENTRY. html?subview=Main&entry=t115.e871 (accessed 20 October 2008). Lists a quotation from Delius’s “At the Crossroads” essay, and a quotation from Eric Fenby’s Delius As I Knew Him.

827. “Delius, Frederick.” In The Oxford Companion to English Literature, edited by Margaret Drabble, pp. 270–271. Oxford: Oxford University Press, 2000. ISBN 0198662440. PR 19.O94 2000. Available online, http://www.oxfordreference.com (accessed 20 October 2008). A survey of Delius’s literary sources.

828. “Frederick Delius.” In The Music Lover’s Almanac, edited by William Hendelson and Paul Zucker, “June 10.” Garden City, N.Y.: Doubleday, Doran, 1943. ML 13.H4. Delius receives a primary entry on 10 June (his death date) plus two other minor entries. The 10 June entry notes that Delius “represents the reawakening of national English music.” There is a brief biographical SUR¿OHOLVWRIFKDUDFWHULVWLFZRUNVDQGSRUWUDLW

829. Diamond, Harold J. Music Analyses: An Annotated Guide to the Literature. New York: Schirmer Books, 1991. xi, 716 p. ISBN 0028701100. ML 128.A7 D5 1991. Contains citations to selected analytical literature for the following works: American Rhapsody, Brigg Fair, Fennimore and Gerda, Koanga, Margot la Rouge, A Mass of Life, Requiem, Song of the High Hills, A Village Romeo and Juliet, Violin Sonatas, Violin Concerto, and Zum Carnival Polka.

830. Diamond, Harold J. Music Criticism: An Annotated Guide to the Literature. Metuchen, N.J.: Scarecrow Press, 1979. x, 316 p. ISBN 0810812681. ML 113.D5. Includes citations to critical and analytical material, including these works: A Mass of Life, the Piano Concerto, Requiem, A Village Romeo and Juliet, and the Violin Concerto. 160 Frederick Delius: A Research and Information Guide

831. Fling, R. Michael. “Delius, Frederick” and “Warlock, Peter.” In Musical Memorials for Musicians: A Guide to Selected Compositions, pp. 55, 218. Lanham, Md.: Scarecrow Press/Music Library Association, 2001. ISBN 0810840138. ML 128.B3 F57 2001. Delius’s Cynara is listed as a memorial to Peter Warlock (Philip Heseltine). There is one work listed as a memorial to Delius: Leslie Mann’s Prelude and Fugue for Small Orchestra.

832. Gooch, Bryan N. S., and David S. Thatcher. Musical Settings of Late Victorian and Modern British Literature: A Catalogue. New York: Garland, 1976. xxiii, 1112 p. Garland Reference Library of the Humanities. ISBN 0824099818. ML 128.V7 G59. Delius’s settings of texts by Ernest Dowson, J. E. Flecker, W. E. Henley, Fiona MacLeod, and Arthur Symons are represented in this work. Each HQWU\JLYHVWKHQDPHRIWKHOLWHUDU\ZRUN¿UVWOLQHGDWHRISXEOLFDWLRQ composer’s name, title of musical work, publication information, form of musical composition, musical forces required, and miscellaneous notes.

833. Greene, Frank. “Delius, Frederick.” In Composers on Record: An Index to Biographical Information on 14,000 Composers Whose Music Has Been Recorded, p. 127. Metuchen, N.J.: Scarecrow Press, 1985. ISBN 0810818167. ML 105.G78 1985. Lists citations to various sources of biographical information on Delius.

834. Kenin, Richard, and Justin Wintle. “Delius, Frederick.” In The Dictionary of Biographical Quotation of British and American Subjects, pp. 229, 589. New York: Knopf, 1978. ISBN 039450027X. CT 773.D38 1978. There are eleven quotations about Delius in this volume, and one quotation by Delius on the English composer .

835. Marks, Henry S. “Delius, Frederick (Jan. 29, 1862–June 10, 1934).” In Who Was Who in Florida, p. 85. Huntsville, Ala.: Strode Publishers, 1973. ISBN 087397039X. F 310.M26. Provides a short description of Delius’s connection to Florida and his activities while resident there. Notes the piano work published in Jacksonville (Zum Carnival Polka DQGKRZ)ORULGDLQÀXHQFHGVHYHUDO of his later works.

836. Mitchell, Alastair, and Alan Poulton, eds. A Chronicle of First Broadcast Performances of Musical Works in the United Kingdom, 1923–1996. Bibliography 161

Aldershot: Ashgate, 2001. xvi, 798 p. ISBN 1859282393. ML 68.M58 2001. ,QFOXGHVLQIRUPDWLRQRQWKH¿UVWEURDGFDVW DVQRWHGLQWKHGDLO\ORJV RI several Delius works.

837. Penney, Barbara, ed. Music in British Libraries: A Directory of Resources. 4th ed. London: Library Association Publishing, 1992. xi, 97 p. ISBN 0853657394. ML 21.G7 P4 1992. Includes information about three collections containing Delius materials: The Royal Northern College of Music, York University J. B. Morrell Library, and a collection of early twentieth-century British sound recordings held privately.

838. Pope, Betty Frances. “Delius, Frederick.” In St James Guide to Biography, edited by Paul Schellinger, pp. 205–206. Chicago: St James Press, 1991. ISBN 1558621466. CT 21.S68 1991. A survey of book-length biographical studies of Delius, with other VLJQL¿FDQWZULWLQJVFLWHGZLWKLQWKHDUWLFOH

839. Sharp, Harold S., and Marjorie Z. Sharp. Index to Characters in the Performing Arts. 4 vols. Metuchen, N.J.: Scarecrow Press, 1969–1972. PN 1579.S45. Part 3 (Ballets) includes entries for Nocturne and Romeo and Juliet.

840. Studwell, William, and David A. Hamilton. Ballet Plot Index: A Guide to Locating Plots and Descriptions of Ballets and Associated Materials. Garland Reference Library of the Humanities. New York: Garland, 1987. xvii, 249 p. ISBN 0824083857. GV 1790.A1 S77 1987. Includes citations to plot sources for Nocturne, Romeo and Juliet, and The Walk to the Paradise Garden.

841. Wenk, Arthur. “Delius, Frederick (1862–1934).” In Analyses of Nineteenth- and Twentieth-Century Music, 1940–1985, pp. 96–97. Boston: Music Library Association, 1987. ISBN 0914954369. ML 113. W45 1987. Lists fourteen citations to musical analyses, arranged by genre and individual work titles.

842. Wilson, G. B. L. A Dictionary of Ballet. 3rd ed. London: A. & C. Black, 1974. xi, 539 p. ISBN 0713613955. GV 1585.W5 1974. 162 Frederick Delius: A Research and Information Guide

Includes entries for ballets Nocturne (“one of Ashton’s best”) and Romeo and Juliet.

Life and Works

This section contains general surveys and studies of the life and musical works RI'HOLXV0DWHULDOVGHDOLQJZLWKDVSHFL¿FDVSHFWRIKLVOLIHDQGZRUNV HJ birthplace, residence, compositional style) or works not having Delius as pri- mary focus can be found in “Topical Studies”; those materials about genre or individual works are located in the “Genre” and “Individual Works” sections, respectively.

Monographs

843. Beecham, Thomas. Frederick Delius. London: Hutchinson, 1959. 227 p. Reprint, New York: Knopf, 1959; New York: Vienna House, 1973. ML 410.D35 B4. This biography was commissioned by Jelka Delius. Beecham notes in the preface that this book is not to be considered a “critical or explanatory account of his music.” For many years Beecham had sole access to approximately 600 letters and documents stored at the Delius home at Grez-sur-Loing. Includes a full list of concert programs from the 1929 Delius Festival. No bibliographical references.

844. Beecham, Thomas. Frederick Delius. Rev. ed. London: Severn House, 1975. 243 p. ISBN 0727800736. ML 410.D35 B4 1975. Revised edition with a new introduction by Felix Aprahamian. Aprahamian adds a short description of how Beecham went about writing the biography and organizing the second Delius festival. Other new material includes the full text of the speech delivered by Beecham at Delius’s reinterment in England, and a discography compiled by Malcolm Walker. The discography lists unpublished recordings and all known commercial disc recordings made by Sir Thomas Beecham, arranged in chronological order.

845. Cahill, Mary. Delius in Danville. Danville, Va.: Danville Historical Society, 1986. xx, 66 p. ML410.D35 C23 1986. A detailed narrative account written to commemorate the centennial anniversary of Delius’s brief stay in Danville. Delius spent nearly a year in Danville as a teacher of music, mostly at the Roanoke Female College (now Averett College). Includes a wealth of background material on the city of Danville, Delius’s associates, a list of students enrolled at Bibliography 163

the college during that time, transcriptions of several letters, numerous illustrations, and an index.

846. Carley, Lionel. Delius, the Paris Years. London: Triad Press, 1975. 96 p. ISBN 0902070142. ML 410.D35 C28. A detailed chronological account of the years Delius spent in Paris from 1888 to 1996. Facsimiles of two unpublished songs (“Chanson [de] Fortunio”, 1889 and “Nuages”, 1893) appear in an appendix.

847. Carley, Lionel, and Robert Threlfall. Delius: A Life in Pictures. Oxford: Oxford University Press, 1977. iv, 99 p. Reprint, London: Thames, 1983. ISBN 0193154374. ML 410.D35 C28. Visual documentation of the life of Delius. Photographs, drawings, and paintings are used as backgrounds for the text, drawn from quotations, letters, and contemporary media reports. Complete documentation of sources for the illustrations and text is given; however, there is no index.

848. Chop, Max. Frederick Delius. Moderne Musiker. Berlin: Harmonie, 1907. 58 p. ML 410.D35 C4. 7KH¿UVWSXEOLVKHGPRQRJUDSKDERXW'HOLXV7KH¿UVWWZRVHFWLRQVRI WKH ERRN SUHVHQW DQ RYHUYLHZ RI KLV OLIH DQG ZRUNV WKH ¿QDO VHFWLRQ (comprising half of the book) is a discussion of Delius as composer. Includes two foldout musical examples. In German.

849. Delius, Clare. Frederick Delius: Memories of My Brother. London: I. Nicholson and Watson, 1935. 276 p. ML 410.D35 D4. Reminiscences written by Delius’s younger sister Clare in the year following his death. This work is particularly valuable for insight into Delius’s early life and his relationship with his father Julius, with whom Delius had a complicated relationship well into adulthood. The author acknowledges that this is not a complete biography, and no attempt is made to discuss his music. There are eight illustrations.

850. Fenby, Eric. Delius. The Great Composers. London: Faber and Faber, 1971. 100 p. Reprint, New York: T. Y. Crowell, 1972. ISBN 0571092969. ML 410.D35 F38. An introduction to the life and works of Delius for the general reader. There are nineteen musical examples, a list of principal works, and a bibliography. 164 Frederick Delius: A Research and Information Guide

851. Fenby, Eric. Delius as I Knew Him. London: G. Bell, 1936. viii, 234 p. Reprint, London: Quality Press, 1948; Westport, Conn.: Greenwood Press, 1975. ML 410.D35 F4 1936. Fenby recorded his account of Delius’s last years from his perspective as the ailing composer’s amanuensis. He gives an eyewitness account of the Deliuses’ daily routine, describes his working relationship with the composer, and provides his impressions of Delius as a person and composer. An appendix gives excerpts in full score from Song of Summer and Songs of Farewell7KH.HQ5XVVHOO¿OPSong of Summer (see no. 1820), was based on this book.

852. Fenby, Eric. Delius as I Knew Him. Rev. ed. London: Icon Books, 1966. xiii, 251 p. Reprint, London: Faber, 1981; New York: Dover, 1994. ML 410.D35 F4 1966. The revised edition adds a new introduction by Sir Malcolm Sargent, an “author’s note to the revised edition,” and an appendix containing a description of Delius’s compositional process (“as told to the author by Delius himself”).

853. Fenby, Eric. Delius as I Knew Him. New and rev. ed. Cambridge: Cambridge University Press, 1981. xxii, 262 p. ISBN 0521245346. ML 410.D35 F4 1981. This new and revised edition omits the full score excerpts and places the revised edition’s appendix as a separate chapter. New material includes an appendix of notes supplied by the author with cues in the main text to these notes, a biographical sketch of Eric Fenby by Christopher Palmer, an afterword by the author, and a list of scores for which Fenby provided assistance.

854. Heseltine, Philip. Frederick Delius. London: J. Lane, 1923. x, 184 p. Also published, London: Bodley Head, 1923. ML 410.D35 H36. 7KH¿UVW(QJOLVKODQJXDJHPRQRJUDSKRQ'HOLXV0XFKRIWKHERRNLV devoted to analysis of selected works; however, there are no musical examples. An appendix includes a list of his works (through 1921), with GDWHVRIFRPSRVLWLRQDQG¿UVWSHUIRUPDQFH

855. Heseltine, Philip. Frederick Delius. Rev. ed. London: J. Cape, 195. x, 184 p. Also published, New York: Oxford University Press, 1952. Reprint, London: J. Lane, 1969; Westport, Conn.: Greenwood Press, 1974. ML 410.D35 H36 1952. Bibliography 165

The revised edition contains some new material, annotations, and comments by Hubert J. Foss.

856. Hull, Robert H. Delius. The Hogarth Essays, Second Series. London: Leonard and Virginia Woolf at The Hogarth Press, 1928, 44 p. ML 410. D35 H8. Partially reprinted from Hull’s article in the Musical Times (see no. 1594). Hull notes that his aim is not to provide a great deal of biographical information (for that the reader is directed to Philip Heseltine’s book; see no. 854), but to provide an alternative view of Delius’s works.

857. Hunt, Norman T. Frederick Delius: A Concert-Goer’s Introduction to the Life and Music of a Great Composer. Hove, Sussex: N. T. Hunt, 1947. 55 p. ML 410.D35 H83. An overview of the composer’s life and works for the nonspecialist. Includes index to compositions discussed in the text.

858. Hutchings, Arthur. Delius. London: Macmillan, 1948. ix, 193 p. Reprint, Westport, Conn.: Greenwood Press, 1970. ML 410.D35 H85. Biography and critical study of Delius’s works. Includes musical examples, a list of works, a bibliography, and a discography.

859. Jahoda, Gloria. The Road to Samarkand: Frederick Delius and His Music. New York: C. Scribner’s Sons, 1969. xi, 248 p. ML 410.D35 J48. A biography written in the style of a historical novel. Relies heavily on the reminiscences of Clare Delius and her daughter, Margaret Vessey. Includes an appendix of selected scores and sound recordings, and index but no bibliography (although several citations to biographical sources are given in the preface).

860. Jefferson, Alan. Delius. The Master Musicians Series. London: Dent, 1972. xi, 179 p. ISBN 0460031317. ML 410.D35 J4. Biography. The author was able to take advantage of documents in the Delius Trust, a luxury not available to previous biographers. Includes one chapter devoted to Delius’s compositional technique. Useful appendices include a calendar noting milestones in Delius’s life as compared with his contemporaries, a catalog of works (prepared by Robert Threlfall), a list and description of Delius’s acquaintances mentioned in the text, a bibliography (prepared by Lionel Carley), an explanation of why the Deliuses chose Grez-sur-Loing as their home, a description of Gauguin’s “Nevermore” (owned by Delius), and a listing of the concerts and works performed at the 1929, 1946, and 1962 Delius Festivals. 166 Frederick Delius: A Research and Information Guide

861. Jenkins, Lyndon. While Spring and Summer Sang: Thomas Beecham and the Music of Frederick Delius. Aldershot: Ashgate, 2005. xii, 197 p. ISBN 0754607216 ML 422.B33 J45 2005. Delves into the relationship between Delius and his most fervent champion, the conductor Sir Thomas Beecham. Beecham not only conducted key performances and recordings of Delius’s music but was instrumental in organizing the Delius Festivals (1929, 1946) and in forming the Delius Trust after Delius’s death. Includes a critical discography and lists of Beecham’s writings on Delius, and his arrangements and orchestrations of Delius’s music.

862. Jenkins, Lyndon and Paul Guinery. Delius & Fenby: A Photographic Journey. Walsall, UK: The Delius Society of Great Britain, 2004. 76 p. ML 410.D35 J46 2004. The content is best summed up as noted on the title page: “A pictorial record of Eric Fenby’s six years as amanuensis to the composer Frederick Delius at Grez-sur-Loing, France between 1928 and 1934.” Most of the photographs are taken from the Delius Trust collections and appear throughout the Delius literature; however, several are newly published. There is no narrative, only chronology and explanatory captions for the photographs. Following the chronology and pictures of the visitors are sections of photographs of residents and neighbors and Delius’s house DQGJDUGHQ7KHODWWHUVHFWLRQ ZKLFKLQFOXGHVÀRRUSODQV LVSDUWLFXODUO\ useful to gain a sense of what the property looked like in Delius’s time.

863. Palmer, Christopher. Delius: Portrait of a Cosmopolitan. London: Duckworth, 1976. xi, 199 p. ISBN 0715607731. ML 410.D35 P3 1976. 7KHERRNGHDOVSULPDULO\ZLWKWKHYDULRXVFRVPRSROLWDQLQÀXHQFHVRQ Delius. The chapters in this book are arranged by the country of residence RULQÀXHQFH,QFOXGHVDELEOLRJUDSK\

Entries in Collective Biographical Sources

864. “Delius, Frederick.” In Composers of Today, 2nd ed. H. W. Wilson Biography Reference Bank. KWWSYQZHEKZZLOVRQZHEFRPÀR\GOLE umn.edu/hww/results/getResults.jhtml?_DARGS=/hww/results/results_ common.jhtml.26 (by subscription, accessed 20 October 2008). Biography, list of works, brief bibliography, and discography.

865. “Delius, Frederick.” In European Composers of Today. H. W. Wilson Biography Reference Bank. KWWSYQZHEKZZLOVRQZHEFRPÀR\GOLE umn.edu/hww/results/getResults.jhtml?_DARGS=/hww/results/results_ common.jhtml.26 (by subscription, accessed 20 October 2008). Bibliography 167

Includes biographical sketch, brief bibliography and list of works.

866. “ Delius, Fritz.” In The Oxford Dictionary of Music, 2nd ed. rev., edited by Michael Kennedy. Oxford Music Online, http://www.oxfordmusiconline. com/subscriber/article/opr/t237/e2840 (by subscription, accessed 20 October 2008). Biographical sketch, discussion of his music, list of works, and links to related articles.

867. “Frederick Delius 1862–1934.” In Composers since 1900: A Biographical and Critical Guide, edited by David Ewen, pp. 158–161. New York: H. W. Wilson, 1969. ISBN 082420400X. ML 390.E833. Available online, H. W. Wilson Biography Reference Bank. http://vnweb.hwwilsonweb. FRPÀR\GOLEXPQHGXKZZUHVXOWVJHW5HVXOWVMKWPO"B'$5*6 KZZ results/results_common.jhtml.26 (accessed 20 October 2008). This survey of Delius’s life and works includes an incorrect marriage date. Includes a separate list of the major works and a brief bibliography. 7KH ¿UVW VXSSOHPHQW DGGV LQIRUPDWLRQ RQ WKH$PHULFDQ SUHPLHUHV RI Koanga and A Village Romeo and Juliet, and the world premiere of The Magic Fountain. The supplement also adds seven books and one article to the bibliography.

868. “Frederick Delius (1862–1934).” In The Music Makers, edited by Clive Unger-Hamilton, pp. 148–149. New York: H. N. Abrams, 1979. ISBN 0810913275. ML 105.M9. Brief survey of Delius’s life and works. Includes a large color rendition of the Ernest Procter portrait.

869. Capell, Richard. “Frederick Delius.” In Great Modern Composers, edited by Oscar Thompson, pp. 78–86. New York: Dodd, Mead, 1941. ML 390.T39 G7. An extensive biography and survey of works drawn from the editor’s International Cyclopedia of Music and Musicians (see no. 807). There is a separate list of works arranged by genre, and a brief bibliography (three titles).

870. Cardus, Neville. “Delius.” In Composers Eleven, pp. 215–235. London: Cape, 1958. Reprint, New York: G. Braziller, 1959; Freeport, N.Y.: Books for Libraries, 1970. ML 390.C3 1959. A revised version of an essay that appeared in the author’s Ten Composers (see no. 871). 168 Frederick Delius: A Research and Information Guide

871. Cardus, Neville. “Delius 1863–1934.” In Ten Composers, pp. 139–152. London: Cape, 1945. Also published, Sydney, Australia: W. Collins, 1945. ML 390.C3 1945. This essay begins with an interesting comparison of the music of Delius and Elgar, then moves on to an analysis of Delius’s musical style. A revised version of this chapter appears in the author’s Composer’s Eleven (see no. 870).

872. Chop, Max. “Frederick Delius.” In Monographien Moderner Musiker, Vol. 2, pp. 84–97. Leipzig: C. F. Kahnt Nachfolger, 1907. ML 390.M66. Reprint with English translation in Jones, Philip, ed. The Collected Writings of the German Musicologist Max Chop on the Composer Frederick Delius (see no. 57), pp. 21–35, 134–177. An enthusiastic essay prompted by recent performances of Appalachia and Sea Drift. Includes list of works and brief biographical information.

873. Colbeck, Maurice. “Frederick Delius 1862–1934.” In Yorkshire History MakersSS±:DNH¿HOG(33XEOLVKLQJ,6%1 CT 785. Y6 C58. $ FROOHFWLRQ RI WZHOYH SUR¿OHV RI IDPRXV SHRSOH FRQQHFWHG ZLWK

874. Cooper, Lettice Ulpha. “Frederick Delius (1863–1934).” In Great Men of Yorkshire (West Riding), pp. 142–160. London: The Bodley Head, 1955. Reprint, London: Bodley Head, 1959. CT 785.Y6 C6. %LRJUDSKLFDOSUR¿OH$UHSURGXFWLRQRIWKHSDLQWLQJRI'HOLXVE\(UQHVW Procter is included in the section of plates. No bibliography or index.

875. Cross, Milton, and David Ewen. “Frederick Delius.” In Milton Cross’ Encyclopedia of the Great Composers and Their Music, Vol. 1, pp. 206–214. Garden City, N.Y.: Doubleday, 1953. Rev. and expanded ed., 1969. ML 385.C7. Provides a biographical sketch, overview of his music, and analytical notes for On Hearing the First Cuckoo in Spring, Summer Night on the River, Brigg Fair, and In a Summer Garden. The 1969 edition adds analytical notes for The Walk to the Paradise Garden and Eventyr.

876. Ewen, David. “Frederick Delius.” In The Book of Modern Composers, pp. 103–116. New York: Knopf, 1950. ML 390.E83 1950. Bibliography 169

Contains a portrait, biographical sketch, a “personal note” drawn from Eric Fenby’s Delius As I Knew Him (see nos. 851–853), and a reprint of Bernard van Dieren’s Musical Times article (see no. 918).

877. Ewen, David. “Frederick Delius.” In Twentieth Century Composers, pp. 187–199. New York: Thomas Y. Crowell, 1937. Reprint, Crowell, 1942; Books for Libraries, 1968. ML 390.E85. Biographical essay. Ewen notes the confusion over Delius’s birthdate, and was among the earliest to speculate that the purpose of Delius’s 1897 American trip was to search for a lost love (Ewen cites Percy Grainger as his source on this topic).

878. Ewen, David. “Frederick Delius 1862–1934.” In The Complete Book of 20th Century Music, pp. 95–100. New York: Prentice-Hall, 1952. MT 90.E9. &RQWDLQV D ELRJUDSKLFDO SUR¿OH DQG GHVFULSWLRQV LQFOXGLQJ ¿UVW performance information) of these works: Brigg Fair, In a Summer Garden, A Mass of Life, On Hearing the First Cuckoo in Spring, Sea Drift, The Song of the High Hills, A Song of Summer, Summer Night on the River, and A Village Romeo and Juliet.

879. Ewen, David. “Frederick Delius 1862–1934.” In The World of Twentieth- Century Music, pp. 211–219. Englewood Cliffs, N.J.: Prentice-Hall, 1968. 2nd ed. rev. by Stephen J. Pettit. London: Hale, 1991. ML 390. E87. Includes a critical analysis of Delius’s style, a biography, and programmatic descriptions of selected works (A Village Romeo and Juliet, Sea Drift, A Mass of Life, Brigg Fair, In a Summer Garden, Dance Rhapsody nos. 1–2, The Song of the High Hills, On Hearing the First Cuckoo in Spring, Eventyr, Requiem, Song of Summer, and Irmelin Prelude).

880. Grew, Sydney. “Frederick Delius.” In Our Favourite Musicians, from Stanford to Holbrooke, pp. 249–263. Edinburgh: T. N. Foulis, 1922. 2nd ed., Edinburgh: Foulis 1924; London: P. Davis, 1924. ML 390.G9. A survey of Delius’s life and works primarily intended for younger readers.

881. Hiscock, Terry. “Frederick Delius.” In Composing Mortals: 20th-Century British Classical Composers, pp. 70–78. London: Thames, 1998. ISBN 090521062X. ML 390.H58 1998. 170 Frederick Delius: A Research and Information Guide

Brief overview of Delius’s life and works intended for the nonspecialist.

882. Holbrooke, Josef. “Frederick Delius.” In Contemporary British Composers, pp. 147–161. London: Cecil Palmer, 1925. ML 390.H73. Biography and discussion of Delius’s works. Includes musical examples, a portrait, and a list of Delius’s published works.

883. Jefferson, Alan. “Delius, Frederick (Fritz Theodore Albert).” In Makers of Modern Culture, edited by Justin Wintle, pp. 126–128. New York: Facts on File, 1981. ISBN 0871964937. CT 120.M36 1981. A more substantial discussion of Delius’s life and works than most general sources of this kind. Includes a list of selected works and bibliography.

884. Kennedy, Michael. “Delius, Frederick (Theodore Albert).” In The New Oxford Companion to Music, edited by Denis Arnold, Vol. 1, p. 546. Oxford: Oxford University Press, 1983. ISBN 0193113163. ML 100.N5 1983. Contains a survey of his life and works. Kennedy describes Delius’s music as being “principally concerned with nostalgia for lost love, and SHUKDSV WKH ¿QHVW H[DPSOH RI LW LV Sea Drift (1903–1904).” Includes portrait and brief bibliography.

885. Kennedy, Michael. “Delius, Frederick (Theodore Albert).” In The Oxford Companion to Music, edited by Alison Latham. Oxford Music Online, http://www.oxfordmusiconline.com/subscriber/article/opr/t114/ e1868 (by subscription, accessed 20 October 2008). Biographical sketch and bibliography.

886. Leach, Gerald. “Delius, Frederick (1862–1934).” In British Composer 3UR¿OHV, pp. 31–32. London: British Music Society, 1989. ISBN 1870536037. ML 390.L35 1989. A brief biographical sketch and discussion of his works.

887. Oxbury, Harold. “Delius, Frederick.” In Great Britons: Twentieth Century Lives, pp. 98–99. Oxford: Oxford University Press, 1985. ISBN 0192115995. CT 783.O93 1985. An overview of Delius’s life and works. There is no bibliography, but the Heseltine and Fenby books are mentioned in the article. Curiously, Beecham’s book on Delius is listed only in the article on Beecham, and not in the Delius entry. Bibliography 171

888. Payne, Anthony. “Frederick Delius.” In The New Grove Twentieth- Century English Masters, pp. 67–94. New York: Norton, 1986. Reprint, Twentieth-Century English Masters. London: Macmillan, 1986. ISBN 0393022854. ML 390.N47 1986. Revised and updated articles drawn from the New Grove Dictionary of Music and Musicians (1980) (see no. 805). Includes a list of works, a bibliography, and an index.

889. Scholes, Percy. “Delius, Frederick.” In The Oxford Companion to Music, edited by John Owen Ward, p. 286. London: Oxford University Press, 1970. ML 100.S37 1970. A concise survey of his life and works.

890. Schonberg, Harold C. “The English Renaissance: Elgar, Delius, Vaughan Williams.” In The Lives of the Great Composers, pp. 492–509. New York: W. W. Norton, 1997. ISBN 0393038572. ML 390.S393 1997. An overview of the lives and works of the three composers and a discussion of their places in musical history.

891. Smith, Jane Stuart, and Betty Carlson. “Frederick Delius (1862–1934).” In $*LIWRI0XVLF*UHDW&RPSRVHUVDQG7KHLU,QÀXHQFH, pp. 195–205. Westchester, Ill.: Good News, 1978. ISBN 0891071598. ML 390.S642. A survey of Delius’s life and works along with a list of recommended sources for reading and listening (titles only, no record labels or numbers). The text was originally given as a lecture in the Farel House Lecture series at L’Abri Fellowship, Switzerland.

892. Streatfeild, R.A. “Frédéric Delius.” In Musiciens anglais contemporains, pp. 49–68. Paris: Éditions du temps présent, 1913. ML 390.S9. An overview of Delius’s life and works partially based on his article in Grove’s Dictionary of Music and Musicians (see no. 819). Includes a general index, but no illustrations or bibliography. In French.

Chapters and Essays in Miscellaneous Sources

893. Flanner, Janet. “Frederick Delius (1862–1934).” In Paris was Yesterday, 1925–1939, edited by Irving Drutman, pp. 119–120. New York: Viking Press, 1972. xxiv, 232 p. DC 715.F57. Death notice drawn from the author’s column originally published in the New Yorker. She offers an interesting explanation for Delius’s blindness! 172 Frederick Delius: A Research and Information Guide

894. Grainger, Percy. “About Delius.” In Grainger on Music, edited by Malcolm Gillies and Bruce Clunies Ross, pp. 361–368. Oxford: Oxford University Press, 1999. ISBN 0198166656. ML 60.G74 1999. An excerpt from Philip Heseltine’s Delius, rev. ed., pp. 170–180 (see no. 855).

895. Gray, Cecil. “Frederick Delius.” In A Survey of Contemporary Music, pp. 58–77. London: Oxford University Press, 1924. Reprint, Freeport, N.Y.: Books for Libraries, 1969; 2nd ed., 1927; reprint, Westport, Conn.: Greenwood, 1972. ML 197.G7. &KLHÀ\DVXUYH\RI'HOLXV¶VZRUNV7KHDXWKRUGHFODUHVKLVHVVD\WREH ³VXSHUÀXRXV´ DIWHU WKH SXEOLFDWLRQ RI 3KLOLS +HVHOWLQH¶V ELRJUDSK\ RI Delius (although Gray notes that the majority of the text was completed prior to the publication of Heseltine’s book). The second edition adds an index.

896. Hill, Ralph. “Frederick Delius.” In British Music of Our Time, edited by A. L. Bacharach, pp. 30–43. Harmondsworth, Middlesex, England: Pelican Books, 1946. New ed., 1951. ML 285.B3. Biographical sketch, a survey of works, and a discography.

897. Hutchings, A. F. B. “The Nineteenth Century: The Indian Summer.” In The Pelican History of Music, Vol. 3, edited by Alec Robertson and Denis Stevens, pp. 219–237. Baltimore: Penguin Books, 1968. ML 160. R665. Includes a biographical sketch and remarks on Delius’s compositional style.

898. Jahoda, Gloria. “The Music-Maker of Solano Grove.” In The Other Florida, pp. 246–269. New York: C. Scribner’s Sons, 1967. Reprint, Port Salerno, Fla.: Valentine Books, 1978; Port Salerno, Fla.: Florida Classics Library, 1984. F 316.2.J3. The author recounts her search for remnants of Delius’s life at Solano Grove. A short post-Delius history of his cottage is given as well as a description of a visit with an elderly woman named Julia Sanks, an occasional worker at Solano Grove. Photographs by the author include the Sanks house, a view of the St. Johns River from Solano Grove, and the cottage as restored at Jacksonville University. No bibliography or index. Bibliography 173

899. Kinscella, Hazel Gertrude. “Delius, Frederick.” In Music on the Air, pp. 303–304. New York: Viking Press, 1934. MT 150.K56. &RQWDLQVDEULHIELRJUDSKLFDOSUR¿OHDQGGHVFULSWLYHQRWHVIRUAppalachia, Brigg Fair, North Country Sketches, and A Song of the High Hills.

900. Raynor, Henry. Music in England. London: R. Hale, 1980. 256 p. ISBN 0709183569. ML 286.R38. Includes a discussion of Delius’s life and works on pp. 183–185.

901. Searle, Humphrey, and Robert Layton. “The Last Romantics, Elgar and Delius.” In Britain, Scandinavia and the Netherlands, pp. 1–21. London: Weidenfeld and Nicolson, 1972. Reprint, New York: Holt, Rinehart and Winston, 1973. ISBN 0297993771. ML 390.S445 B7. %LRJUDSKLFDOSUR¿OHDQGVXUYH\RIZRUNV

902. Taylor, Deems. “Orange Grower.” In Of Men and Music, pp. 35–39. New York: Simon and Schuster, 1937. MT 6.T26 O31. One of a collection of radio talks supplemented by the author’s writings, it tells the story of Delius’s Florida years. It is written in an accessible style, with added dialogue.

Articles

903. “Frederick Delius (1862–1934).” Classical.net. http://www.classical. net/music/comp.lst/delius.php (accessed 22 October 2008). The Delius page contains a biographical sketch by Jane Erb, links to ¿YH RWKHU 'HOLXVUHODWHG ZHEVLWHV DQG D OLVW RI EDVLF UHSHUWRLUH DQG recommended recordings. The basic repertoire list is curiously limited to Brigg Fair, On Hearing the First Cuckoo in Spring, and tone poems— perhaps evidence of the rather uneven level of expertise coming from the volunteer contributors. Delius is also represented unevenly in the other areas of the website, notably the bibliography and the lists of basic repertoire and recommended recordings.

904. Ackere, Jules van. “Un musicien méconnu: Frederick Delius, coloriste.” Revue générale belge 5 (1968): 75–86. Survey of his life and works. In French.

905. Ackere, Jules van. “Frederick Delius of de wellust van de klank.” Academiae Analecta 44, no. 3 (1983): 59–122. 174 Frederick Delius: A Research and Information Guide

A study of Delius’s life, works, and compositional style. Includes musical examples and a bibliography. In Dutch.

906. Ainsley, Rob. “Delius: Music for All Seasons?” Classic CD (October 1993): 24–27. An introduction to the music of Delius for the unfamiliar listener. Includes several illustrations, a chronology, and a selective list of works.

907. Berry, Leland J. “Frederick Delius.” Musical Standard (11 August 1928): 40. Brief discussion of Delius’s life and works.

908. Brian, Havergal. “The Art of Delius,” parts 1 through 8. Musical Opinion 47 (1923–1924): 598, 700–701, 799–800, 906–907, 1002–1003, 1098, 1194–1195; 48 (1924): 49–50. Reprinted in a condensed version in Havergal Brian on Music: Selections from His Journalism, Vol. 1, edited by Malcolm MacDonald (see no. 1002), pp. 100–131. A series of eight articles that provides an enthusiastic appraisal of Delius’s works. The series was under way before the author became aware of Philip Heseltine’s book, and thus the author notes his slightly different view of some of Delius’s works.

909. Brian, Havergal. “Delius: The Last Phase.” Musical Opinion (December 1936): 201–202. Reprint Havergal Brian on Music: Selections from His Journalism, Vol. 1, edited by Malcolm MacDonald (see no. 1002, p. 141–145). In response to Eric Fenby’s Delius As I Knew Him (see nos. 851–853), DERRNFRYHULQJ'HOLXV¶V¿QDO\HDUV%ULDQVWDWHVKLVZLVKIRUDERRN covering his earlier years “recreating the sense of life in and around him when his masterpieces were written.” Reprinted from Brian’s Musical Opinion column “On the Other Hand.”

910. Brian, Havergal. “The Passing of Delius.” Musical Opinion 57 (July 1934): 861. Reprinted in Havergal Brian on Music: Selections from His Journalism, Vol. 1, edited by Malcolm MacDonald (see no. 1002), pp. 137–139. An obituary and personal reminiscence.

911. Cameron, Norman. “The Delius Society.” Gramophone (March 1933): 389–391. Bibliography 175

%LRJUDSKLFDOSUR¿OHDQGGLVFXVVLRQRIKLVZRUNVDQGUHFRUGLQJV,QFOXGHV discographical information.

912. Carley, Lionel. “Frederick Delius: et 50 års minne.” Nordisk musikktidsskrift 23 (January 1986): 28–33. $VXUYH\RI'HOLXV¶VOLIHDQGZRUNVLQFRPPHPRUDWLRQRIWKH¿IWLHWK anniversary of his death. The author’s name is misspelled as “Cartley” throughout the article. In Norwegian.

913. Chatterton, Julia. “The Morning and Afternoon of Delius.” The Sackbut (October 1929): 77–78. 5HPDUNVRQWKHUHFHSWLRQRI'HOLXV¶VPXVLFDQGQRWHVWKHLQÀXHQFHRI folklore in his music.

914. Chop, Max. “Frederick Delius.” Signale für die musikalische Welt (1927): 1315. Not available for examination.

915. Chop, Max. “Frederick Delius: eine biographische Studie mit Bildbeilage.” Musikalisches Wochenblatt/Neue Zeitschrift für Musik, nos. 35–36 (29 August 1907): 705–706; no. 37 (12 September 1907): 731–732. Reprint with English translation in Jones, Philip, ed. The Collected Writings of the German Musicologist Max Chop on the Composer Frederick Delius (see no. 57), pp. 51–62, 163–173. %LRJUDSKLFDO SUR¿OH IROORZHG E\ DQ DVVHVVPHQW RI 'HOLXV¶V ZRUNV Includes a list of works and a list of recent performances.

916. Chop, Max. “Tonsetzer der Gegenwart: Fréderick Delius, sein Leben und Schaffen.” Neue Musik Zeitung 31, no. 15 (1910): 310–314; no. 16 (1910): 332–335. Reprint with English translation in Jones, Philip, ed. The Collected Writings of the German Musicologist Max Chop on the Composer Frederick Delius (see no. 57), pp. 100–122, 215–238. ,QFOXGHVDELRJUDSKLFDOSUR¿OHOLVWRISHUIRUPDQFHVDQGDGLVFXVVLRQ of Delius’s musical style and major works. Illustrated with three photographs.

917. Cumberland, Gerald [Charles Kenyon]. “Pen Portraits of Musicians: Frederick Delius.” Musical Opinion (July 1909): 700. Reprint, in Redwood, Christopher. A Delius Companion (see no. 59), pp. 19–23. This written sketch originally appeared in a series of articles published in the Musical Opinion. In the Redwood volume, a reprint of the 176 Frederick Delius: A Research and Information Guide

DUWLFOHLVDFFRPSDQLHGE\WZROHWWHUVWKH¿UVWLVDOHWWHUWRWKHMusical Opinion editor from Delius, stating that he did not realize he was being “interviewed,” and a subsequent letter from Cumberland noting that he did not consider it to be an interview.

918. Dieren, Bernard van. “Frederick Delius: January 29, 1863–June 10, 1934.” Musical Times 75, no. 1097 (July 1934): 598–604. Obituary and tribute.

919. Dieren, Bernard van. “Delius.” Monthly Musical Record 64 (July– August 1934): 121–123. Obituary and tribute.

920. Evans, Edwin. “Frederick Delius 1862–1934.” Chesterian, no. 117 (September–October 1934): 1–5. Obituary and tribute.

921. Foss, Hubert. “Frederick Delius,” parts 1 and 2. Crescendo, no. 30 (October 1950): 5; no. 40 (June 1951): 339. 3UR¿OH

922. Gardiner, Bennett. “Delius and Reality.” Musical Opinion 106 (September 1983): 373–374, 382. A survey of the life and works of, and literature about, Delius.

923. Gifford, Katya. “Frederick Delius (1862–1934).” Humanities Web. http://www.humanitiesweb.org (accessed 22 October 2008). The author offers biographical information about the life and works of Delius as part of the larger Humanities website. Includes a bibliography of books about Delius, as well as a lists of key works, selected quotes, recommended recordings, and other information. A photograph of Delius appears on the opening page of the Delius index.

924. Grew, Sydney. “Musicians, III: Frederick Delius.” Midland Musician (March 1926): 91–94. Discussion of Delius’s life and career, and a brief list of compositions. Includes a portrait.

925. Heseltine, Philip. “Introductions, V: Frederick Delius.” Music Bulletin 5 (May 1923): 144–147. Reprint, Delius Society Journal no. 94 (1987), pp. 23–25. Bibliography 177

An overview of the philosophy and chief characteristics of Delius’s music.

926. Heseltine, Philip. “Musik in England: Frederick Delius.” Musikblätter des Anbruch 4, no. 5–6 (March 1922): 81–83. Survey of Delius’s works. The article was originally written in English and then translated to German by Rose Hoffman. An English translation by Evelin Gerhardi of the German article was published in Delius Society Journal no. 94 (1987): 21–22.

927. Heseltine, Philip. “Some Notes on Delius and His Music.” Musical Times 56, no. 865 (March 1915): 137–142. Reprint, Delius Society Journal no. 94 (1987): 3–10; “From the Archive: A Good European: Philip Heseltine Introduces the Music of Delius.” Musical Times 138 (September 1997): 29–33. A survey of Delius’s works along with an explanation of his unique harmonic style.

928. Heseltine, Philip. “The Yorkshire Genius of Friday’s Concert.” Radio Times 22 (1 February 1929): 259, 273. Reprint, Delius Society Journal no. 94 (1987): 33–35. An overview of Delius’s life and works, with particular attention to the works to be broadcast 8 February 1929.

929. Holbrooke, Josef. “Musical Impressions XIII: Of Fritz Delius.” Musical Standard (13 April 1907): 233. Survey of his life and works. Holbrooke claims (in his Contemporary British ComposersVHHQR WKLVWREHWKH¿UVWPDMRUDUWLFOHDERXW Delius written in English.

930. Hove, Richard. “Frederick Delius, 1862–1962: et hundredeårsminde.” Nordisk tidskrift för vetenskap, konst och industri. Årg. 40 Häfte 2 (1964): 93–104. Biographical sketch and centennial tribute.

931. Hull, Robin. “The Range of Delius.” Disc 4 (autumn 1950): 100–104. Short survey of Delius’s major works.

932. Hussey, Dyneley. “Frederick Delius.” The Spectator 5 (15 June 1934): 921. Obituary. 178 Frederick Delius: A Research and Information Guide

933. Lambert, Constant. “The Intimate Appeal of Delius.” Radio Times (22 June 1934): 899. Obituary and tribute. Includes a photograph (credited to Peggy Delius) of Frederick and Jelka “shortly before his death.”

934. Marx, Joseph. “Frederick Delius.” Musikblätter des Anbruch 1, no. 2 (November 1919): 49–53. Evaluation of Delius’s works, and a comparison with Edvard Grieg and Edward MacDowell. In German.

935. Mellers, Wilfrid. “Composer of the Month: Frederick Delius.” BBC Music Magazine 11 (October 2002): 50–54. Survey of Delius’s life and works. Includes a timeline, notes on his style, a brief bibliography, and a discography.

936. Millar, Sherran. “The Magic of Delius: Was Sir Thomas Beecham Right?” Etude 66 (April 1948): 230, 266. &KLHÀ\DVXUYH\RI'HOLXV¶VOLIHDQGZRUNVZLWKDIHZUHPDUNVDERXWWKH lack of Delius works being presented in the concert hall.

937. Moeran, E. J. “Music.” Weekly Westminster Gazette 2, no. 72 (30 June 1923): 14. A preview of Philip Heseltine’s biography of Delius.

938. Nichols, Robert. “Delius and His Work.” London Calling, no. 247 (July 1944): 9. A brief appreciation of Delius and his work.

939. Pirie, Peter J. “Delius the Unknown.” Music and Musicians 19, no. 11 (1970–1971): 34–40. A discussion of Delius’s reputation and works. Illustrations are taken from Eric Fenby’s Delius (see no. 851).

940. Reeser, Eduard. “Frederick Delius (1863–1934). Caecilia en de muziek (August–September 1934): 398–415. Obituary and survey of works. Includes separate list of works and musical examples. In Dutch.

941. Rondo. “Frederick Delius,” parts 1 through 4. Canon 1 (August 1947): Bibliography 179

23–24; (September 1947): 24–26; (October 1947): 33–35; (November 1947): 37–39. %LRJUDSKLFDOSUR¿OHLQIRXULQVWDOOPHQWV

942. Runciman, John F. “Fritz Delius, Composer.” The Musical Courier (18 March 1903): 16–17. Reprint, Redwood, Christopher. A Delius Companion (see no. 59), pp. 13–18. A brief biographical sketch and survey of works.

943. Runciman, John F. “Some Modern English Composers III.” Musical World 1 (June 1901): 63–65. Biographical sketch and list of works.

944. Simon, Heinrich. “Frederick Delius,” parts 1 and 2, Musical Opinion (February 1935): 406–407; (March 1935): 503–504. Discussion of Delius’s life and musical style and reception, translated by H. Grunbaum.

945. Simon, Heinrich. “Frederick Delius zum 60. Geburtstag am 29 Jänner 1923,” parts 1 and 2. Musikblätter des Anbruch 5 (January 1923): 1–6; 5 (February 1923): 45–50. An extended survey and discussion of Delius’s works and compositional style, taken from a planned biography of Delius that was never published.

946. Smith, Carleton. “A Note on Delius: Not for Everybody, His Music Requires the Complement of a Discriminating Ear.” Coronet 6 (August 1939): 116. Provides a brief introduction to Delius’s life and works.

947. Stefan, Paul. “Delius.” Anbruch (June 1934): 118–119. Obituary. In German.

948. Stefan, Paul. “Ein Wort für Delius zu seinem siebzigsten Geburtstag.” Anbruch (February–March 1932): 48–49. Brief survey of Delius’s life and works on the occasion of his seventieth birthday.

949. Steinhauer, Walter. “Frederick Delius.” Melos 13, no. 7–8 (July–August 1934): 253. Obituary. In German. 180 Frederick Delius: A Research and Information Guide

950. Weigl, Bruno. “Frederic Delius.” Musikalisches Wochenblatt/Neue Zeitschrift für Musik Heft 8 (26 May 1910): 79–80. Survey of Delius’s works followed by a brief paragraph of biographical details.

TOPICAL STUDIES

Monographs

951. Beecham, Thomas. A Mingled Chime: An Autobiography. New York: G. P. Putnam, 1943. viii, 330 p. Reprint, New York: Da Capo, 1976; Westport, Conn.: Greenwood Press, 1976. ML 422.B33 B2. Although there is a separately titled chapter on Delius (pp. 113–120), the entire book is invaluable for insight on the conductor and his relationship with Delius.

952. Bird, John. Percy Grainger. 3rd ed. Oxford: Oxford University Press, 1999. xv, 317 p. ISBN 0198166524. ML 410.G75 B6 1999. First published, London: P. Elek, 1976. 'HOLXV¿JXUHVWKURXJKRXWWKLVELRJUDSK\RI3HUF\*UDLQJHU7KHFKDSWHU “Unto Brigg Fair” gives a detailed account of how Grainger acquired the folk song “Brigg Fair,” and Delius’s subsequent setting of it. There is also some information about Joseph Taylor, singer of “Brigg Fair,” and DGHVFULSWLRQRIWKH¿UVWSHUIRUPDQFHRI'HOLXV¶VUKDSVRG\DWWHQGHGE\ Grainger, Delius, and Taylor.

953. Bray, Trevor, Bantock: Music in the Midlands before the First World War. London: Triad Press, 1973. 36 p. ISBN 090207007X. ML 410.B21 B7. Based on a chapter from the author’s dissertation (Ph.D., Cambridge University, 1972). Provides information on Delius’s involvement as vice president of the Musical League. Correspondence between Bantock and Delius is extensively quoted and documented.

954. Campbell, Margaret. Julian Lloyd Webber: Married to Music, the Authorised Biography. London: Robson Books, 2000. xv, 205 p. ISBN 1861054009. ML418.L66 C3 2000. Describes cellist Lloyd Webber’s interest in Delius’s music and his friendship with Eric Fenby. Includes bibliography and discography. Bibliography 181

955. Clifford, Phil. Grainger’s Collection of Music by Other Composers. Parkville, Victoria, Australia: Grainger Museum, 1983. viii, 435 p. ISBN 0868391425. ML 134.G78 G7. A catalog of musical works housed in the Percy Grainger Music Collection. Percy Grainger assembled the collection by asking his composer friends to contribute their works. Listings of the musical works are divided by format and arranged by composer. Several Delius works are listed in the various sections; a facsimile of a page from the autograph score of the Florida Suite (with margin notes by Eric Fenby) appears on p. 226. Includes indexes and appendices.

956. Crombie, John. &KH]&KDUORWWHDQG)LQGH6LqFOH0RQWSDUQDVVH. Paris: Kickshaws, 2003. 131 p. DC 752.M8 C76 2003. Commemorates the centenary of Chez Charlotte, a small restaurant located in the Montparnasse area of Paris. During the 1890s, it was a favorite gathering place for artists and musicians, including Delius and his future wife, Jelka Rosen.

957. Davidson, Gladys. Stories of the Ballets. London: T. Werner Laurie, 1949. MT 95.D2 S93. Synopses of the ballets Nocturne and Romeo and Juliet. The ballet title index gives brief production information (story source, composer, FKRUHRJUDSKHUVFHQHU\DQGFRVWXPHGHVLJQHUVDQGGHWDLOVRIWKH¿UVW production).

958. Douglas-Home, Jessica. Violet: The Lives and Loves of Violet Gordon Woodhouse. London: Harvill Press, 1996. x, 342 p. ML 417.G67 D6 1996. Delius wrote his Dance for harpsichord for the English harpsichordist Violet Gordon Woodhouse. This biography of Gordon Woodhouse includes an account of the writing and performing of this work.

959. Foreman, Lewis, ed. Music in England 1885–1920: As Recounted in Hazell’s Annual. London: Thames, 1994. viii, 121 p. ML 286.4.M87 1994. Includes a review of Delius’s self-produced 1899 concert.

960. Gillespie, Don. The Search for Thomas F. Ward, Teacher of Frederick Delius. Gainesville: University Press of Florida, 1996. xvi, 180 p. ISBN 0813013984. ML 423.W297 G55 1996. 182 Frederick Delius: A Research and Information Guide

A biography of Thomas F. Ward, a Jesuit and musician resident in Jacksonville, Florida, whom Delius met by chance in a local music store. Delius persuaded Ward to return to Solano Grove with him, and later called his studies with Ward invaluable. Numerous illustrations, a bibliography, and an index enhance the text.

961. Goossens, Eugene. Overture and Beginners: A Musical Autobiography. London: Methuen, 1951. viii, 327 p. Reprint, Westport, Conn.: Greenwood Press, 1976. ML 410.G643 A3. Includes reminiscences of Delius by violinist and conductor Eugene Goossens.

962. Gray, Cecil. Musical Chairs, or between Two Stools. London: Home and Van Thal, 1948. 324 p. Reprint, London: Hogarth, 1985. ML 423.G75 A3. Reprinted in part, “Memories of Delius,” in Redwood, Christopher. A Delius Companion (see no. 59), pp. 135–145. Despite his previous complimentary writings about Delius’s music, English critic and composer Cecil Gray can hardly conceal his dislike of Delius as a person. He describes in detail his visit with Delius in Grez- sur-Loing (pp. 185–199). Delius is mentioned in passing elsewhere in the volume.

963. Gray, Michael. Beecham: A Centenary Discography. New York: Holmes & Meier, 1979. xi, 129 p. ISBN 0841905827. ML 156.7.B43 G7. Contains lists of all known commercial acoustical and electrical UHFRUGLQJV LQFOXGLQJ WKH GH¿QLWLYH 'HOLXV UHFRUGLQJV  PDGH E\ 6LU Thomas Beecham as conductor, pianist, or speaker. The lists are arranged in numerical order by matrix number or recording date. Includes indexes of composers and works, and performers.

964. Gunnarsson, Torsten. The Painters in Grez-sur-Loing. Tokyo: Yomiuri Shimbum, 2000. 303 p. ND551.G74 P3 2000. Catalog of an exhibition held in Japan that featured 146 paintings from collections in seven different countries. Delius is mentioned throughout, and there is a photograph of the Delius’s house (by Toru Arayashiki, ZKR GHYLVHG WKH H[KLELW  7H[W FKLHÀ\ LQ -DSDQHVH EXW ¿YH RI WKH essays have been translated to English. Includes color illustrations and bibliographical references.

965. Healey, Derek. 7KH,QÀXHQFHRI$IULFDQ$PHULFDQ0XVLFRQWKH:RUNV of Frederick Delius. Philadelphia, Pa.: Delius Society Philadelphia Bibliography 183

Branch, 2003. 129 p. ISBN 0615123643. ML 410.D35 H32 2003. Also published: New York: Healey, 2001. viii, 118 p. Revised and enlarged version of a paper given at the College Music 6RFLHW\2FWREHU ³7KH,QÀXHQFHRI%ODFN$PHULFDQ0XVLFRQ the Works of Frederick Delius: Fact or Nostalgia?”); the 2003 edition was made available to university libraries and the Delius Trust, but is currently not commercially available. After introductory sections on Delius and African American music, the author looks for elements common to Delius’s music and African American folk music. Includes many musical examples with an index, and a bibliography.

966. Heseltine, Nigel. Capriol for Mother: A Memoir of Philip Heseltine (Peter Warlock). London: Thames, 1992. 176 p. ISBN 0905210816. ML 410.W289 H584. Nigel Heseltine, son of Philip Heseltine, presents his memories of a father whom he says he saw “perhaps a dozen times” in his life. These undocumented recollections are based on his memories and family papers, some of which have apparently been destroyed. The book contains a discussion of the complicated relationships between Delius, Philip, Philip’s mother (Edith Covernton), and his “Uncle Joe” Heseltine, who resided in a French village not far from the Deliuses in France.

967. Hollander, Hans. Music und Jugendstil. Zürich: Atlantis, 1975. 143 p. ISBN 3761104480. ML 3849.H73. A brief discussion of Jugendstil elements found in Sea Drift and A Village Romeo and Juliet. Includes musical examples.

968. Housewright, Wiley L. A History of Music and Dance in Florida. Tuscaloosa: University of Alabama Press, 1991. 494 p. ISBN 0817304924. ML 200.7.F6 H7 1991. Historical survey of music in Florida, a state noted for its long history of music and musical population.

969. Howes, Frank. The English Musical Renaissance. London: Secker and Warburg, 1966. 381 p. Also published New York: Stein and Day, 1966. ML 286.H69 1966. $Q H[WHQGHG GLVFXVVLRQ RI 'HOLXV¶V OLIH ZRUNV DQG VLJQL¿FDQFH IRU (QJOLVKPXVLFLQVSLWHRIKLVGHFLGHGO\FRVPRSROLWDQLQÀXHQFHV,QFOXGHV a reproduction of the James Gunn portrait.

970. Hughes, Meirion, and Robert Stradling. The English Musical Renaissance, 1840–1940: Constructing a National Music. 2nd ed. 184 Frederick Delius: A Research and Information Guide

Manchester: Manchester University Press, 2001. xxi, 330 p. First edition published as The English Musical Renaissance, 1860–1940. London: Routledge, 1993. ISBN 0719058295. ML 286.4.H84 2001. :KLOH'HOLXVGRHVQRW¿JXUHVWURQJO\LQWKLVFKURQRORJLFDOVWXG\RIWKH English musical renaissance, it is of interest for the broader picture of the social and political context at the time.

971. Jones, Philip. The American Source of Delius’ Style. Outstanding Dissertations in Music from British Universities. New York: Garland, 1989. 559 p. ISBN 0824020146. ML 410.D35 J6 1989. $ VWXG\ RI YDULRXV $PHULFDQ LQÀXHQFHV RQ 'HOLXV¶V FRPSRVLWLRQDO style, based on the author’s Ph.D. thesis (University of Birmingham, 1981). Includes a reconstruction of the tone poem American Rhapsody for orchestra (1896). The author claims this work to be unique among Delius’s compositions in that it directly shows the assimilation of these $PHULFDQLQÀXHQFHV

972. Kruse, Gottfried. Frederick Delius, Béla Bartók. Wilhelmshaven: F. Noetzel, 2000. 80 p. ISBN 3795907977. ML 410.D45 K7 2000. Presents the correspondence between Delius and Béla Bartók. Includes a brief biography by Lionel Carley and bibliography. In German.

973. Lee-Browne, Martin. Nothing so Charming as Musick! The Life and Times of Frederic Austin, Singer, Composer, and Teacher. London: Thames, 1999. 176 p. ISBN 9780905211060. ML 420.A935 L477 1999. )UHGHULF $XVWLQ D OHDGLQJ (QJOLVK EDULWRQH JDYH WKH ¿UVW (QJOLVK performance of Sea Drift. This book provides an interesting look at Delius’s friends known as the “Frankfurt Gang,” which included Austin, Norman O’Neill, and Balfour Gardiner, among others.

974. Norris, Gerald. A Musical Gazetteer of Great Britain and Ireland. Newton Abbot: David and Charles, 1981. 352 p. ISBN 0715378457. ML 285.N67 1981. There are nine entries for places associated with Delius. Includes an index.

975. Osato, Sono. Distant Dances. New York: Knopf, 1980. xi, 301 p. ISBN 0394508912. GV 1785.O6 A33 1980. Includes a discussion of the ballet Romeo and Juliet on pp. 200–205. The author danced the role of Rosaline in the production; there is one photograph of the author in this role. Bibliography 185

976. Pirie, Peter J. The English Musical Renaissance. London: V. Gollancz, 1979. 270 p. Also published, New York: St. Martin’s Press, 1980. ISBN 0575026790. ML286.5.P6. This chronological study of English musical history includes a discussion of Delius and his works.

977. Scholes, Percy. The Mirror of Music 1844–1944: A Century of Musical /LIHLQ%ULWDLQDV5HÀHFWHGLQWKH3DJHVRIWKH0XVLFDO7LPHV. 2 vols. London: Novello, 1947. Reprint, Freeport, N.Y.: Books for Libraries, 1970. ML 285.S35. Summarizes Delius’s coverage in the Musical Times7KH¿UVWPHQWLRQ occurred in July 1899, in a review of his self-produced concert.

978. Smith, Joseph Sutcliffe. A Musical Pilgrimage in Yorkshire. Leeds: R. Jackson, 1928, xix, 340 p. ML 286.S7. This attempt at a comprehensive resource on the musical life of Yorkshire falls short in Delius’s case. There are many inaccuracies, the most egregious being that Delius composed songs under the pseudonym “Peter Warlock.”

979. Smyth, Ethel. Beecham and Pharaoh. London: Chapman and Hall, 1935. 181 p. ML 410.S657. 7KH ¿UVW SDUW RI WKLV ERRN FRQWDLQV WKH UHFROOHFWLRQV RI WKH (QJOLVK composer and writer Dame Ethel Smyth regarding the conductor Sir Thomas Beecham and Delius. Includes reproductions of two letters from Delius to Smyth.

980. Sullivan, Jack. New World Symphonies: How American Culture Changed European Music. New Haven: Yale University Press, 1999. 262 p. ISBN 0300072317. ML 240.S85 N4 1999. 6XUYH\V $PHULFDQ LQÀXHQFHV RQ WKH PXVLF RI VHYHUDO FRPSRVHUV LQ 'HOLXV¶VFDVHWKH$IULFDQ$PHULFDQLQÀXHQFH,QFOXGHVUHIHUHQFHVEXW no bibliography.

981. Tertis, Lionel. Cinderella No More. London: P. Nevill, 1953. 118 p. ML 418.T4 A3. Includes an account of a visit to Delius at Grez in 1933 by the English violist Lionel Tertis. Tertis’s My Viola and I (Elek, 1974) also includes an account of the author’s visit to Grez. 186 Frederick Delius: A Research and Information Guide

982. Threlfall, Robert. Delius’ Musical Apprenticeship: Incorporating a Survey of the Leipzig Notebooks. London: Delius Trust, 1994. 161 p. ISBN 095026539X. ML 410.D35 T53. A study of Delius’s notebooks from his studies at the Leipzig Conservatory (1886–1888) based on the author’s examination of four notebooks (two originals at the Delius Trust Archives and photo reproductions of the notebooks held by Jacksonville University and the Grainger Museum). Includes forty-four facsimiles and musical examples, a list of “hitherto- unpublished music by Delius reproduced in this book” and index.

983. Threlfall, Robert, ed. A Musical Notebook. 2 vols. London: Delius Trust, 1993. ISBN 0950265381. M 3.D36 1993. Issued by the Delius Trust to mark the completion of the collected HGLWLRQ7KH¿UVWYROXPHFRQWDLQVDQLQWURGXFWLRQE\5REHUW7KUHOIDOO and a transcribed version of the notebook. The second volume is an annotated facsimile.

984. Tomlinson, Fred. Warlock and Delius. London: Thames Publishing, 1976. 31 p. ISBN 0905210050. ML 410.H585 T7. An enlarged version of a talk given to the Delius Society in 1976. Tomlinson has added notes and an alphabetical list of Delius works arranged, copied, or transcribed by Philip Heseltine. The narrative covers the nearly twenty-year acquaintance of the two composers, and is quick to point out some inaccuracies regarding the Delius–Heseltine relationship found in Cecil Gray’s biography of Heseltine (J. Cape, 1934). Includes facsimiles of letters and music by both Delius and Heseltine, and the full text of the Bruce Blunt poem “Delius.”

985. Upton, Stuart, and Malcolm Walker. Frederick Delius: A Discography. Edgeware, Middlesex, England: Delius Society, 1969. 42 p. ML 156. D44 U7. Also published in the Delius Society Newsletter no. 24 (1969). Supplements, Delius Society Newsletter no. 26 (1970): 15–18; no. 30 (1971): 15–17. This covers “all commercial gramophone records issued to the public over a period of over 50 years.” It is divided into four sections: LP records, 78s, an alphabetical index by title of composition, and an appendix. The ¿UVWSDUWRIWKHDSSHQGL[LVWLWOHG³'HOLXV¶VFRQWHPSRUDULHVRQUHFRUG´ D selective list of 78s that have a connection with Delius). Upton theorizes that some of these recordings would have been in Delius’s personal collection. The second part of the index, compiled by Malcolm Walker, includes a list of test and unissued recordings. Bibliography 187

986. Vaughan, David. Frederick Ashton and His Ballets. First American edition. New York: Knopf, 1977. xx, 522 p. Also published London: A. & C. Black, 1977. 2nd ed., London: Dance Books, 1999. ISBN 0394410858. GV 1785.A8 V38 1977. Brief discussions of Nocturne (1936) and A Walk to the Paradise Garden (1972), both set to music by Delius. Includes two photographs from A Walk to the Paradise Garden.

Chapters and Essays in Monographs

987. “Frederick Delius (1862–1934).” In The Book of Musical Anecdotes, edited by Norman Lebrecht, pp. 264–265. London: A. Deutsch, 1985. Also published New York: Free Press, 1985. ISBN 0233977309. ML 65.B673 1985. Includes two anecdotes from Delius’s life: an account of the practical trick played on writer August Strindberg during a séance, and the story of how the manuscript of Eventyr was smuggled out of France during the war. Includes a source list and an index.

988. “Frederick Delius.” In Great Composers in Historic Photographs: 244 Portraits from the 1860s to the 1960s, edited by James Camner, p. 29. New York: Dover, 1981. ISBN 0486241327. ML 87.G818. Includes one rather grainy photograph of Delius dating from the early .

989. “Frederick Delius.” In Portraits of the World’s Best-Known Musicians: An Alphabetical Collection of Notable Musical Personalities of the World Covering the Entire History of Music, edited by Guy McCoy, p. 251. Philadelphia: T. Presser, 1946. ML 87.E78. Delius is one of approximately 5,000 musicians represented in this collection of thumbnail-sized portraits originally published in The Etude, 1932–1940. The caption provides only very brief biographical information.

990. “Romeo and Juliet.” In Dictionary of Modern Ballet, edited by Francis Gadan and Robert Maillard, pp. 293–294. New York: Tudor, 1959. First published Dictionnaire du ballet moderne. Paris: F. Hazan, 1957. Also published London: Methuen, 1959. GV 1787.D513. Provides a critical description of the production and includes illustration of the Eugene Berman sketch of a set for Romeo and Juliet in 1943. 188 Frederick Delius: A Research and Information Guide

991. Abraham, Gerald. “Delius and the Ethos of Art Nouveau.” In Art Nouveau, Jugendstil und Musik, edited by Jürg Stenzel, pp. 187–192. Zurich: Atlantis, 1980. ISBN 3761106041. ML 55.S396 1980. Describes elements of Art Noveau found in Delius’s literary taste and music.

992. Adams, Byron. “‘No Armpits, Please, We’re British’: Whitman and English Music 1884–1936.” In Walt Whitman and Modern Music: War, Desire and the Trials of Nationhood, edited by Lawrence Kramer, pp. 25–42. New York: Garland, 2000. ISBN 0815331541. ML 80.W5 W35 2000. A discussion of settings of Whitman by English composers of the period, FKLHÀ\WKRVHRI5DOSK9DXJKDQ:LOOLDPVDQG)UHGHULFN'HOLXV

993. Arayashiki, Toru. “Frederick Delius and Grez-sur-Loing: Some Japanese Perspectives.” In Carley, Lionel, ed. Frederick Delius: Music, Art, and Literature (see no. 56), pp. 154–167. Describes the artistic atmosphere and importance of Grez-sur-Loing, which attracted artists from such places as Sweden and Japan. The character of Delius’s works shows an understanding and connection to this artistic environment.

994. Balanchine, George. “Romeo and Juliet.” In Complete Stories of the Great Ballets, pp. 318–322. Garden City, N.Y.: Doubleday, 1954. MT 95.B3. Includes a synopsis, cast list, and an excerpt from a review. In the author’s revised 1968 edition of this book (titled Balanchine’s New Complete Stories of the Great Ballets) the review excerpt is omitted.

995. Barjansky, Catherine. “A Late Lark Singing” and “Only One Happiness.” In Portraits with Backgrounds, pp. 93–113. New York: Macmillan, 1947. Also published London: G. Bles, 1948. NB 699.B3 A3. The author has created “portraits in words” of the people she has sculpted in wax. Two chapters are devoted to Delius. The author and her husband, the cellist Alexandre Barjansky, met the Deliuses when Alexandre gave the world premiere of Delius’s Violoncello Concerto. The author’s observations of Jelka Delius are particularly interesting.

996. Beaumont, Cyril. “Nocturne.” In Complete Book of Ballets: A Guide to the Principal Ballets of the Nineteenth and Twentieth Centuries, pp. 997–999. London: Putnam, 1949. GV 1787.B35 1949. Bibliography 189

Includes a synopsis and production details for the ballet based on music of Delius.

997. Beaumont, Cyril. “Antony Tudor: Romeo and Juliet.” In Ballets Past and Present: Being a Third Supplement to the “Complete Book of Ballets,” pp. 163–169. London: Putnam, 1955. MT 95.B43 1955. Includes an extended synopsis, details and assessment of the production, and one illustration from the ballet based on music of Delius.

998. Bergsagel, John. “J. P. Jacobsen and Music.” In J. P. Jacobsens spor i ord, billeder og toner: tolve afhandlinger, edited by F. J. Billeskov Jansen, pp. 285–313. Copenhagen: C. A. Reitzel, 1985. ISBN 8774214411. PT 8140.Z5 J5 1985. Includes a discussion of Delius’s literary sources and his interest in the works of the Danish novelist and poet Jens Peter Jacobsen.

999. Bergsagel, John. “Delius and Danish Literature.” In Carley, Lionel, ed. Frederick Delius: Music, Art, and Literature (see no. 56), pp. 290–310. Explores Delius’s relationship with Denmark and Danish literature. Includes a list of Delius’s compositions inspired by Danish literature.

1000. Bhimani, Nazlin. “Sorabji’s Music Criticism.” In Sorabji: A Critical Celebration, edited by Paul Rapoport, pp. 256–284. Aldershot: Scolar, 1992. ISBN 0859679233. ML 410.S6874 S67 1992. Discussion of the musical criticism of Delius’s works by the English FRPSRVHU .DLNKRVUX 6RUDEML GUDZQ FKLHÀ\ IURP KLV ZULWLQJV LQ The New Age and The New English Weekly. Includes excerpts of reviews.

1001. Brennan, Joseph Gerard. “Sarah Lawrence: Ireland, Joyce; France, Gide, Delius.” In The Education of a Prejudiced Man, pp. 220–224. New York: Charles Scribner’s Sons, 1997. ISBN 068414915X. B 945.B7444 A33. Brennan recalls visiting the former Delius house at Grez-sur-Loing (owned at the time by Madame Robert Merle d’Aubigné) and giving a paper at the 1972 Delius Festival in Jacksonville, Florida.

1002. Brian, Havergal. “Delius.” In Havergal Brian on Music: Selections from His Journalism, Vol. 1, edited by Malcolm MacDonald, pp. 99–145. London: Toccata Press, 1986. ISBN 0907689191. ML 60.B74 1986. Reprints of various articles written by Brian in the Musical Opinion, 1924–1936. 190 Frederick Delius: A Research and Information Guide

1003. Buettner, Stewart, and Reinhard G. Pauly. “Frederick Delius.” In Great Composers, Great Artists: Portraits, pp. 118–119. Portland: Amadeus Press, 1992. ISBN 0931340500. ML 87.B76 1992. Delius is represented in this collection by a reproduction of the 1922 Max Beckmann lithograph. The accompanying narrative includes biographical information on Delius and Beckmann with a paragraph on their acquaintance. The lithograph was originally prepared for a biography of Delius by Heinrich Simon that was never published.

1004. Caldwell, John. “Delius.” In The Oxford History of English Music, Vol. 2, pp. 330–331. Oxford: Clarendon Press, 1991. ISBN 0198161298. ML 286.C28 1991. Includes a discussion of the latter half of Delius’s life, from 1914 through 1934.

1005. Cardus, Neville. “Delius: His Methods and His Music.” In A Delius Companion, edited by Christopher Redwood (see no. 59), pp. 87–91. First published in the Manchester Guardian (14 October 1929). Attempts to explain Delius’s compositional style in layman’s terms.

1006. Carley, Lionel. “An English Composer at the Heart of Nordic Culture: Frederick Delius and His Friends.” In Nordic Letters 1870–1910, edited by Janet Garton and Michael Robinson, pp. 376–397. Norwich: Norvik Press, 1999. ISBN 1870041399. PT 7073.5.N67 1999. A survey of Delius’s many Scandinavian friendships as chronicled in his FRUUHVSRQGHQFH'HOLXVPDGH¿IWHHQWULSVWR6FDQGLQDYLDRYHUDSHULRG of forty-two years.

1007. Chazin-Bennahum, Judith. “Romeo and Juliet.” In International Dictionary of Ballet, Vol. 2, edited by Martha Bremser, pp. 1213–1214. Detroit: St James Press, 1993. ISBN 1558620842. GV 1585.I57 1993. Includes full production details, a bibliography, and a discussion of the ballet to the music of Delius.

1008. Chazin-Bennahum, Judith. “To America: The Journey That Lasts a Life- time.” In The Ballets of Antony Tudor: Studies in Psyche and Satire, pp. 120–129. New York: Oxford University Press, 1994. ISBN 0195071867. GV 1785.T83 C53 1994. Includes a discussion of the selection and production of the music for Romeo and Juliet. Bibliography 191

1009. Colles, H. C. “The Delius Festival.” In Essays and Lectures, pp. 107– 109. London: Oxford University Press, 1945. ISBN 0836919106. ML 60.C747. First published The Times, London (2 November 1929). A review of the 1929 Delius Festival.

1010. Crosland, Margaret. “Nocturne.” In Ballet Carnival: A Companion to the Ballet, pp. 280–281. London: Arco, 1955. MT 95.C74. This book covering the people, stories, vocabulary, and music of the ballet world includes a synopsis, credits list, a brief critique of Frederick Ashton’s Nocturne, and a list of recordings of both Nocturne and Romeo and Juliet.

1011. Cumberland, Gerald [Charles Kenyon]. “Some More Musicians.” In Set Down in Malice: A Book of Reminiscences, pp. 251–252. London: G. Richards, 1919. Also published New York: Brentano’s, 1919. PR 472.D4 1919. The author recalls meeting Delius in Liverpool.

1012. Demuth, Norman. “Frederick Delius.” In Musical Trends in the 20th Century, pp. 128–135. London: Rockliff, 1952. Reprint, New York: Greenwood, 1975. ML 197.D37 1952. Survey of Delius’s works along with a discussion of his compositional style. Includes musical examples and an index.

1013. Eccott, David. “Florent Schmitt.” In Carley, Lionel, ed. Frederick Delius: Music, Art, and Literature (see no. 56), pp. 113–153. Describes Delius’s forty-year friendship with French composer Florent Schmitt, whom he met in Paris in the 1890s. Delius commissioned Schmitt to make piano reductions of several of Delius’s operas.

1014. Foulds, John. “Vignettes Continued: Scriabin, Debussy, Delius, Macdowell, Sibelius.” In Music To-Day: Its Heritage from the Past and Legacy to the Future, pp. 293–326. London: I. Nicholson and Watson, 1934. ML 197.F79 M8. A discussion of Delius’s compositional style is found on pp. 306–312.

1015. Gillies, Malcolm, and David Pear. “Frederick Delius (1862–1934).” In Portrait of Percy Grainger, pp. 51–53. Rochester, N.Y.: University of Rochester Press, 2002. ISBN 1580460879. ML 410.G75 G55 2002. 192 Frederick Delius: A Research and Information Guide

This study of Grainger through the eyes of friends, colleagues, and students includes two excerpts from letters written by Delius, each containing remarks about Grainger.

1016. Gilliand, Norman. “January 28th: Orange Plantation Composer.” In Grace Notes for a Year: Stories of Hope, Humor and Hubris from the World of Classical Music, 28. Madison, Wis.: NEMO Productions, 2003. vii, 397 p. ISBN 0971509301. ML 65.G55 2002. From a series of daily radio stories, this episode about Delius concerns his time in Jacksonville.

1017. Gillespie, Don, and Robert Beckhard. “On Hearing the First Delius in America: Critical Reaction to Frederick Delius’s Music in the United States, 1909–1920.” In Carley, Lionel, ed. Frederick Delius: Music, Art, and Literature (see no. 56), pp. 57–98. A study of critical and popular reaction to Delius’s major works performed in the United States, 1909–1929.

1018. Gray, Michael. “Delius, Frederick.” In Classical Music Discographies, 1976–1988: A Bibliography, p. 68. New York: Greenwood, 1989. ISBN 0313259429. ML 128.D56 G7 1989. Lists several sources that contain discographies for Delius.

1019. Harmon, Gary L. “Fernandina Beach to Picolata and Olustee.” In The Book Lover’s Guide to Florida: Authors, Books and Literary Sites, edited by Kevin McCarthy, pp. 29–30. Sarasota: Pineapple Press, 1992. ISBN 9781561640126. PS 266.F6 B66 1992. Notes the restored Delius house located on the grounds of Jacksonville University and the annual Delius Festival. Gives brief background information on Delius and Florida; includes picture of Delius and his traveling companion, Charles Douglas, taken before leaving England LQ)HEUXDU\'HVFULEHV'HOLXVDVDUHSUHVHQWDWLYHRIWKH³UH¿QHG heritage of early English settlers” in Florida. Includes a paragraph of bibliographical references.

1020. Harrison, Beatrice. “Delius and Elgar.” In The Cello and the Nightingales: The Autobiography of Beatrice Harrison, edited by Patricia Cleveland- Peck, pp. 113–125. London: J. Murray, 1985. ISBN 0719542081. ML 418.H33 A3 1985. Cellist Beatrice Harrison recalls her friendships with Delius and English composer Edward Elgar. Includes a photograph of Miss Harrison and Delius in the Harrison’s garden at The Waffrons. Bibliography 193

1021. Holmes, John L. “Frederick Delius (1862–1934).” In Composers on Composers, pp. 56–57. New York: Greenwood Press, 1990. ISBN 0313266026. ML 90.H64 1990. Includes quotes about Delius from the composers , Arnold Bax, Constant Lambert, Percy Grainger, the teacher , and the jazz musician and composer . Delius himself is quoted in several entries.

1022. Howard, Camille Cole. “Antony Tudor’s Romeo and Juliet.” In The Staging of Shakespeare’s Romeo and Juliet as a Ballet, pp. 78–90. San Francisco: Mellen Research University Press, 1992. ISBN 0773498567. GV 1790.R65 H68 1992. Includes a discussion of the music for the ballet Romeo and Juliet, set to works of Delius arranged by Antal Dorati.

1023. Karolyi, Otto. “Romanticism and Postromanticism: Edward Elgar, Frederick Delius, Arnold Bax, John Ireland.” In Modern British Music: The Second British Musical Renaissance from Elgar to P. Maxwell Davies, pp. 13–22. Rutherford, N.J.: Fairleigh Dickinson University Press, 1994. 151 p. ISBN 0838635326. ML 285.5.K33 1994. Delius is given a brief biographical sketch along with a discussion of his compositional style on pp. 18–20. There are other scattered references to Delius throughout the book.

1024. Knight, Janice. “My Life with the Bass Oboe.” Double Reed 22, no. 4 (1999): 55–56. First published Double Reed News Magazine. Discusses the use of the bass oboe in various English composers’ works and the author’s experiences in performing these works. Delius used the instrument in A Mass of Life, Dance Rhapsody no. 1, Fennimore and Gerda, and the Requiem (described by the author as “very dull”). She notes that Percy Grainger also used the bass oboe in his The Warriors, which was dedicated to Delius.

1025. Krokover, Rosalyn. “Romeo and Juliet.” In The New Borzoi Book of Ballets, pp. 218–222. New York: Knopf, 1956. MT 95.K76. Includes a description, cast list, and synopsis of the ballet based on the music of Delius.

1026. Kruse, Paul. “Florida in the Life and Works of Frederick Delius.” In Jacksonville Historical Society Papers, pp. 77–92. Jacksonville, Fla.: Jacksonville Historical Society, 1947. F 319.J1 J3 1947 v.1. 194 Frederick Delius: A Research and Information Guide

Text of a paper read before the Jacksonville Historical Society, 28 January 1942. The author explores Delius’s reasons for leaving England, WKHFKRLFHRI)ORULGDDVDGHVWLQDWLRQDQGWKHVLJQL¿FDQFHRI)ORULGDLQ Delius’s music despite the relatively short time he spent in the state.

1027. Lawrence, Robert. “Romeo and Juliet (Tudor).” In The Victor Book of Ballets and Ballet Music, pp. 361–368. New York: Simon and Schuster, 1950. MT 95.L48. An extensive discussion of the ballet; also includes cast information and a synopsis. There are musical examples and six photographs from the production.

1028. Lloyd, Stephen. “Delius as a Conductor.” In Carley, Lionel, ed. Frederick Delius: Music, Art, and Literature (see no. 56), pp. 15–35. A discussion of Delius’s attempts at conducting. Includes quotations from reviews.

1029. Lloyd, Stephen. “Delius, Beecham and Hardy.” In H. Balfour Gardiner, pp. 53–67. Cambridge: Cambridge University Press, 1984. xv, 272 p. ISBN 0521256097. ML 410.G1683 L6 1984. 7KLV FKDSWHU UHFRXQWV WKH ¿UVW PHHWLQJ EHWZHHQ 'HOLXV DQG %DOIRXU Gardiner. Balfour Gardiner was a frequent visitor to Grez, so there is additional discussion of Delius throughout the book. Includes a photo of Delius, possibly taken during the war years, and a photo of Frederick and Jelka in Norway.

1030. Machlis, Joseph. “Other Impressionists: Frederick Delius (1862–1934).” In Introduction to Contemporary Music, 2nd ed., pp. 115–118. New York: Norton, 1979. Also published London: Dent, 1980. ML 197.M11 15. Includes remarks on his compositional style and works.

1031. Mackenzie, Compton. “The Delius Festival.” In A Musical Chair, pp. 211–213. London: Chatto and Windus, 1939. ML 60.M142 M9. First published Gramophone (November 1929): 230. Terms the 1929 Delius Festival “a worthy tribute to a great composer,” but argues that the title of “greatest English composer” really belongs to Edward Elgar.

1032. Mackenzie, Compton. “Holst and Delius.” In A Musical Chair, pp. 208–211. London: Chatto and Windus, 1939. ML 60.M142 M9. First published Gramophone (July 1934): 41–42. Bibliography 195

Perhaps intended to mark the deaths of both Delius and English composer , critic Compton Mackenzie makes no bones about his dislike of Delius’s music. He hopes that the soon-to-be-issued Delius Society recordings will change his opinion.

1033. Markova, Alicia. “Ballet Theatre, 1942: Sir Thomas Beecham and Romeo and Juliet.” In Markova Remembers, pp. 108–115. London: H. Hamilton, 1986. Also published: Boston: Little, Brown, 1986. ISBN 0241119537. GV 1785.M3 A3 1986. Dame Alicia Markova, the original Juliet, gives her recollections of the production. There are eight photographs of the production.

1034. Mellers, Wilfrid. “Delius, Sibelius and Nature.” In Man and His Music: The Story of Musical Experience in the West, edited by Alec Harman, pp. 923–934. London: Barrie and Rockliff, 1962. 1172 p. Also published: New York: Oxford University Press, 1962. ML 160.H284. An overview of the lives and works of Delius and the Finnish composer -HDQ 6LEHOLXV ERWK LQÀXHQFHG E\ QDWXUH ,QFOXGHV D FRPSDUDWLYH chronology, a discography, a bibliography, and indexes.

1035. Moore, Gerald. “Sammons and Beecham: Nightingales and Crocodiles.” In Am I Too Loud? A Musical Autobiography, pp. 56–64. New York: Macmillan, 1962. ISBN 0241900190. ML.41.M85 A3. Contains recollections of visiting Delius at Grez with the Harrison family by the English pianist Gerald Moore.

1036. Nettel, Reginald. “Contemporaries.” In Ordeal by Music: The Strange Experience of Havergal Brian, pp. 58–68. London: Oxford University Press, 1945. ML 410.B753 N4. Describes the efforts of Delius and Havergal Brian in the short-lived Musical League.

1037. Nettel, Reginald. “Delius.” In Music in the Five Towns, 1840–1914: $6WXG\RIWKH6RFLDO,QÀXHQFHRI0XVLFLQDQ,QGXVWULDO'LVWULFW, pp. 98–106. London: Oxford University Press, 1944. ML 286.N48. Discusses performances of Delius’s works by various northern English musical organizations. Includes excerpts from critical reaction to these performances.

1038. Newman, Ernest. “Delius: The End of a Chapter in Music.” In From the World of Music, edited by Felix Aprahamian, pp. 114–117. London: J. 196 Frederick Delius: A Research and Information Guide

Calder, 1956. Reprint, New York: Coward-McCann, 1957; New York: Da Capo, 1978. ML 60.N49. First published the Sunday Times (London) (17 June 1934). Reprint, Redwood, Christopher. A Delius Companion (see no. 59), pp. 97–100. Tribute.

1039. Newman, Ernest. “A Note on Delius.” In From the World of Music, edited by Felix Aprahamian, pp. 105–108. London: J. Calder, 1956. Reprint: New York: Coward-McCann, 1957; New York: Da Capo, 1978. ML 60.N49. First published in the Sunday Times (London) (10 November 1929). An appreciation of Delius’s music.

1040. Nichols, Robert. “Delius as I Knew Him.” In Selections from the BBC Programme “Music Magazine,” pp. 5–9. London: Rockliff, 1953. ML 55.M67. 7KHDXWKRUUHFDOOVDERDWULGHZLWK'HOLXVDW*UH]DQGEULHÀ\GLVFXVVHV LQÀXHQFHVRIQDWXUHDQG1LHW]VFKHRQ'HOLXV

1041. O’Shea, John. “Frederick Delius (1862–1934) and Scott Joplin (1868–1917).” In 0XVLF DQG 0HGLFLQH 0HGLFDO 3UR¿OHV RI WKH *UHDW Composers, pp. 187–200. London: Dent, 1990. Also published as Was Mozart Poisoned? Medical Investigations into the Lives of the Great Composers. New York: St. Martin’s Press, 1990. ISBN 0460047841. ML 390.O84 1990. Opens with a general discussion of syphilis (from which both composers suffered) and moves on to individual biographical sketches. Includes a chronology of Delius’s illness from 1895 to 1934.

1042. Oyler, Philip. “Some Memories of Delius.” In Sons of the Generous Earth, pp. 41–54. London: Hodder and Stoughton, 1963. S 521.O88 1963. Excerpts reprinted in Delius Society Newsletter (December 1963): 2. Oyler, manager of an estate located near the Deliuses, provides a detailed description of the house and garden at Grez as well as recollections of his visits with the Deliuses. Includes several photographs of Grez and the surrounding area.

1043. Page, Frederick. “Christchurch: In Praise of Delius.” In Thomson, J. M. and Janet Paul, eds. Frederick Page: A Musician’s Journal 1905–1983, pp. 33–60. Dunedin, New Zealand: J. McIndoe, 1986. ISBN 086868080X. ML422.F74 F7 1986. Bibliography 197

Page’s journal reveals his interest in Delius’s music, sparked by his reading of Cecil Gray’s Survey of Contemporary Music and Philip Heseltine’s biography of Delius.

1044. Price, Bernard. “The North: Frederick Delius.” In Creative Landscapes of the British Isles: Writers, Painters and Composers and their Inspiration, pp. 31–33. London: Ebury Press, 1983. ISBN 0852232756 PR 110.G7 P75 1983. Notes the importance of landscapes, particularly the Yorkshire moors of his childhood, in the music of Delius. Includes a reproduction of the Ernest Procter portrait and a photograph of “The Cow and Calf Rock, Ilkley.”

1045. Reid, Charles. “Enter Delius.” In Thomas Beecham: An Independent Biography, pp. 53–61. London: V. Gollancz, 1961. Also published, New York: Dutton, 1962. ML 422.B33 R4. Discussion of Beecham’s discovery of Delius’s music and his friendship with Delius. Later in the book, there is a brief description of the writing of Beecham’s book on Delius.

1046. Ringger, Rolf Urs. “Das ‘Naturhafte’ bei Frederick Delius.” In Von Debussy bis Henze: zur Musik unseres Jahrhunderts, pp. 157–165. Munich: Piper, 1986. ISBN 349200802X. ML 197.R56 1986. First published in Neue Zürcher Zeitung (1975). $GGUHVVHVWKHLQÀXHQFHRIQDWXUHLQ'HOLXV¶VPXVLF

1047. Rittmann, Annegret. “‘Our Prophetic Little Lady Friend’: The Artist Ida Gerhardi.” In Frederick Delius: Music, Art, and Literature, edited by Lionel Carley (see no. 56), pp. 168–183. The artist Ida Gerhardi was an early friend of Jelka Rosen Delius. After meeting Frederick in 1896, the three spent time at the house at Grez. Gerhardi was an enthusiastic promoter of Delius’s music, introducing his music to the German conductors Hans Haym and . A rift in the friendship later healed and the friendship resumed until Gerhardi’s death in 1927.

1048. Robert, Grace. “Romeo and Juliet.” In The Borzoi Book of Ballets, pp. 218–222. New York: Knopf, 1952. GV 1787.R6. Includes a synopsis, cast list, and extensive discussion of the production of the ballet based on the music of Delius. 198 Frederick Delius: A Research and Information Guide

1049. Rossi, Jérôme. “Etude comparée des structures mélodiques et harmoniques chez Grieg et Delius.” In Structure et forme: Du créateur au médiateur, edited by Philippe Reynal, pp. 31–42. Paris: Observatoire musical français, 2006. ISBN 2845911254. ML 3797.R467 2004. Delius uses the melody “I Ola-dalom, i Ola-kjønn,” also used by Edvard Grieg (10 norsek folkeviser, op. 66, no. 14), in the middle part of On Hearing the First Cuckoo in Spring. Both use the theme and variations structure, and one can see the melodic and harmonic sources of form in Delius’s work. In French.

1050. Rossi, Jérôme. “Fonctions de la polytonalité dans la musique instrumentale de Frederick Delius.” In Polytonalité/polymodalité: Histoire et actualité, edited by Michel Fischer and Danièle Pistone, pp. 27–36. Paris: Observatoire musical français, 2005. ISBN 2845911173. ML 381.P65 2005. Delius used polytonal compositional techniques in his Florida Suite for WKHUHVXOWDQWVRXQGVUDWKHUWKDQWKHVSHFL¿FDSSOLFDWLRQRIDSRO\WRQDO system. In French.

1051. Rugstad, Gunnar. “Christian Sinding–Frederick Delius: A Friendly Counterpoint.” In Frederick Delius: Music, Art, and Literature, edited by Lionel Carley (see no. 56), pp. 99–112. Describes the relationship between Delius and Norwegian composer Christian Sinding, whom he met in his student days in Leipzig. The correspondence from Sinding to Delius has been preserved by the Delius Trust and sheds much light on the two composers’ relationship.

1052. Salomon, John S. and Margaret T. Peters. “Frederick Delius (1862– 1934).” In A Guidebook to Virginia’s Historical Markers. Rev. and expanded ed., p. 135. Charlottesville: University of Virginia Press, 1994. F 227.A76 1994. &RPSLODWLRQ RI WKH WH[WV RI PRUH WKDQ  RI¿FLDO VWDWH KLVWRULFDO markers placed along Virginia highways since 1926. Markers in Danville include one at the site of the Henry P. Richardson house where Delius lived from 1885–1886 while teaching at Roanoke Female College.

1053. Simeone, Nigel. “Frederick Delius (29 January 1862–10 June 1934).” In Paris: A Musical Gazetteer, pp. 58–60. New Haven, Conn.: Yale University Press, 2000. ISBN 0300080530. ML 21.F7 S56 2000. Bibliography 199

A chronological list and brief explanation of Delius’s Paris haunts and activities.

1054. Stoneman, Mark. “Delius in Florida: The Delius Festival of Jacksonville.” In Frederick Delius: Music, Art, and Literature, edited by Lionel Carley (see no. 56), pp. 36–56. ([DPLQHV WKH LQÀXHQFH RI 'HOLXV RQ WKH PXVLFDO OLIH RI -DFNVRQYLOOH Florida. Includes a discussion of local musical organizations, efforts to preserve Delian artifacts and collections, and the annual Delius Festival.

1055. Stradling, Robert. “On Shearing the Black Sheep in Spring: The Repatriation of Frederick Delius.” In Music and the Politics of Culture, edited by Christopher Norris, pp. 69–105. New York: St. Martin’s Press, 1989. Also published, London: Lawrence and Wishart, 1989. ISBN 0312035128. ML 3800.M88 1989. A deconstructive view of how Delius allowed himself and his music to be considered English despite his professed dislike of England, the FRVPRSROLWDQLQÀXHQFHVRQKLVPXVLFDQGWKHFRPSRVHU¶VUHVLGHQFHLQ France.

1056. Trend, Michael. “The English Environment: Elgar, Delius.” In The Music Makers: Heirs and Rebels of the English Musical Renaissance from Edward Elgar to Benjamin Britten, pp. 19–46. London: Weidenfeld and Nicolson, 1985. xvii, 268 p. First American edition, New York: Schirmer Books, 1985. ISBN 029778403X. ML 286.5.T7 1985. An extensive discussion of the lives and music of the composers Edward Elgar and Delius.

1057. Weiske, Agnes. “From Ignaz Moscheles to Jelka Delius: A Background to the Rosen Family.” In Carley, Lionel, ed. Frederick Delius: Music, Art, and Literature (see no. 56), pp. 184–210. Explores the background and family of Jelka Rosen Delius. Her mother, Serena Rosen, was the daughter of piano virtuoso and composer Ignaz Moscheles.

1058. Wilson, Colin. “Delius.” In Chords and Discords, pp. 125–132. New York: Crown, 1966. MT 6.W555 C5. The English writer Colin Wilson (b. 1931) compares Delius with the English writer Ernest Dowson, and goes on to discuss Delius’s relationships with Sir Thomas Beecham and Philip Heseltine. 200 Frederick Delius: A Research and Information Guide

1059. Young, Percy. “Delius and a Disciple.” In Pageant of England’s Music, pp. 129–140. Cambridge: W. Heffer and Sons, 1939. ML 286.Y58 P2. Surveys the life and works of Delius and Philip Heseltine. Includes musical examples, a reproduction of the James Gunn portrait, and an index.

1060. Young, Percy. “Frederick Delius.” In A History of British Music, pp. 534–538. London: Benn, 1967. xi, 647 p. Also published New York: Norton, 1967. ML 285.Y68. A survey of Delius’s works with musical examples.

Articles

1061. “The 44th Annual Delius Festival in Jacksonville, Florida.” http:// thompsonian.info/jaxville.html (accessed 15 October 2008). Includes photos from the Festival, an article from the Florida Times- Union, and a memoir by Terry Sanderson.

 ³%HHFKDP 'HOLXV DQG 'H¿FLW´ Newsweek 28, no. 20 (11 November 1946): 96. Review of the second Delius Festival organized by Sir Thomas Beecham. The title refers to the fact that, despite initial enthusiasm for the festival, FRQFHUWVKDG\HWWRVHOORXWUHVXOWLQJLQDOLNHO\GH¿FLW

1063. “Celebrating the Music of Delius.” Southern Living 14 (February 1979): 28. Announces the 1979 Delius Festival to be held at Jacksonville University. %ULHÀ\ UHFRXQWV 'HOLXV¶V DVVRFLDWLRQ ZLWK )ORULGD DQG LQFOXGHV WKUHH photographs of the Solano Grove cottage on the grounds of the university.

1064. “Composers and Compositions.” Museum News (Toledo Museum of Art) no. 156 (October 1954): 2. Announcement of an exhibition titled “Composer Portraits and Autograph Scores” to be held 3 October–7 November 1954. The exhibition was to include the Edward Munch lithograph of Delius, owned by the museum.

1065. “Dances from Romeo and Juliet (A. Tudor).” Dance in Video, Alexander Street Press. http://www.alexanderstreet.com (by subscription, accessed 20 October 2008). Bibliography 201

Provides video from a 1957 CBS broadcast of dances from the Antony Tudor ballet.

1066. “Delius Again.” Saturday Review 148, no. 3865 (23 November 1929): 610. Review of the Delius Festival organized by Sir Thomas Beecham, “a great triumph for the composer and conductor.”

1067. “The Delius Centenary.” Tempo, no. 60 (1961–1962): 1, 23–25. Suggests that the appeal of Delius’s music is to the young, and that this observation might warrant future study. Related illustrations reproduce SKRWRJUDSKVRI'HOLXV3HUF\*UDLQJHU%UDGIRUG/LPSV¿HOGDQG*UH] sur-Loing.

1068. “Delius Comes Home!” BBC Bradford and West Yorkshire. http://www. s230964027.websitehome.co.uk/articles.samples/delius-comes-home. pdf (accessed 20 October 2008). Biographical sketch and discussion of festival events in preparation for the Delius Inspired Festival, to be held 1–8 July 2006 in Bradford, England.

1069. “Delius Festival.” Music Teacher 60 (November 1981): 25. A preview of the 1982 Delius Festival to be held at Keele University. Includes a brief survey of previous Delius Festivals (1929, 1946, 1962).

1070. “Delius, Frederick (1862–1934).” The Pantheist Index. http://www. pantheist-index.net/Art_Poetry_Music/Music/Delius_Frederick/ (accessed 15 October 2008). The Pantheist Index lists resources relating to Pantheism available via the Web. It is unclear how the sites are chosen or updated. The page for Delius contains a list of links to sites of various quality and availability (several links pointed to pages no longer available).

1071. “Delius House Continues to Inspire.” Compass (winter 1991): 5. Gives the history of Delius’s cottage at Solano Grove and how it came to be moved to Jacksonville University. Also describes the Florida artist Maggie Campbell’s watercolor painting of the cottage and Jacksonville University’s role in the Delius Association of Florida.

1072. Delius Inspired Festival. BBC Radio 3. http://www.bbc.co.uk/radio3/ classical/britishcomposers/delius.shtml (accessed 15 October 2008). 202 Frederick Delius: A Research and Information Guide

Announces the Delius Inspired festival concert lineup; concerts were also broadcast on BBC Radio 3.

1073. “The ‘Delius Inspired’ Festival, Bradford, July 2006.” http://thompsonian. info/delius-bradford-2006.html Includes list of concerts, links to the website of Tasmin Little, the festival’s director, and a collection of photos from the festival.

1074. “A Delius Memorial.” Tempo, no. 4 (July 1989): 9. Announces an appeal for funds toward building “The Delius Music Room” in the Bradford Grammar School as a memorial to Delius. It was hoped that this project would include a museum.

1075. “A Delius Society.” British Musician and Musical News (April 1933): 75. Announcement of the formation of the Delius Society with Sir Thomas Beecham as president. The primary purpose of the organization is to produce gramophone records of Delius’s works.

1076. “Delius: The Nostalgic Fallacy.” British Musician and Musical News (October 1936): 222–223. Notes that the words nostalgia and nostalgic were often used in newspaper articles about the Delius Festival (1929). The anonymous author feels that the word(s) has been misapplied by journalists in reference to Delius’s music.

1077. “Final Curtain on Bradford’s Delius Festival.” Wool Record (13 April 1962): 9. Reprint, Delius Society Journal no. 135 (2004): 84. Brief editorial comments on the centenary Delius Festival and notes Delius’s connection to the wool industry.

1078. “Florida Honors Delius as Her Own.” The Musician 44 (May 1939): 88. Announcement of a memorial fund set up by Mrs. Henry Richmond as a tribute to Delius. The fund is to be devoted to the advancement of music education and will be administered by Duval County Board of Public Instruction and the Jacksonville Public Library.

1079. “Frederick Delius.” Musical Herald (November 1919): 359–361. 'LVFXVVLRQ RI KLV FRVPRSROLWDQ WDVWHV LQÀXHQFHV DQG FRPSRVLWLRQDO style. Bibliography 203

1080. “Frederick Delius.” Musical Times 56, no. 865 (1 March 1915): 137. $EULHIELRJUDSKLFDOSUR¿OHWKDWSUHFHGHVWKHVXUYH\RI'HOLXV¶VZRUNV written by Philip Heseltine.

1081. “Frederick Delius, C. H.” Milo 1 (October 1929): 28. A preview of the 1929 Delius Festival.

1082. “Gramophone Records of the Music of Delius,” parts 1 and 2. Midland Musician (March 1926): 94; (April 1926): 130–131. Discography.

1083. Homage to Delius, 1993. %UDGIRUG 6FXOSWXUH 7UDLO KWWSZZZQJÀ ac.uk/sculptrail/sculp27.html (accessed 27 August 2008). Point no. 27 on the Bradford Sculpture Trail offers Amber Hiscott’s Homage to Delius. Includes color picture of the sculpture.

1084. “In a Summer Garden.” About the House 4, no. 2 (1973): 28–29. A photo essay of the Ronald Hynd ballet set to music by Delius.

1085. “Little’s Delius Search.” Strad 108 (July 1997): 704. Brief report of violinist Tasmin Little’s search for evidence of Delius’s relationship with a local woman and possible child born in Florida. /LWWOHLVDOVRLQYROYHGZLWKWKH¿OPThe Lost Child (see no. 1814), to be broadcast on BBC2.

1086. The Lost Child (1997). BFI Film & TV DatabaseKWWSIWYGEE¿RUJXN sift/title/574229 (accessed 22 October 2008). 6\QRSVLVFDVWDQGFUHGLWVIRUWKHGRFXPHQWDU\¿OPWKDWDLUHGRQ-XQH 1997 (BBC2).

1087. “Manuscripts by Elgar, Delius, Holst.” Tempo no. 7 (June 1944): 13–16, 25. Contains reproductions of manuscript pages of various works (Cockaigne by Edward Elgar, Delius’s String Quartet, and Lyric Movement by Gustav Holst) in commemoration of the tenth anniversary of the passing of the three composers. A short explanation follows on p. 25.

1088. “Midnight Burial of Delius: Interview with Sir Thomas Beecham.” Le Grand Baton 15 (December 1978): 13–14. First published in the Observer (24 May 1935). 204 Frederick Delius: A Research and Information Guide

5HSRUWRIWKHUHLQWHUPHQWRI'HOLXV¶VERG\DWWKHFHPHWHU\DW/LPSV¿HOG

1089. “Mr. Fritz Delius.” Musical Times 40 (July 1899): 472. Review of Delius’s self-produced London concert.

1090. “Nocturne.” Collections Online. http://www. rohcollections.org.uk/work.aspx?searchtype=workprodperf&page=0&p erson=delius&row=0&work=505 (accessed 20 October 2008). Includes work, production, and performance (18 March 1946) information for the Frederick Ashton ballet.

1091. “Odd Man Out.” Music and Musicians 10 (March 1962): 33. Notes that Delius was not actually born in the Bradford house slated for conversion to a gas station and garage. His family had temporarily moved into the house next door while the house in question was being renovated.

1092. Omnibus: Song of Summer (1968). Internet Movie Database. http:// www.imdb.com/title/tt0063628/ (accessed 20 October 2008). The entry for Song of Summer includes a cast list, other credits and plot summary.

1093. “Remembering Delius.” Music and Musicians 9 (March 1961): 23. An announcement of the Delius Centenary Festival.

1094. “St. Helier: Coast to Coast.” BBC Jersey. http://www.bbc.co.uk/jersey/ content/articles/2005/06/15/coast05walks_start.shtml (accessed 20 October 2008). Itinerary for a walk around St. Helier. Point 3 in the walk features Havre des Pas, a Victorian seaside resort that hosted famous visitors including Delius.

1095. “Two Promising Young Men, Elgar and Delius.” Music Teacher 29 (December 1950): 583. First published in The Gazette (1899). 5HSULQWVUHSRUWVRI'HOLXV¶V¿UVW/RQGRQFRQFHUWDQGWKH¿UVWSHUIRUPDQFH of Elgar’s Variations on an Original Theme (Enigma Variations). The two composers are compared and are deemed “worth future hearings.”

1096. “The Walk to the Paradise Garden.” About the House 4, no. 2 (1973): 26–27. Bibliography 205

A photo essay of the Frederick Ashton ballet based on the music of Delius.

1097. “The Walk to the Paradise Garden.” Royal Opera House Collections Online. http://www.rohcollections.org.uk/work.aspx?work=131&row =1&searchtype=workprodperf&person=delius (accessed 20 October 2008). Includes work, production, and performance (15 November 1972) information for the Frederick Ashton ballet.

1098. Abraham, Gerald. “Delius and His Literary Sources.” Music and Letters 10 (April 1929): 182–188. Reprint, Slavonic and : Essays and Studies, pp. 332–338. London: Faber and Faber, 1968. Reprint, New York: St. Martin’s, 1968. ML 300.A16 S6. 6FDQGLQDYLD $PHULFD DQG 1LHW]VFKH ZHUH WKH FKLHI LQÀXHQFHV RQ Delius’s choice of literary sources.

1099. Abraham, Gerald. “‘Tommy’ in England.” Saturday Review 33 (28 October 1950): 66–67. A survey of the life and works of conductor Sir Thomas Beecham (1879– 1961), and a discussion of his efforts to promote the music of Delius. Includes a discography.

1100. Ahad, Nick. “An Abiding Musical Passion.” Yorkshire Post (27 May 2006). Available online, http://www.s230964027.websitehome.co.uk/ pages/02_pages/02_set_download.htm (accessed 26 March 2009). An interview with Tasmin Little regarding her interest in Delius and the upcoming Delius Inspired festival to be held in Bradford, England.

1101. Anderson, Robert. “Delius.” Musical Times 136, no. 1832 (October 1995): 555–556. Review of six recent Delius compact discs: The Delius Collection, volumes 1–4 (Unicorn-Kanchana UKCD 2071–2074, see no. D91–D97), the Violin Sonatas and Cello Sonata (EMI 7243 5 55399 2 2, see D240), and Complete Works for Violin and Piano (Meridian CDE 84298/9-2, see D79).

1102. Anderson, Robert. “Uncollected Essays.” Musical Times 135, no. 1815 (May 1994): 282–83. Feature review of several Delius scores, including volume 21C of the Collected Edition (“Early Orchestral Works III”), a piano reduction of 206 Frederick Delius: A Research and Information Guide

Sakuntala, a two-piano arrangement of Poem of Life and Love, and a vocal score of Sea Drift. Rolf Christian Stang offers some corrections in a letter to the editor in the September issue of Musical Times.

1103. Antcliffe, Herbert. “The System of Frederick Delius.” Musical News and Herald (28 January 1922): 121–122. A discussion of Delius’s compositional method and style. Nature is noted DVDQLPSRUWDQWLQÀXHQFHRQKLVVW\OH

1104. Aprahamian, Felix. “A Visit to Delius.” Royal College of Music Magazine 81, no. 1 (1985): 27–28. Recounts the author’s August 1933 visit to Delius at his home in Grez- sur-Loing.

1105. Arnold, Cecily. “A Singer’s Memories of Delius.” Music Teacher 29 (April 1950): 165. Reprint, Redwood, Christopher. A Delius Companion (see no. 59), pp. 107–112. Arnold recalls her visit with Delius in Grez-sur-Loing. Includes a short discussion of Delius’s songs.

1106. Backhouse, J. M. “Delius Letters.” The British Museum Quarterly 30, no. 1–2 (1965): 30–35. Describes the correspondence between Philip Heseltine and Delius recently acquired by the British Museum. The collection contains approximately 200 letters and postcards.

 %DQ¿HOG 6WHSKHQ ³)UHQFK ,PSUHVVLRQV LQ D 6XPPHU *DUGHQ´ BBC Music Magazine (June 1994): 27–28. %DQ¿HOGTXHVWLRQVZKHWKHU'HOLXVFDQEHFDOOHGDQ(QJOLVKRUD)UHQFK composer, noting that Delius is misunderstood even today. Includes four SKRWRJUDSKVRIWKH'HOLXVHVDQGWKUHHVWLOOVIURPWKH.HQ5XVVHOO¿OPA Song of Summer (see no. 1820). Delius was featured as “Composer of the Week” 6–10 June 1994.

 %DQ¿HOG6WHSKHQ³La ronde se déroule: Delius and the Round Dance.” British Music 6 (1984): 26–37. Explores Delius’s use of the waltz and dance elements in his music, and IROORZVWKHVKLIWLQLWVXVHDQGVLJQL¿FDQFHWKURXJKRXWKLVFDUHHU7KH following works are examined: Idyll (derived from Margot la Rouge), Paris: Nocturne (The Song of a Great City), La ronde se déroule (later Bibliography 207

revised as Lebenstanz), Appalachia, and A Mass of Life. Includes eight handwritten musical examples. Originally given as a lecture at the Delius Festival, University of Keele, March 1982; the shortened version that appears here was also given at the 19th Century Music Conference, Southampton University, July 1982.

1109. Barzel, Ann. “Southern Exposure: Sarasota Adopts Eddy Toussaint.” Dance Magazine 67 (August 1993): 26–31. Includes a brief description of the ballet Florida Suite, and some background information on Delius (although the dates of his Florida residence are incorrect). The ballet was presented by the Sarasota Ballet of Florida during their 1990–1991 season. There is one photograph from the production.

1110. Beecham, Thomas. “Beecham on Delius.” Music Magazine/Musical Courier 164, no. 1 (January 1962): 17. An extract from Beecham’s book Frederick Delius, in which Beecham GHVFULEHVKLV¿UVWPHHWLQJZLWK'HOLXV

1111. Beecham, Thomas. “Early Days with Delius.” Saturday Review 43 (25 June 1960): 41–43. 7KH FRQGXFWRU 6LU 7KRPDV %HHFKDP GHVFULEHV KLV ¿UVW PHHWLQJ ZLWK Delius and a subsequent trip to Norway with the composer. Among the three illustrations is a photograph of Beecham delivering the oration at 'HOLXV¶VUHLQWHUPHQWLQWKHFHPHWHU\DW/LPSV¿HOG(QJODQG

1112. Beecham, Thomas. “Frederick Delius.” Tempo, no. 26 (1952–1953): 6–7. A brief excerpt from Beecham’s autobiography, A Mingled Chime (see no. 951).

1113. Bertonneau, Thomas F. “The High Hills: Frederick Delius and the Secular Sublime.” The Praesidium: A Journal of Literate and Literary Analysis. http://www.literatevalues.org/literatevalues-arch.htm (accessed 22 October 2008). Contemplates the paradox that a great artist is not necessarily a great man.

1114. Bevil, J. Marshall. “Notes on Frederick Delius, ‘La Calinda’ from Koanga, ‘A Late Lark,’ and ‘Morning’ and ‘Night’ from Florida Suite.” http://home.earthlink.net/~llywarch/del01.html (accessed 20 October 2008). 208 Frederick Delius: A Research and Information Guide

This essay opens with a biographical sketch, then moves on to the works mentioned in the title. Includes bibliography.

1115. Bliss, Arthur. “The English Renaissance.” Pro-Musica Quarterly 2 (December 1923): 10–13. A survey of British composers, including Delius.

1116. Blom, Eric. “Delius and America.” Musical Quarterly, 15 (July 1929): 438–447. The author notes the lack of recognition for Delius’s music and explores possible reasons for it. There is also a discussion of the American years and a comparison of Delius and the American composer Edward MacDowell. Includes a portrait of Delius (1914).

1117. Botsford, Ward. “The Beecham Discography.” Le Grand Baton 6 (August–November 1969): 1–50. First published in nine parts in American Record Guide 33–36 (1967–1969). A comprehensive list of recordings made by Sir Thomas Beecham. The list (arranged by composer) includes title, performer, record number, recording date, and miscellaneous information.

1118. Bourke, Gerard. “The Genius of Delius.” Music Magazine/Musical Courier 164 (January 1962): 15–17. Centenary tribute. Includes illustrations of Delius’s homes in Bradford (no. 6 Claremont), Solano Grove, and Grez-sur-Loing.

1119. Brant, L. V. “Delius in America.” Etude 68 (August 1950): 7–8. A brief account of Delius’s years in the United States. The cover illustration of this issue features Hobson Pittman’s “Delius’ In a Summer Garden.”

1120. Brennan, Joseph Gerard. “Delius and Whitman.” Walt Whitman Review 18, no. 3 (September 1972): 90–96. Describes and provides context for Delius’s three settings of Whitman poetry. Jelka Delius abridged Whitman’s “Out of the Cradle Endlessly Rocking” for Sea Drift, and for his Songs of Farewell. Robert Nichols arranged text from Whitman’s “Once I Passed through A Populous City” and other poems for the late work Idyll.

1121. Brian, Havergal. “The Delius Festival,” parts 1 and 2. Musical Opinion (November 1929): 130–131; (December 1929): 240–241. Reprinted in Bibliography 209

Havergal Brian on Music: Selections from His Journalism, Vol. 1, edited by Malcolm MacDonald (see no. 1002), pp. 131–135. An appreciation of the works of Delius, prompted by the London Delius Festival held 12 October–1 November 1929.

1122. Brian, Havergal. “Delius’ Personality.” Musical Opinion 52 (November 1929): 144. Reprinted in Havergal Brian on Music: Selections from His Journalism, Vol. 1, edited by Malcolm MacDonald (see no. 1002), pp. 136–137. The composer Havergal Brian gives a brief recollection of how Delius would discuss music and his contemporaries. Brian remarks on Delius’s “original remarks” and his “great deal of wit.” The reprinted article is supplemented by a paragraph from Brian’s Musical Opinion column, “On the Other Hand” (May 1939): 686.

1123. Brown, Geoff. “Remixing the Delius Myth.” Times (30 June 2006). Available online, http://www.s230964027.websitehome.co.uk/articles. samples/times-30april.pdf (accessed 20 October 2008). Background material for the upcoming Delius Inspired Festival.

1124. Buchanon, Jason. “Delius: A Village Romeo and Juliet.” Allmovie. http:// www.allmovie.com/cg/avg.dll?p=avg&sql=4:289557 (accessed 21 October 2008). Includes brief synopsis, DVD menu contents, and extras.

1125. Buckley, Roger. “Delius in Norway: An Early Experience.” Adam International Review, no. 498/499 (1998): 62–66. A discussion of Delius’s Norwegian connections.

1126. Burnett, Gene M. “Florida Tapped the Music in His Soul.” Florida Trend (October 1975): 89–91. Reprint, Biography News 2 (November– December): 1194–1195; and “Florida: A Wellspring for Delius’ Music.” In Florida’s Past: People and Events That Shaped the State, Vol. 1, pp. 42–45. Englewood, Fla.: Pineapple Press, 1986. ISBN 0910923272. F 311.5.B87 1986. A brief description of Delius’s Florida years and his Florida-inspired works.

1127. Burns, R. C. “The Music of Delius: The Early Recordings (1927–38, 1948).” ARSC Journal 9, no. 2/3 (1977): 36–58. 210 Frederick Delius: A Research and Information Guide

A survey of the published Delius recordings made by Sir Thomas Beecham prior to World War II.

1128. Byrne, Susan. “Beecham’s Discovery of Delius.” Le Grand Baton 15 (December 1978): 27–29. A survey of the conductor Sir Thomas Beecham’s role in promoting Delius’s music and compares the lives and personalities of the two men.

1129. Canarina, John. “Delius: The Fenby Legacy.” High Fidelity 32 (February 1982): 59. Lengthy review of Unicorn-Kanchana DKP 9008/9 (see no. D120), conducted by Eric Fenby.

1130. Capell, Richard. “The Delius Festival,” parts 1 and 2. Monthly Musical Record 59 (1929): 332, 364. An extended review of the six Delius Festival concerts.

1131. Capell, Richard. “Delius: Landscape Painter in Music.” Radio Times (4 December 1931). Reprint, Redwood, Christopher. A Delius Companion (see no. 59), pp. 45–48. 1DWXUH ZDV DQ LPSRUWDQW LQÀXHQFH LQ WKH ZRUNV RI 'HOLXV MXVW DV LW served various landscape painters.

1132. Cardus, Neville. “Centennial: Frederick Delius.” Contemporary Review 201 (February 1962): 79–83. Centenary tribute.

1133. Carley, Lionel. “Grieg and Musical Life in England.” Musik & forskning 19 (1993–1994): 73–92. Delius is counted as one of four lasting friendships developed by Norwegian composer Edvard Grieg with musicians working in England. Includes a summary in Danish.

1134. Carley, Lionel. “Hans Haym: Delius’s Prophet and Pioneer.” Music and Letters 54 (January 1973): 1–24. Reprint, Redwood, Christopher, A Delius Companion (see no. 59), pp. 187–215. A description of Delius’s relationship with the German conductor Hans +D\PZKRJDYHPDQ\¿UVWSHUIRUPDQFHVRI'HOLXV¶VZRUNV Bibliography 211

1135. Carley, Lionel. “Jelka Rosen Delius: Artist, Admirer and Friend of Rodin: The Correspondence 1900–1914,” parts 1 and 2. Nottingham French Studies 9 (May 1970): 16–30; (October 1970): 81–102. $FROOHFWLRQRI¿IW\WZROHWWHUVIURPWKH'HOLXV7UXVW$UFKLYHFROOHFWLRQ The correspondence appears in the original French, but the commentary is in English.

1136. Carley, Lionel. “Munch and Delius.” Adam International Review no. 498–499 (1988): 56–62. An unauthorized publication made from a lecture given by Dr. Carley at the Musée d’Orsay, 1991.

1137. Carley, Lionel. “Nordic Art at the Cheltenham Festival, July 1994.” Anglo-Norse Review (winter 1994–1995): 24–25. Recounts how an exhibition of works by Nordic artists active in Grez-sur- Loing in the later part of the nineteenth century came to the Cheltenham Festival. The festival featured performances of two Scandinavian- inspired works by Delius.

1138. Chislett, W. A. “Neglected Composers, IV: Frederick Delius.” Gramophone (April 1927): 450–452. Biographical sketch, portrait, and survey of major works (with record label and number for those recorded). The author terms Delius a “neglected composer” in his native land, noting the cursory treatment given in Henry Davey’s History of English Music (2nd ed. London: J. Curwen, 1921).

1139. Church, Michael. “New Strings to Two Fiddlers’ Bows.” Classical Music 809 (18 March 2006): 38–39. Discusses the founding of a festival by Tasmin Little to honor Delius in Bradford. Little will also be among the festival’s performers.

1140. Clayton, Emma. “Tasmin Host Dazzling Toast to Genius of Delius.” Ilkley Gazette (16 June 2006). Available online, http://www.s230964027. websitehome.co.uk/articles.samples/ilkley_16june.pdf Background information for the upcoming Delius Inspired festival.

1141. Cooke, Deryck. “Delius: A Centenary Evaluation.” The Listener 67 (25 January 1962): 195–196. Reprinted in Essays on Music: An Anthology from The Listener, edited by Felix Aprahamian, pp. 84–92. London: Cassell, 1967. ML 55.A65; Vindications: Essays on Romantic Music, 212 Frederick Delius: A Research and Information Guide

pp. 116–122. Cambridge: Cambridge University Press, 1982. Reprint, London: Faber, 1982. ISBN 0521247659. ML 196.C66 1982. The author argues that Delius’s popularity in England was ephemeral, starting only with the 1929 Festival and dwindling after the 1946 Festival to its current low ebb at the centenary mark. He explores several possible reasons for disinterest, among them the tastes of English musicians, his style, and his “un-English” attitude to life perceived in the music.

1142. Cooke, Deryck. “Delius and Form: A Vindication,” parts 1 and 2. Musical Times 103, no. 1432 (June 1962): 392–393; no. 1433 (July 1962): 460–465. Reprinted in Vindications: Essays on Romantic Music, pp. 123–142. Cambridge: Cambridge University Press, 1982. Reprint, London: Faber, 1982. ISBN 0521247659. ML 196.C66 1982; and in A Delius Companion (see no. 59), pp. 249–262. Examines Delius’s use of formal structures through an analysis of the Violin Concerto. Several letters to the editor were written regarding this article in subsequent issues of Musical Times.

1143. Cooke, Deryck. “The Delius Centenary: A Summing-Up,” parts 1–3. Musical Opinion 85 (June 1962): 527–531; (July 1962): 589–593; (August 1962): 653–657. An attempt to understand widely different critical reactions to the Bradford Delius Festival, and to evaluate reception of Delius’s music LQWKHSUHVHQWWLPH7KHVHFRQGSDUWRIWKHDUWLFOHGHDOVVSHFL¿FDOO\ZLWK critical reaction to A Village Romeo and Juliet.

1144. Cooke, Deryck. “Delius, Debussy and Pure Creation.” The Listener 67 (1 February 1962): 233. A comparison of two composers sharing a centenary in 1962: Delius and Claude Debussy. The author questions why Debussy (and not Delius) is acknowledged as a “seminal force,” and points to the differing personalities of the two composers as the answer.

1145. Cooke, Deryck. “Delius the Unknown.” Proceedings of the Royal Musical Association 89 (1962–1963): 17–29. Reprint, Delius Society Journal no. 137 (2005): 41–53. Cooke deplores the current state of indifference toward Delius during his centenary year, and advocates a revival of Delius’s music in England.

1146. Copley, Ian A. “A Delius Miniature and Some Memories.” Music and Letters 43 (January 1962): 4–6. Bibliography 213

Mrs. Cassirer-Neubauer, the widow of the conductor Fritz Cassirer, gives her reminiscences of Delius. Includes a photograph of the wax bust made by Catherine Barjansky, now in the possession of Mrs. Cassirer- Neubauer.

1147. Copley, Ian A. “Warlock and Delius: A Catalogue.” Music and Letters 49 (July 1968): 213–218. A brief overview of Delius’s relationship with Philip Heseltine, followed by an extensive listing of Heseltine’s transcriptions and arrangements of Delius’s works, and his writings on Delius. Robert Threlfall is credited with assistance in the preparation of the catalog.

1148. Coveney, John. “The Musical World of Frederick Delius: Magic and Mystery.” American Record Guide 36 (May 1970): 712–720. Reprint, The Delian (January 2000): 8. This extended review of Gloria Jahoda’s The Road to Samarkand (see no. 859) provides a survey of previously published full-length, English- language biographies of Delius.

1149. Cox, David. “Warlock as I Knew Him.” Composer 82 (summer 1984): 19–23. This interview with Eric Fenby records his impressions of meeting Philip Heseltine, and discusses Delius’s relationship with Heseltine.

1150. Cross, Burnett. “Manuel Tarshish Talks about Delius and Grainger.” Grainger Society Journal 9, no. 1 (1987): 15–37. In the latter half of this article, Tarshish recalls his conversations with Percy Grainger about Delius.

1151. Cruft, Adrian. “Eric Fenby.” Composer 27 (spring 1968): 2–3. 3UR¿OHRI)HQE\LQFOXGLQJKLVZRUNDV'HOLXV¶VDPDQXHQVLV

1152. Daly, Frank. “The Triple Tragedy.” Musical Opinion 107 (August 1984): 339–340. The loss of three composers (Edward Elgar, Frederick Delius, and Gustav +ROVW LQRQH\HDUKDGDVLJQL¿FDQWLPSDFWRQWKHPXVLFDOHVWDEOLVKPHQW of 1934. The author ponders the impact of a similar loss on the musical world of 1984.

 'DQH -HIIUH\ ³)UHGHULFN 'HOLXV )ORULGD¶V 3DVVLRQDWH ,QÀXHQFH RQ D Composer.” Florida Living 17, no. 12 (December 1997): 8–10. 214 Frederick Delius: A Research and Information Guide

Overview of Delius’s Florida years and the mark it left on his works.

1154. Demarquez, Suzanne. “Alfred Bruneau, Gustav Holst, Frederick Delius.” Revue musicale 15 (July–August 1934): 158–160. Notes the deaths of the three musicians.

1155. Douglas, Keith. “The Delius Society.” Gramophone 11 (1933): 132. An announcement of the formation of the Delius Society by its honorary secretary.

1156. Douglas, Keith. “Frederick Delius: An Appreciation.” Heaton Review 3 (1929): 52–54. An appreciation of Delius’s music and a description of his visit with Delius at Grez-sur-Loing.

1157. Drew, David. “Delius and France.” New Statesman 63 (11 May 1962): 686. Commentary prompted by the Bradford Delius centenary festival.

1158. Dubb, Asher. “Musicians’ Maladies: Of What Did They Die? Frederick Delius.” Adler Museum Bulletin 24, no. 1–2 (July 1998): 11–12. $Q RYHUYLHZ RI 'HOLXV¶V ¿QDO LOOQHVV 7KH DXWKRU WDNHV WKLV DFFRXQW primarily from John O’Shea’s Music and Medicine (see no. 1041). Includes a picture of the Delius 31p stamp, issued in Great Britain in 1985.

1159. Elgar, Edward. “My Visit to Delius.” British Musician and Musical News (May 1933). First published Daily Telegraph (May 1933). Reprinted in Moore, Jerrald Northrop, Edward Elgar: Letters of a Lifetime (see no. 23), pp. 470–471. Recounts the composer’s 1933 visit to Grez. The reprinted version includes the entire version of the Daily Telegraph, London, article; the editor of the volume notes that the article was shortened for publication in the newspaper.

1160. Evans, Edwin. “Delius: A Personal Reaction in the Form of a Letter.” The Sackbut 1 (December 1929): 118–123. Reprint, Redwood, Christopher. A Delius Companion (see no. 59), pp. 79–85. Bibliography 215

The English critic Edwin Evans shares his views on Delius after attending four of the six Delius Festival concerts.

1161. Fahy, Joseph. “Delius in Danville: The City Remembers.” High Fidelity/ Musical America, 36 (August 1986): MA27–28. An overview of Delius’s brief residence in Danville, Virginia.

1162. Fanning, David. “From Paradise to Ilkley Moor.” Daily Telegraph (4 July 2006). Available online, http://www.telegraph.co.uk/arts/main. jhtml?xml=/arts/2006/07/04/bmdelius04.xml (accessed 20 October 2008). Review of the Delius Inspired festival, held in Bradford, England.

1163. Fawkes, Richard. “Delius’ Secret.” Classical Music no. 584 (28 June 1997): 51. The English violinist and Delius specialist Tasmin Little describes the genesis of the BBC2 documentary The Lost Child (see no. 1814).

1164. Fenby, Eric. “Delius (1862–1934).” Music and Musicians 22 (June 1974): 26–28. Reprint, Lloyd, Stephen, ed. Fenby on Delius: Collected Writings on Delius to Mark Eric Fenby’s Ninetieth Birthday (see no. 58), pp. 44–47. Reminiscences of Delius and Grez-sur-Loing.

1165. Fenby, Eric. “Delius (1928–1934): A Chapter Completed.” Royal Academy of Music Magazine, no. 191 (1966): 8–12. Recounts Fenby’s visit to Jacksonville to participate in the 1966 Delius Festival.

1166. Fenby, Eric. “Delius after Twenty Years.” Music and Musicians (June 1954): 13. Reprint, Lloyd, Stephen, ed. Fenby on Delius: Collected Writings on Delius to Mark Eric Fenby’s Ninetieth Birthday (see no. 58), pp. 44–47. Fenby writes about Delius and his music on the occasion of the twentieth anniversary of Delius’s death.

1167. Fenby, Eric. “Delius Was No Drooping Dreamer.” Music and Musicians 10 (March 1962): 17. Reprint, Lloyd, Stephen, ed. Fenby on Delius: Collected Writings on Delius to Mark Eric Fenby’s Ninetieth Birthday (see no. 58), pp. 50–54. 216 Frederick Delius: A Research and Information Guide

Fenby refutes the stereotypical view of the composer as a terminally ill man.

1168. Fenby, Eric. “Delius’s Last Years.” Musical Times 75, no. 1097 (July 1934): 604–605. Reprint, Lloyd, Stephen, ed. Fenby on Delius: Collected Writings on Delius to Mark Eric Fenby’s Ninetieth Birthday (see no. 58), pp. 23–24. 'HVFULEHVWKHFRQGLWLRQVDW*UH]GXULQJ'HOLXV¶V¿QDO\HDUVZKHQ(ULF Fenby served as his amanuensis.

1169. Fenby, Eric. “Frederick Delius.” Crescendo no. 122 (October 1962): 27. Centenary tribute.

1170. Fenby, Eric. “Frederick Delius 1862–1934.” Radio Times 188 (13 February 1969): 39. A brief discussion of Delius’s compositional style in preparation for an upcoming broadcast program.

1171. Fenby, Eric. “Frederick Delius, January 1862–June 1934.” Canon 15 (January–February 1962): 4–5. Short discussion of Delius’s life and his contribution to British music on the occasion of the Delius centenary.

1172. Fenby, Eric. “Revisiting Solano Grove: Delius in Florida.” Composer no. 21 (1966): 5–7. Reprinted in part, Lloyd, Stephen, ed. Fenby on Delius: Collected Writings on Delius to Mark Eric Fenby’s Ninetieth Birthday (see no. 58), pp. 174–175. Recounts the author’s visit to Solano Grove, the “spiritual birthplace” of Delius’s music.

1173. Foss, Hubert. “After-Thoughts on Delius.” Musical Times 70, no. 1042 (1 December 1929): 1073–1076. Considers four points regarding Delius’s music: the “different cast” of Delius’s mind, the ultimate simplicity of his work, his inability to submit to the “academic foot-rule,” and the preoccupation of his work with the sheer beauty of sound.

1174. Frandsen, Ulrike. “Frederick Delius (1862–1934): Ein Verzeichnis der in öffentlichen Musikbibliotheken der Bundesrepublik Deutschland (Alte Bundesländer) vorhandenen Werke.” Forum Musikbibliothek no. 4 (1992): 292–311. Bibliography 217

A list of Delius works held by various German public libraries.

1175. Freeman, John W. “Records.” Opera News 37, no. 19 (17 March 1973): 32. Feature review of several Delius recordings: Angel SBLX-3784 (A Village Romeo and Juliet), Angel SB-3781 (A Mass of Life), Angel S-36756 (Appalachia, Brigg Fair), and Seraphim S-60147 (Requiem, Idyll).

1176. Frye, H. N. “Frederick Delius.” Canadian Forum 16, no. 187 (August 1936): 19–20. Discussion of Delius’s nationalism, character, and compositional style.

1177. Garcia, Emanuel E. “Frederick Delius: Devotion, Collaboration and the Salvation of Music.” http://thompsonian.info/delius-garcia.html (accessed 20 October 2008). Text of a paper delivered at the Philadelphia Ethical Society, Philadelphia, Pennsylvania. The Web page also includes an image of the poster DQQRXQFLQJ WKH SUHVHQWDWLRQ DQ DXGLR ¿OH RI WKH VHFRQG PRYHPHQW of Delius’s Violin Sonata no. 3, and photos of the performers (Daniel Khalikov, violin, and Elena Jivaeva, piano). Garcia, a psychiatrist, looks at Delius’s relationship with his family and music and his collaboration ZLWK (ULF )HQE\ DQG GLVFXVVHV 'HOLXV¶V ¿QDO LOOQHVV IURP D PHGLFDO perspective. Includes bibliography.

1178. Gillies, Malcolm. “Great Expectations: Grieg and Grainger.” Musical Times 148, no. 1900 (autumn 2007): 7–26. Material in this article was originally used in the opening address “Percy Grainger: Grieg’s Interpreter and Propagator” given to the International Grieg Society Conference “Beyond Grieg” held in Bergen, 30 May–2 June 2007. There are several references to Delius throughout this article, owing to his strong connections to both individuals.

1179. Gilman, Lawrence. “The World of Music: Two British Composers.” Harper’s Weekly 54 (26 November 1910): 19. 3UR¿OHV RI 'HOLXV DQG WKH 6FRWWLVK FRPSRVHU :LOOLDP :DOODFH ERWK LGHQWL¿HG DV \RXQJHU %ULWLVK FRPSRVHUV ZKRVH ZRUNV KDYH EHHQ neglected in concert halls in the United States. Includes a survey of works and brief discussion of style for both composers. 218 Frederick Delius: A Research and Information Guide

1180. Glass, Hubert. “Reissues for the Delius Centenary.” American Record Guide 30 (December 1963): 40. Survey of recordings released to mark the centenary.

1181. Grainger, Percy. “Genius of Delius.” Etude 39 (November 1921): 707. Reprint, “Glimpses of Genius.” Grainger Journal 5, no. 2 (1983): 18–21. Excerpt from an interview with Percy Grainger. Grainger speaks about Delius, , Cyril Scott, Richard Strauss, and characteristics of musical genius.

1182. Grainger, Percy. “The Genius of Frederick Delius.” Musical Courier 71 (18 November 1915): 39. Reprint, “Das Genie Delius.” Musikblätter des Anbruch 5 (January 1923): 23–24. Remarks on Delius’s personality and compositional style.

1183. Grainger, Percy. “The Personality of Frederick Delius.” Australian Musical News 24, no. 12 (1 July 1934): 10–15. Reprint, Redwood, Christopher, A Delius Companion (see no. 59), pp. 117–129. Reminiscences of Grainger’s friendship with Frederick and Jelka Delius.

1184. Gray, Cecil. “Delius and Beecham—A Delius Festival.” Nation (16 November 1929): 251. Review of the Delius Festival organized by Sir Thomas Beecham.

 *UHHQ¿HOG (GZDUG ³%DUELUROOL¶V /DVW 6HVVLRQV´ High Fidelity and Musical America 20, no. 11 (November 1970): 18. Describes conductor Sir John Barbirolli’s last recording sessions, in which he recorded Appalachia and Brigg Fair with the Hallé Orchestra.

1186. Grove, Jeff. “Florida Celebrates Delius.” American Record Guide 62 (September/October 1999): 18–20. Report from the 1999 Delius Festival, Jacksonville, Florida; features reviews of festival concerts.

1187. Hall, David. “The Fenby Legacy.” Stereo Review 47, no. 4 (April 1982): 62–63. Feature review of Unicorn-Kanchana DKP 9008/9 (see no. D120), conducted by Eric Fenby. Bibliography 219

1188. Hanna, A. J. “The Music Master of Solano Grove.” American Society Legion of Honor Magazine 14, no. 3 (1943): 185–192. Provides a description of Solano Grove and notes how “Floridians have joined with Yorkshiremen and other devotees in memorializing Delius’s life and works.” Some of these accomplishments include identifying, purchasing, and preserving of the Solano Grove site and cottage, assembling collections of correspondence and manuscripts, and creating an endowment fund for music in Jacksonville.

1189. Harrison, Beatrice. “Delius.” Everyman 2, no. 37 (10 October 1929). Reprint, Delius Society Journal no. 87 (1985): 21–29. 'HVFULEHVKHU¿UVWPHHWLQJZLWK'HOLXVDQGWKHKRXVHDQGJDUGHQDW*UH] Interspersed throughout the article are facsimiles of various newspaper clippings reviewing Miss Harrison’s performances of works by Delius.

1190. Harrison, Beatrice. “Frederick Delius at Home.” Radio Times (28 January 1927). Reprint, Delius Society Journal no. 87 (1985): 20. Describes a visit with Delius at his home in Grez-sur-Loing.

1191. Harrison, May. “Delius.” Royal College of Music Magazine 33, no. 2 (1937): 47–52. Reprint, Redwood, Christopher, A Delius Companion (see no. 59), pp. 101–106. The English violinist’s reminiscences of Frederick and Jelka Delius.

1192. Harrison, May. “The Music of Delius.” Proceedings of the Royal Musical Association 71 (1944–1945): 43–48. Reprint, Delius Society Journal no. 87 (1985): 32–37. Recalls some of Miss Harrison’s memories of the Deliuses, and makes some brief remarks about his chamber music.

1193. Heseltine, Philip. “Delius, Composer and Interpreter of Nature: Some Impressions.” Radio Times 25 (4 October 1929): 7. Reprint, Delius Society Journal no. 94 (1987): 35–38. A preview of the Delius Festival. Includes a look at Delius’s life and philosophy.

1194. Hill, Ralph. “The Gramophile’s Favourite Composers, no. 1: Frederick Delius.” Musical Mirror (October 1929): 261. Survey of Delius’s chamber, orchestral, and choral works in preparation for the upcoming Delius Festival. Includes discographical information. 220 Frederick Delius: A Research and Information Guide

1195. Hoare, Geoffrey. “Delius Slept Here?” Cotswold Life, no. 89 (1976): 26–28. Reprint, Delius Society Journal no. 54 (1977): 5–9. Recounts Delius’s 1881 visit to Stroud, Gloucestershire. Includes three photographs.

1196. Hoffman, Charles. “He Set Florida to Music.” All Florida and TV Magazine (4 November 1962): 3. An explanation of how Delius’s Solano Grove piano was found in Daytona Beach, Florida, in 1961.

1197. Hogarth, Basil. “Frederick Delius: A Critical Estimate.” English Review 59 (August 1934): 154–162. Tribute.

1198. Howarth, David. “The Last Summer.” Harper’s Magazine 223 (November 1961): 89–93. The author’s personal recollections of Delius’s reburial in the cemetery DW/LPSV¿HOG6XUUH\+HLQFOXGHVVRPHEDFNJURXQGLQIRUPDWLRQRQWKH Deliuses, and recounts his visit to Jelka Delius shortly before her death.

1199. Hughes, Herbert. “Notes from a Musical Diary: The Mystery of Delius.” Saturday Review 157, no. 4103 (16 June 1934): 708. Tribute and discussion of Delius’s career highlights and English roots.

1200. Hull, Robert. “The Music of Frederick Delius.” Contemporary Review 136 (October 1929): 496–501. $VXUYH\RIZRUNVDQGGLVFXVVLRQRI'HOLXV¶VVLJQL¿FDQFHLQOLJKWRIWKH upcoming Delius Festival.

1201. Hull, Robin H. “The Scope of Delius.” Music Review 3, no. 4 (1942): 257. 'LVFXVVHVZKHWKHU'HOLXV¶VVFRUHVDFWXDOO\UHÀHFWZKDWKHLQWHQGHGDQG the amount of direction given for the interpretation of his scores.

1202. Hull, Robin H. “Three British Composers: Elgar, Delius and Holst.” Musical Times 100, no. 1397 (July 1959): 380–382. A comparison of the status enjoyed by the three composers at the time of WKHLUGHDWKVDQGWZHQW\¿YH\HDUVODWHU

1203. Hurd, Peter. “The Heckelphone at 100.” Journal of the American Musical Instrument Society no. 30 (2004): 98–165. Bibliography 221

This extensive history of the heckelphone includes some brief remarks on the use of the bass oboe in the works of Delius.

1204. Hussey, Dyneley. “The Musician’s Gramophone.” Musical Times 95 (April 1954): 191. Review of the Delius Society’s recording of Appalachia.

1205. Hutchings, Arthur. “The Meditative English Mind.” The Listener 61 (23 April 1959): 736. On the surface, Cockaigne (by Edward Elgar), Sea Drift (by Delius), and the Beni Mora suite (by Gustav Holst) would appear to have nothing much in common. The author notes that there is indeed a commonality, in that the music of these three composers is “most frequently pressed into service for documentaries, travel and descriptive programs, and for plays during which the producer wishes to suggest expanses and distances, especially that of the mind and imagination.”

1206. Hutchings, Arthur. “Nietzsche, Wagner and Delius.” Music and Letters 22 (1941): 235–247. The author uses philosopher Friedrich Nietzsche as a “starting point [to] give us some insight into the least tangible contrasts between Wagner and Delius.” The author points to Delius’s early life in Bradford and the solitude experienced in Solano Grove as factors in Delius’s adoption of Nietzschean philosophy.

1207. Hutchings, Arthur. “The Technique of Romanticism. IV. The Latest Phase—Delius.” Musical Times 71, no. 1052 (1930): 889–892. Argues that Delius is representative of the “ultimate stage of romanticist technique.”

1208. Jenkins, Lyndon. “When Delius Came to Birmingham.” Warwickshire and Worcestershire Life (February 1982): 44–45. A discussion of the 1912 Birmingham Festival, which included a performance of Sea Drift. The author gives a present-day description of 'HOLXV¶VIRUPHUKRXVHLQ*UH]VXU/RLQJ,QFOXGHV¿YHLOOXVWUDWLRQV

1209. Jensen, Eric Frederick. “Sound as Symbol: )LQGHVLqFOH Perceptions of the Orchestra.” Music Review 55 (August 1994): 227–240. Includes a study of the pamphlet Anatomie et physiologie de l’orchestre (Paris, 1894), written by the occultist Papus (Gerard Encausse) with contributions by Delius. 222 Frederick Delius: A Research and Information Guide

1210. Johnson, Stephen. “Seemingly Seamless Song.” Gramophone 65 (January 1988): 1063. Brief summary of an interview with Eric Fenby about the recording of The Fenby Legacy discs for Unicorn-Kanchana (see no. D120).

1211. Jones, Philip. “Delius and America: A New Perspective.” Musical Times 125, no. 1702 (December 1984): 701–702. Reprint, Delius Society Journal no. 90 (1986): 10–12. -RQHVGHVFULEHVWZRSRVVLEOH$PHULFDQLQÀXHQFHVRQ'HOLXVWKDWSUHGDWH his trip to Florida. Related correspondence appears in the April and May 1985 issues of Musical Times.

1212. Jones, Philip. “The Delius Birthplace.” Musical Times 120 (December 1979): 990–992. Reprinted as “The Delius Birthplace: A Solution.” Delius Society Journal no. 67 (1980): 5–9. An examination of the uncertainties surrounding the exact location of Delius’s birthplace. His birthplace was recorded as No. 6 Claremont, Bradford, Yorkshire, England, while the family home at the time was JHQHUDOO\ NQRZQ WR EH 1R ± &ODUHPRQW -RQHV FRQVXOWHG RI¿FLDO records and contemporary accounts in an attempt to reconcile the differences in location.

1213. Kennedy, Michael. “Delius, Elgar and Holst Revisited: A New Look at Three Great English Composers 50 Years after Their Deaths.” Keynote Magazine 8 (June 1984): 14–19. Discovers some interesting parallels in the careers of Edward Elgar and Delius, who are described in the article as “twin musical souls.”

1214. Kennedy, Michael. “Elgar, Delius and Holst.” Hallé (April 1959): 8–12. 'LVFXVVHV WKH UHSXWDWLRQV RI WKH FRPSRVHUV RQ WKH WZHQW\¿IWK DQQLYHUVDU\ RI WKHLU GHDWKV 'HOLXV LV GHVFULEHG DV D ³ORQHO\ ¿JXUH perhaps the strangest in our musical history.” Kennedy gives incorrect dates for Delius’s birth and marriage.

1215. Kennedy, Michael. “The English Musical Renaissance 1880–1920.” Gramophone 60 (August 1982): 218–222. This survey focuses on the music of Edward Elgar, Delius, Ralph Vaughan Williams, and Gustav Holst. Includes a discography.

1216. Kennedy, Michael. “Out in the Cold.” The Spectator (11 September 2004): 49–50. Reprint, Delius Society Journal no. 137 (2005): 54–56. Bibliography 223

The 2004 Promenade Concerts series marked the seventieth anniversary of three composers who died in 1934 (Edward Elgar, Gustav Holst, and Frederick Delius). Kennedy contemplates the current reputations of the FRPSRVHUVDQGZKHWKHUWKDWZDVDFFXUDWHO\UHÀHFWHGLQWKHSURJUDPPLQJ of the concerts.

1217. Klenau, Paul. “The Approach to Delius.” Music Teacher (January 1927): 19–21. Reprint, Redwood, Christopher. A Delius Companion (see no. 59), pp. 31–36. Reminiscences of Delius and a discussion of his music.

 .UXVH*RWWIULHG³0LQGHQ5DYHQVEHUJHUDOV7DEDNSÀDQ]HULQ)ORULGD´ Der Minden-Ravensberger (1992): 96–99. Recounts the story of Adolf Fröhlke and Paul Nicolas who went to Florida to grow tobacco at Solano Grove in 1901.

1219. Lambert, Constant. “The Art of Frederick Delius.” Apollo (November 1929). Reprint, Redwood, Christopher, A Delius Companion (see no. 59), pp. 75–77. Lambert notes the emotional qualities of Delius’s music.

1220. LeVasseur, Andrea. “Song of Summer.” Allmovie. http://www.allmovie. com/cg/avg.dll (accessed 21 October 2008). Includes plot synopsis, cast list and production credits.

 /OR\G6WHSKHQ³(-0RHUDQ6RPH,QÀXHQFHVRQ+LV0XVLF´Musical Opinion 104 (February 1981): 174–177. ([DPLQHVWKHLQÀXHQFHVRI'HOLXVDQG3KLOLS+HVHOWLQHLQSDUWLFXODURQ the music of E. J. Moeran. Moeran’s Summer Valley for piano (1922) was dedicated to Delius.

1222. López López, José Luis. “Música de Hoy Para un Pensar por Venir. Nietzsche y la Música del Último Siglo: Una Aproximación.” Estudios Nietzsche: Revista de la Sociedad Espanola de Estudios sobre Friedrich Nietzsche 2, (2002): 73–90. Analyzes the relationship between Nietzsche’s philosophy and the music of the last century, including that of Delius (A Mass of Life).

 /RXLV.HLWK³6W3HWHU¶V&KXUFK\DUG/LPSV¿HOG6XUUH\´KWWSZZZ OLPSV¿HOGQHWOLPSV¿HOGKLVWRU\FKXUFK\DUGFKXUFK\DUGKWPO DFFHVVHG 20 October 2008). 224 Frederick Delius: A Research and Information Guide

%LRJUDSKLFDOSUR¿OHVRIWKHIDPRXVPXVLFLDQVEXULHGLQWKH&KXUFK\DUG including the Deliuses, Sir Thomas Beecham, the Harrison sisters, and the conductor Norman Del Mar. Includes color picture of the church.

1224. Lowe, Rachel. “The Delius Trust Manuscripts.” Brio 5 (spring 1968): 5–9. Reprint, Delius Society Newsletter no. 23 (1969): 2–6. A description of the manuscripts and Deliana held by the Delius Trust. Includes an overview of method used by the former Delius Trust archivist in the preparation of her catalog of Delius manuscripts. Corrigenda appears in Brio 5, no. 2 (autumn 1968): 10.

1225. Lowe, Rachel. “The Music Archive of the Delius Trust.” Music Review 34 (1973): 294–306. A condensed summary of the full catalog of manuscripts held by the Delius Trust. Some additional material and notes were provided by Robert Threlfall.

1226. Lowe-Dugmore, Rachel. “Delius and Elgar: A Postscript.” Studies in Music no. 8 (1974): 92–100. Background material on the relationship of the two composers and Elgar’s 1933 visit to Delius. The last two letters exchanged by the composers are reproduced in full.

1227. Lowe-Dugmore, Rachel. “Documenting Delius,” parts 1 and 2. Studies in Music, no. 12 (1978): 114–129; no. 13 (1979): 44–62. Addendum, Studies in Music, no. 14 (1980): 127. Reprint, Delius Society Journal no. 65 (1979): 7–14; no. 69 (1980): 15–20. ,GHQWL¿HV VRPH RI WKH SUREOHPV LQYROYHG LQ WKH SUHSDUDWLRQ RI A Descriptive Catalogue of Delius Letters in the Grainger Museum (see no. 30). Examines Delius’s undated letters in the Grainger Museum collections and relates them to those in other archives. Describes the problems encountered in dating the letters and reconciling dates and DFWLYLWLHVZLWKRWKHUSXEOLVKHGDQGXQSXEOLVKHGVRXUFHV7KH¿UVWSDUW of the article covers the years 1913 to 1915; the subsequent part covers 1916 to 1919.

1228. Lowe-Dugmore, Rachel. “Frederick Delius and Norway.” Studies in Music, no. 6 (1972): 27–41. Revised reprint, Redwood, Christopher, A Delius Companion (see no. 59), pp. 167–186. 'LVFXVVHV WKH LQÀXHQFH RI 1RUZD\ RQ 'HOLXV¶V PXVLF WKURXJK LWV geography, music, art, and people. Corrigenda are published in Studies in Music, no. 7 (1973): 98. Bibliography 225

1229. Luther, John. “West Coast Delius Society Launched.” West Coast Delius Society Newsletter 1, no. 1 (January 1995): 1. Announces the formation of the West Coast Delius Society, whose aims are to introduce the music of Delius and promote performances of his music on the west coast of the United States.

1230. Lyle, Robert. “Delius and the Philosophy of Romanticism.” Music and Letters 29 (April 1948): 158–164. The author uses Delius as an illustration of how musical appeal is not able to be documented in purely musical terms, but must rely on extramusical explanations.

1231. Lyle, Watson. “Frederick Delius, C. H.—Himself and His Music.” Windsor Magazine (November 1929) Biographical sketch and overview of his major works.

1232. Marsh, Carole. “Frederick Delius.” In Britain (January 1985): 19–20. Biographical sketch with an emphasis on Delius’s Bradford connections.

1233. Mayes, Stanley H. “Frederick Delius, a Man of Genius: A Discography.” Le Grand Baton (January–March 1965): 3–16. The discography lists “every known record.” It is arranged by composition title and gives label and number information, performers, dates, and commentary.

 0HDG:LOOLDP5³$:LQWHU¶V7DOH5HÀHFWLRQVRQWKH'HOLXV)HVWLYDO (1946).” Norseman (1947): 78–81. 7KHDXWKRUUHÀHFWVRQ'HOLXV¶V1RUZHJLDQFRQQHFWLRQVDQGQRWHVWKDWWKH music inspired by Norway was the music of his youth.

1235. Mellers, Wilfrid. “Delius and Peter Warlock: A Comparative Note.” Scrutiny 5 (March 1937): 384–397. A comparison of the music of Delius and Philip Heseltine, highlighted by excerpts from letters quoted in the Cecil Gray biography of Heseltine (J. Cape, 1974).

1236. Mitchell, Donald. “Delius—Twenty Years After.” The Listener 59 (12 June 1958): 993. 226 Frederick Delius: A Research and Information Guide

A survey of the reception of Delius’s music during the past twenty years, plus a discussion of form in his music.

1237. Mitchell, Donald. “The Private World of Frederick Delius.” Musical Opinion 76 (April 1953): 405–407. A discussion of Delius’s uniquely personal compositional style.

1238. Nathan, Frederick P. “Delius, Some Recollections.” Hallé (March 1951): 18. Recollections of a former schoolmate of Delius. The friendship began while attending the same school in Bradford; the two met again later in Manchester and Paris.

1239. Nichols, Robert. “The Power of Music.” London Mercury 35, no. 207 (January 1937): 270–277. Discussion of Eric Fenby’s relationship with Delius on the occasion of the publication of Fenby’s Delius As I Knew Him (see nos. 850–852). The December issue of London Mercury (35, no. 206, 1936) includes a reproduction of the Edvard Munch portrait in a plate following p. 116.

1240. Norrie, Jane. “Beyond the Frame.” Neues Glas, no. 1 (January 1995): 24–27. Depicts Amber Hiscott’s Quatrefoil for Delius (1993), a large three- dimensional steel and glass work located in Bradford.

1241. Orr, C. W. “Delius Versus the Rest: A Study in Musical Egotism.” Making Music, no. 28 (1955): 5–7. Orr draws on his twelve-year friendship with Delius for this study of Delius’s musical likes and dislikes. Includes numerous quotations from their correspondence.

1242. Orr, C. W. “Frederick Delius: Some Personal Recollections.” Musical Opinion 57 (August 1934): 944–946. Reprint, Redwood, Christopher. A Delius Companion (see no. 59), pp. 55–63. The author recalls his introduction to Delius and his music.

1243. Oyler, Philip. “Delius at Grez.” Musical Times 113, no. 1551 (May 1972): 444–447. Oyler, an English farmer, served as a manager of a large estate near Delius’s house at Grez-sur-Loing. In this article, he notes his dislike of Bibliography 227

Delius’s music and disagrees with Eric Fenby’s accounts of how Delius dictated his music to Fenby. Eric Fenby gives his response in a letter to the editor (Musical Times 113, no. 1554 (August 1972): 767).

1244. Oyler, Philip. “Frederick Delius in His Garden.” Music Student, 14 (July 1934): 121–123. Reprint, Redwood, Christopher, A Delius Companion (see no. 59), pp. 49–54, and Delius Society Journal no. 140 (2006): 23–28. Describes Delius’s garden at Grez-sur-Loing in great detail.

1245. Palmer, Christopher. “Delius—A German Composer?” Musical Opinion 96 (1973): 4–6. 'HEDWHVZKHWKHU'HOLXVFDQEHFODVVL¿HGDVD*HUPDQFRPSRVHULQYLHZ of his formal education and early success in Germany. Delius’s Eine Messe des Lebens (A Mass of Life) can be seen as a truly German work in its inspiration, spirituality, and compositional technique.

1246. Palmer, Christopher. “Delius and Folksong.” Musical Times 112, no. 1535 (January 1971): 24–25. Discusses Delius’s use of folk song elements in his music, despite his professed lack of interest in English folk song.

1247. Palmer, Christopher. “Delius and Percy Grainger.” Music and Letters 52 (October 1971): 418–425. A comparison of the two composers, noting similar harmonic styles and common interests in Scandinavia, America, and folklore.

1248. Palmer, Christopher. “Delius and Poetic Realism.” Music and Letters 51 (1970): 404–414. Studies Delius’s association with the writers of the German “poetic realism” movement. Includes a discussion of the differences between Gottfried Keller’s original story Romeo und Julia auf dem Dorfe and the libretto used by Delius for his opera A Village Romeo and Juliet.

1249. Palmer, Christopher. “Delius, Vaughan Williams, and Debussy.” Music and Letters 50, no. 4 (1969): 475–480. Though Delius is usually described as an English composer, he remains D³VROLWDU\DQGHQLJPDWLF¿JXUH´ZKRVHPXVLFGHVSLWHLWVLQGLYLGXDOLW\ is essentially stateless. Palmer compares the development of the three FRPSRVHUV¶VW\OHVDQGQRWHVWKHLQÀXHQFHRIQDWXUHRQWKHP 228 Frederick Delius: A Research and Information Guide

1250. Palmer, Christopher. “The Fenby Connection.” Records and Recordings no. 289 (October 1981): 16–18. 7KH DXWKRU ZKR GHYLVHG DQG SURGXFHG WKHVH UHFRUGLQJV UHÀHFWV RQ Delius and his relationship with amanuensis Eric Fenby.

1251. Palmer, Christopher. “The Fenby Legacy.” Gramophone 59 (October 1981): 524–525. Describes the recording of The Fenby Legacy discs released on the Unicorn-Kanchana label (see no. D120).

1252. Palmer, Christopher. “Indian Summer of a Genius: Fenby’s Work with Delius.” Country Life (6 September 1976): 658. $VKRUWSUR¿OHRI(ULF)HQE\DQGDGHVFULSWLRQRIKLVZRUNDV'HOLXV¶V amanuensis. Includes a photograph of Delius and Fenby, and a reproduction of the Edmond X. Kapp drawing (1932) of Delius.

1253. Palmer, Peter. “Lost Paradises: Music and the Aesthetics of Symbolism.” Musical Times 148, no. 1899 (2007): 37–50. 7KHDXWKRULVVXUSULVHGWR¿QGQRPHQWLRQRI'HOLXVLQThe Encyclopedia of Symbolism (New York: Berkley, 1995) despite the presence of Symbolist elements in several of his works (e.g., Paris, Summer Night on the River, Song of the High Hills, A Village Romeo and Juliet).

 3DUNHU'&³7KH'HOLXV)HVWLYDO6RPH5HÀHFWLRQV´Musical Standard (28 December 1929): 211. Review of festival events.

1255. Payne, Anthony. “Delius’s Stylistic Development.” Tempo, no. 60 (1961–1962): 6–16. Delius’s works are studied chronologically to determine a pattern of stylistic development.

1256. Payne, Anthony. “Englands zweite Renaissance in der Musik.” Oesterreichische Musikzeitschrift 41 (March–April 1986): 149–154. Delius is included as a principal representative of the “second renaissance” of English music in this general survey of composers active from 1900 to 1930.

1257. Pike, D. E. “The Future of Delius.” Chesterian no. 50 (November 1925): 37–41. Bibliography 229

Speculates that the future of Delius’s music will rest with the “works whose foundations are sustained without the fatal aid of the human YRLFH´$OVRLQFOXGHVGLVFXVVLRQRIKLVPDMRUZRUNV OLPLWHGFKLHÀ\WR those published at the time the article was written).

1258. Pirie, Peter J. “Debussy and Delius.” Musical Opinion 86 (July 1963): 593. A comparison of the two composers.

1259. Pirie, Peter J. “Debussy and English Music.” Musical Times 108 (July 1967): 599–601. A discussion of composer Claude Debussy’s relationship with England. Delius is mentioned as a contemporary of Debussy, and there is a brief comparison of their music.

1260. Pirie, Peter J. “Epitaph on a Centenary (Frederick Delius 1862–1962).” Music Review 23 (August 1962): 221–237. The works and reputation of Delius are discussed in response to an unfavorable press reaction to a Delius centenary concert.

1261. Pirie, Peter J. “No Funeral Taps for Delius.” High Fidelity 12 (April 1962): 46–48, 108. The author speculates whether Delius’s music can survive the death of its champion, Sir Thomas Beecham, or if Delius’s music is perhaps ultimately better served by new interpretations. He also observes that very little recorded music is being released to mark the Delius centenary.

1262. Plush, Vincent. “Delius and the Ladies of Jacksonville, Florida.” ABC Radio 24 Hours (Australia) (September 1994): 44–48. Plush surveys Delius’s Florida years and questions the effectiveness of present-day efforts to further Delius’s music.

1263. Pond, Steven F. “Jamming the Reception: Ken Burns, ‘Jazz,’ and the Problem of ‘America’s Music.’” Notes 60 (September 2003): 11–45. Includes a discussion of Ellington’s “Delius language” and probes the TXHVWLRQDVWRKRZDQGZKDWH[WHQW(OOLQJWRQZDVDFWXDOO\LQÀXHQFHG by Delius.

1264. Pryce-Jones, Alan. “Music: Delius.” London Mercury 21, no. 122 (December 1929): 172–174. 230 Frederick Delius: A Research and Information Guide

Evaluation of Delius’s works in light of the recent Delius Festival.

1265. Ralph, Robert. “Delius.” Musical Opinion (October 1913): 16–17. A study of the characteristics and compositional style of the music of Delius. The author uses two simple songs (“Abendstimmung” [“Twilight Fancies”] and “Wiegenlied” [from Sieben Lieder (aus dem Norwegischen)]) as examples of art that will ensure Delius “his ultimate place in the ‘royal line.’”

1266. Randel, William. “Frederick Delius in America.” Virginia Magazine of History and Biography 79 (July 1971): 349–366. Reprint, “Delius in America,” in Redwood, Christopher, A Delius Companion (see no. 59), pp. 147–166. A detailed account of Delius’s American experience and its impact on KLVPXVLF'HOLXVWUDYHOHG¿UVWWR)ORULGDDQG9LUJLQLDEHWZHHQDQG DQGEULHÀ\UHWXUQHGWR)ORULGDLQWRVHOOKLVRUDQJHSODQWDWLRQ and promote his music.

1267. Raynor, Henry. “‘A Supreme and Complete Egoist.’” Musical Opinion 77 (April 1954): 401–405. A discussion of Delius’s works and compositional style.

1268. Redwood, Christopher. “Delius and Strindberg.” Music and Letters 56, no. 3–4 (1975): 364–370. A discussion of Delius’s friendship with the artist, including their friends and places in common.

1269. Reed, Peter Hugh. “Delius: The Musical Sunset of the Romantics.” Musical Standard (23 March 1929): 93. Discussion of Delius’s life and works; includes discography.

1270. Rees, C. B. “The Delius Centenary.” Musical Events 17 (April 1962): 4–5. A brief editorial on the occasion of the Delius Centenary Festival (Bradford, England).

1271. Reid, Charles, and Ernest Bradbury. “Delius.” Music and Musicians (May 1962): 14–15. The authors present two contrasting reviews of the centenary Bradford (England) Delius Festival. Includes a reproduction of the Augustus John drawing of Delius. Bibliography 231

1272. Reynolds, Peter J. “Peter Warlock: His Contemporaries and Their ,QÀXHQFH´British Music 7 (1985): 48–58. 'HOLXVZDVRQHRIVHYHUDOLQÀXHQFHVRQWKHPXVLFRI3KLOLS+HVHOWLQH not only in Heseltine’s early music but in his mature style as well.

1273. Rippin, John. “A Visit to Grez.” Royal College of Music Magazine 59, no. 3 (1963): 69–70. Reprint, Delius Society Newsletter (March 1964): 3–4. Recounts an undated visit to Delius’s former house at Grez-sur-Loing. Includes a description of the house and garden.

1274. Roman, Zoltan. “Jugendstil 5HYLVLWHG ,QWHUVSHFL¿F &RQFHSWXDO Modelling and the Turn-of-the-Century ‘Peripheral’ Arts.” International Review of the Aesthetics and Sociology of Music 30 (December 1999): 111–149. Delius’s song “Spielmann” is examined in this study of the Jugendstil artistic movement.

1275. Roman, Zoltan. “Nietzsche via Mahler, Delius and Strauss: A New Look at Some ¿QGHVLqFOH ‘Philosophical Music.’” Nietzsche-Studien 19 (1990): 292–311. Examines Nietzschean elements present in three works: the “Zarathustras Nachtlied” section of A Mass of Life by Delius, by Richard Strauss, and Gustav Mahler’s Symphony no. 3.

1276. Rudland, Malcolm. “A New Home for Sir Thomas.” Musical Times 112 (July 1991): 361. Describes the reburial of Sir Thomas Beecham in the same cemetery DV 'HOLXV /LPSV¿HOG 3DULVK &KXUFK 6XUUH\  -RKQ $PLV UHDG D commemorative and valedictory address, reminding those in attendance WKDWQHDUO\¿IW\VL[\HDUVSULRU%HHFKDPVWRRGDWWKHYHU\VDPHVSRW and delivered a eulogy for Delius.

 6DIÀH0LFKDHODQG-HIIUH\56DIÀH³0HGLFDO+LVWRULHVRI3URPLQHQW Composers: Recent Research and Discoveries.” Acta Musicologica 65 (July–December 1993): 77–101. 'HOLXVLVRQHRIHOHYHQFRPSRVHUVZKRVHPHGLFDOSUR¿OHVDUHH[DPLQHG in this article. An evaluation of recent literature is included.

1278. Sastre, Cecile-Marie. “Picolata on the St. Johns: A Preliminary Study.” El Escribano: The St. Augustine Journal of History 32 (1995): 25–64. 232 Frederick Delius: A Research and Information Guide

The last part of this article describes Picolata after the Civil War. Delius is noted as one of the area’s most famous residents. Includes a description of the cottage and his activities during his stay at Solano Grove, located just south of Picolata.

1279. Sharp, G. N. “Delius,” parts 1–3. British Musician and Musical News (August 1938): 176–178; (September 1938): 204–207; (October 1938): 230–232. A survey of Delius’s works, focusing on A Village Romeo and Juliet, Sea Drift, and A Mass of Life. Includes bibliography.

1280. Simmons, David. “Kempe and Delius.” Music and Musicians 11 (December 1962): 54–55. A review of a centenary concert presented by the Delius Trust and the Royal Philharmonic Orchestra (conducted by Rudolf Kempe), Festival Hall, 29 October 1962.

1281. Simon, Heinrich. “Delius Festival in London.” Anbruch (November– December 1929): 349–352. Review of the festival concerts taken from the Frankfurter Zeitung. In German.

1282. Simon, Heinrich. “Jelka Delius.” Monthly Musical Record 65 (December 1935): 219–220. Reprint, Redwood, Christopher, A Delius Companion (see no. 59), pp. 131–134. Simon notes the recent death of Jelka Delius with this tribute.

1283. Smith, John Boulton. “Edvard Munch og Frederick Delius.” Kunst og Kultur 48 årg. 3. hefte (1965): 137–158. Reprint, Frederick Delius og Edvard Munch [Exhibition catalog] (see no. 96). An overview of the friendship between Delius and the Norwegian artist Edvard Munch. Includes references and twelve illustrations. In Norwegian.

1284. Smith, John Boulton. “Portrait of a Friendship: Edvard Munch and Frederick Delius.” Apollo 83 (January 1966): 38–47. Traces the friendship and correspondence between Delius and the 1RUZHJLDQ DUWLVW (GYDUG 0XQFK IURP WKHLU ¿UVW PHHWLQJ LQ 3DULV LQ the 1890s to Delius’s death in 1934. Includes references and thirteen illustrations. Bibliography 233

1285. Stanley, Katharine Phyllis. “Frederick Delius.” Musical Opinion (September 1935): 1004–1005. A brief study of “Delius the Musician.”

1286. Stevenson, Ronald. “Delius’s Sources.” Tempo, no. 151 (1984): 24–27. 'LVFXVVHVWKHLQÀXHQFHRI)UpGpULF&KRSLQRQWKHPXVLFRI'HOLXV

1287. Suckling, Norman. “Delius after a Generation.” Monthly Musical Record 79 (December 1949): 255–260. A reevaluation of Delius in light of the publication of Arthur Hutchings’s Delius (see no. 857).

1288. Surtees, Bruce. “Beecham and Delius.” Classical Music Magazine 16 (April 1993): 38. Describes the relationship between the English conductor Sir Thomas Beecham and Delius, and the transfer of Beecham’s recordings of Delius’s music to compact disc.

1289. Tetley, Gerard. “Composer Frederick Delius Spent a Formative Year in Danville.” Virginia and the Virginia County 7 (August 1953): 17–18, 36. Notes that Delius’s brief stay in Danville, Virginia, was not well documented or even well remembered by local citizens. Describes the GLI¿FXOWLHV&ODUH'HOLXV%ODFNHQFRXQWHUHGZKHQDWWHPSWLQJWR¿QGRXW more information about her brother’s residence in Danville.

1290. Tetley, Gerard. “Delius as a Teacher in Virginia.” Musical America 75 (15 February 1955): 7, 193. An account of Delius’s stay in Danville, prompted by an inquiry by Clare Delius Black for information for her book on her brother. Draws heavily on the recollections of Mrs. Willa McGehee Giles, the only living link to Delius at the time the article was written.

1291. Tetley, Gerard. “Delius in Danville.” Virginia Cavalcade 9, no. 1 (1959): 16–20. Describes Delius’s residence in Danville.

1292. Tetley, Gerard. “Delius Recalled as Virginia Town Music Teacher: Forgotten Interlude in Early Career Disclosed by Old Resident of Danville.” Musical America 55 (10 October 1935): 14. 234 Frederick Delius: A Research and Information Guide

Relates the story of the “discovery” of Delius’s eight-month stay in Danville, Virginia, between 1885 and 1886. Delius’s sister Clare had ZULWWHQWRDORFDOVFKRRORI¿FLDOLQVHDUFKRILQIRUPDWLRQRQ)UHGHULFN¶V VWD\ WKHUH ¿QGLQJ WKDW LW ZDV DSSDUHQWO\ IRUJRWWHQ E\ DOO H[FHSW WKH widow of Professor R. S. Phifer. Mrs. Phifer provided her recollections to the author. There are two illustrations (a picture of the Roanoke Female College, and one of Mrs. Phifer).

1293. Thompson, Bill. “Delius Connections.” The Music of Frederick Delius. http://thompsonian.info/delconn.html (accessed 1 October 2008). 6XUYH\ RI WKH PDQ\ SRSXODU PXVLFLDQV WKDW KDYH EHHQ LQÀXHQFHG E\ Delius, including Felix Slatkin, Nelson Riddle, Alex Stordahl, Duke Ellington, Mel Tormé, George Shearing, Peggy Lee, David Rose, Judy Garland, Les Baxter, Gene Krupa, Bernard Herrmann, and Dudley Moore.

1294. Threlfall, Robert. “Delius: A Fresh Glance at Two Famous Scores.” Musical Times 125 (June 1984): 315–319. Manuscript evidence is used to shed light on Delius’s compositional process in On Hearing the First Cuckoo in Spring and A Mass of Life.

1295. Threlfall, Robert. “Delius in Eric Fenby’s Mss.” Composer, no. 31 (1969): 19–21. A list of manuscripts bearing Eric Fenby’s musical work as Delius’s amanuensis. A revised and enlarged list appears in issue no. 57 (see no. 1296).

1296. Threlfall, Robert. “Delius in Eric Fenby’s Mss.” Composer, no. 57 (1976): 33–35. $UHYLVHGDQGHQODUJHGYHUVLRQRIWKHOLVWRIPDQXVFULSWV¿UVWSXEOLVKHG in Composer, no. 31 (1969) (see no. 1295).

1297. Threlfall, Robert. “Delius Music Manuscripts in Australia.” Studies in Music, no. 7 (1973): 69–76, 98. Describes twelve manuscripts housed in the Grainger Centre at the University of Melbourne. Includes musical examples, corrigenda, and addenda.

1298. Tracey, Edmund. “Sir Thomas Beecham on Frederick Delius.” The Listener 63 (7 January 1960): 11–12. Bibliography 235

Tracey interviews English conductor and Delius champion Sir Thomas Beecham about the publication of his book on Delius. Beecham also provides remarks on Delius’s opera, A Village Romeo and Juliet. Includes a reproduction of the A. Ouvré engraving of Delius.

1299. Turner, W. J. “Delius and Sibelius.” New Statesman and Nation n.s. 8 (17 November 1934): 718. Editorial written on the occasion of two Delius memorial concerts.

1300. Tyler, Larry. “Florida Recollections of Delius Shaky.” Jacksonville Monthly (January–February 1984): 71–75. Because Delius did not keep a diary, accounts of his Solano Grove days FRPHFKLHÀ\IURPUHFROOHFWLRQV,QVRPHFDVHVWKHDXWKRUQRWHVWKHVH recollections are “embroidered by adulatory biographers.” Includes a short bibliography and list of events to take place at the 1984 Delius Festival.

1301. Wainapel, Stanley F. “Frederick Delius: Medical Assessment.” New York State Journal of Medicine 80 (November 1980): 1886–1887. $QH[DPLQDWLRQRI'HOLXV¶VPHGLFDOKLVWRU\,QWKH¿UVWKDOIRIKLVOLIHKH was physically vigorous and healthy—exactly the opposite of the blind, FULSSOHGLQGLYLGXDOSRUWUD\HGLQ.HQ5XVVHOO¶V¿OPIRUWKH%%& (see no. 1820). Includes bibliographical references.

1302. Wainapel, Stanley F. “Frederick Delius: The Man, the Composer, the Patient.” Journal of Medical Biography 1 (1993): 160–164. $GHVFULSWLRQRI'HOLXV¶V¿QDOLOOQHVV,QFOXGHVDSRUWUDLW

1303. Wallace, Helen. “Little Goes a Long Way.” BBC Magazine 6 (August 1998): 24–28. $ SUR¿OH RI WKH (QJOLVK YLROLQLVW DQG 'HOLXV VSHFLDOLVW 7DVPLQ /LWWOH Includes some background information and her involvement in the %%&GRFXPHQWDU\¿OPThe Lost Child (see no. 1814).

1304. Warrack, John. “Three English Masters.” Gramophone 61 (March 1984): 1059–1060. Surveys the reception of the music of Edward Elgar, Delius, and Gustav +ROVWDQGKRZWKHUHFHSWLRQKDVÀXFWXDWHGLQWKH¿IW\\HDUVVLQFHWKHLU deaths. Includes a discography. 236 Frederick Delius: A Research and Information Guide

1305. Westbrook, Francis B. “Delius, 1862–1934.” Choir 53 (February 1962): 26–27. Centenary tribute.

1306. Westrup, J. A. “Editorial.” Music and Letters 43 (January 1962): 1–3. Centenary appreciation.

1307. White, Dale. “Delius.” Florida Living 12 (February 1992): 46–48. The author gives an account of Delius’s Solano Grove years, and notes the importance of Florida on Delius’s compositional style.

1308. White, Terence. “Delius.” British Musician and Musical News (August 1936): 180–181. ,GHQWL¿HVDQGDWWHPSWVWRGLVSHOWKUHHFDWHJRULHVRIREMHFWLRQVWR'HOLXV¶V music.

1309. Williams, Peter. “In a Summer Garden: Brief Encounter.” Dance and Dancers (December 1972): 25–29. Reprint, Delius Society Newsletter no. 39 (1973): 9–11. Review of the Ronald Hynd ballet based on the music of Delius given at Sadler’s Wells Theatre, 26 October 1972. Includes cast list and several pictures from the production. Following the Williams article are two shorter critiques: “Living Portrait” by John Percival and “Summer Idyll” by Noel Goodwin.

1310. Wollaston, George. “Delius on Record.” Canon 1 (November 1947): 32–34. Discography; includes a discussion of Brigg Fair, A Walk to the Paradise Garden, On Hearing the First Cuckoo in Spring, and Summer Night on the River.

1311. Woodruff, Juliette. “Delius: Music Man of Solano Grove.” Jacksonville Monthly (February 1984): 28–31. Recounts Delius’s Florida years on the occasion of the 1984 Delius Festival.

1312. Wright, C. E. “The Florida Home of Frederick Delius.” Le Grand Baton, 6 (August–November 1969): 58–61. First published in the New York Times (26 January 1969). Bibliography 237

A description of the relationships between Delius and Sir Thomas Beecham and Florida. Includes two photographs of the restored Delius cottage after its move to Jacksonville University.

Dissertations and Theses

1313. Allman, Anne Williams. “The Songs of Frederick Delius: An Interpretive and Stylistic Analysis and Performance of Representative Compositions.” Ed.D. diss., Columbia University, 1983. 265 p. Analyzes forty-four of Delius’s songs thought to be neglected in contemporary performance. Includes brief biographical sketch, English translations for the Danish, German, and French songs, a bibliography, and a list of available editions of the songs.

1314. Aylward, James. “A Study of the Rationale Underlying Certain Techniques of Delius with Examples from Selected Works.” M.A. thesis, San Jose State College, 1969. v, 55 p. Examines selected compositions from Delius’s middle years for evidence of the composer’s personal traits and philosophy. Musical works examined include Appalachia, Sea Drift, Brigg Fair, Dance Rhapsody no. 1, In a Summer Garden, Two Pieces for Small Orchestra, North Country Sketches, Violin Concerto, and A Song before Sunrise, with occasional references to other works.

1315. Bacon-Shone, Frederic. “Form in the Chamber Music of Frederick Delius.” Ph.D. diss., University of Southern California, 1976. Not available for examination.

1316. Boyle, Andrew J. “A Quest for Innocence: The Music of Frederick 'HOLXV±´3K'GLVV8QLYHUVLW\RI6KHI¿HOGL[S ([DPLQHV'HOLXV¶VHDUO\ZRUNVIRULQÀXHQFHVDQGIRUSURJUHVVWRZDUG his mature style. Includes musical examples, illustrations, chronological list of compositions (1880–1900), and a bibliography.

1317. Caldwell, Donald Graham. “The Choral Music of Frederick Delius.” D.M.A. diss., University of Illinois at Urbana-Champaign, 1975. ix, 301 p. Examines Delius’s musical logic and sense of design as found in his choral works. The following works are analyzed: Sea Drift, A Mass of Life, Songs of Sunset, An Arabesque, Requiem, Songs of Farewell, 238 Frederick Delius: A Research and Information Guide

Appalachia, A Song of the High Hills, and part songs (“On Craig Ddu,” “Midsummer Song,” “Wanderer’s Song,” To Be Sung of a Summer Night on the Water, The Splendour Falls on Castle Walls). Pertinent quotations from books by Philip Heseltine, Thomas Beecham, and Arthur Hutchings are given for each analyzed work. Includes a bibliography and a select discography.

1318. Chaung, Shun-Hsu. “Delius’s Musical Landscapes for Orchestra.” D.M.A. diss., University of Cincinnati, 1998. 101 p. After a brief summary of Delius’s life and works, the author examines 'HOLXV¶VPXVLFDOVW\OHDQGYDULRXVLQÀXHQFHVRQKLVVW\OH7ZRZRUNVDUH studied in detail: In a Summer Garden and The Song of the High Hills. Includes musical examples and a bibliography.

1319. Foreman, Lewis. “The British Musical Renaissance: A Guide to Research.” 3 vols. Fellow of Library Association diss., Library Association (London), 1972. Delius is one of seventeen composers selected by the author as the PRVWLPSRUWDQW¿JXUHVLQ%ULWLVKPXVLFRIWKHODWHQLQHWHHQWKDQGHDUO\ twentieth centuries. Includes a thorough listing of primary and secondary materials for the composers, and guides to general British music sources, illustration archives, agencies, concert programs, and music societies. Writings by the composers themselves (other than autobiographies) have been given only cursory treatment. The chapter on Frederick Delius, though now dated, is an excellent starting point for research.

1320. Foreman, Lewis. “English Music 1860–1960: Its Reception, Revival and Recording.” 3 vols. Ph.D. diss., University of Wales, 2006. Delius is one of fourteen composers featured in this study of musical reception, performance history and promotion of new music. The principal source for the study is the BBC Written Archives at Caversham.

1321. Gillmor, Alan Murray. “Frederick Delius: Five Orchestral Miniatures.” M.A. thesis, University of Michigan, 1964. 59 p. $QDO\]HV¿YHRUFKHVWUDOFRPSRVLWLRQVThe Walk to the Paradise Garden, Summer Night on the River, On Hearing the First Cuckoo in Spring, A Song before Sunrise, and A Song of Summer. Includes musical examples and bibliography.

1322. Grimes, Doreen. “Form in the Orchestral Music of Frederick Delius.” Ph.D. diss., North Texas State University, 1966. xvii, 459 p. Bibliography 239

A very thorough examination of form in Delius’s orchestral music. Includes a complete list of the orchestral works arranged by title, an index of the principal themes in each work, a conversion table (rehearsal letter or number converted to measure number), correspondence associated with this dissertation, bibliography, and handwritten musical examples.

1323. Haynes, Brooks. “Tonal Imagery in the Vocal Music of Frederick Delius.” M.M. thesis, University of Cincinnati, 1948. 127 p. Analyzes representative vocal works to show how Delius achieves tonal imagery through the use of melody, rhythm, harmony, and special compositional devices. Works analyzed include Sea Drift, Appalachia, A Mass of Life, To Be Sung of a Summer Night on the Water, A Late Lark, Cynara, excerpts from Koanga, and several songs with piano. Includes a complete list of works, bibliography, and select discography.

1324. Hutchings, Edward Gilmore. “The Published Solo Songs of Frederick Delius.” D.M.A. diss., University of Miami, 1980, v, 102 p. Examines Delius’s songs as a whole for text, rhythm, melody, harmony, accompaniment, and form. Includes a chronological list of songs according to published title, a list of translators, original language and dedication, and correspondence related to the dissertation, musical examples, and a bibliography.

1325. Jones, Philip. “The American Sources of Delius’s Style.” 2 vols. Ph.D. diss., University of Birmingham, 1981. ML 410.D35 J6 1981. Reprint, The American Source of Delius’ Style. Outstanding Dissertations in Music from British Universities. New York: Garland, 1989. ([SORUHVWKHLQÀXHQFHRIEODFN$PHULFDQVLQJLQJRQ'HOLXV¶VPXVLFDO style and analyzes the unpublished American Rhapsody for orchestra and other works. Includes a bibliography, discography, and musical examples.

 .RYDOHQNR 6XVDQ &KDI¿QV ³7KH 7ZHQWLHWK &HQWXU\ 5HTXLHP $Q Emerging Concept.” Ph.D. diss., Washington University, 1971. vii, 329 p. The author traces the origins of the “secular requiem” as it has evolved since World War I through the analysis of nine representative works. Delius’s RequiemLVLQFOXGHGLQDJURXSRI¿YHZRUNVGDWLQJIURPWKH World War I period. (The other works in the World War I period include Max Reger’s Requiem, Gustav Holst’s Ode to Death, Arthur Bliss’s Morning Heroes, and Edward Elgar’s The Spirit of England.) The Delius work, discussed on pp. 95–124, is given the most thorough treatment of 240 Frederick Delius: A Research and Information Guide

WKH¿YH,QFOXGHVPDQ\PXVLFDOH[DPSOHVWKHFRPSOHWHWH[WVRIWKHQLQH works (plus a few historical texts discussed in the introductory chapters), a table of selected nonliturgical of the twentieth century (divided into groups of works for soloist(s)/chorus/orchestra, voices, or instruments) and a bibliography.

1327. Lee, Katherine Lucille. “Selected Songs of Frederick Delius.” M.A. thesis, University of North Dakota, 1972. vii, 95 p. Examines nine of Delius’s songs for evidence of a relationship between the biographical events of Delius’s life and the language he selected for song texts. The songs are printed in their entirety with titles (except one) given only in English: “The Nightingale” [“Sing, Sing”], “Twilight Fancies” [“Abendstimmung”], “Hidden Love” [“Verborg’ne Liebe”], “Love’s Philosophy,” “Le ciel est, par-dessus le toit,” “Black Roses” [“Schwarze Rosen”], “Summer Landscape,” “The Nightingale Has a Lyre of Gold,” and “So White, So Soft, So Sweet Is She.” Numerous misspellings mar the bibliography.

1328. Lim, Yekyung. “Neglected Cello Repertoire of Twentieth Century English Composers.” D.M.A., University of Maryland, College Park, 2006. The author’s premise is that, for a variety of reasons, many twentieth- century English compositions by major composers for cello remain relatively unknown. The second recital associated with this D.M.A. project included Delius’s Romance.

1329. Miller, Michael Keith. “Delius and Debussy: An Analytical Comparison of Selected Orchestral Works.” M.M. thesis, Florida State University, 1989. ii, 85 p. Delius’s Two Pieces for Small Orchestra are compared with two works RI 'HEXVV\ LQ DQ DWWHPSW WR ¿QG VLPLODULWLHV LQ WKH FRPSRVLWLRQDO techniques of the two composers.

 0RUULVRQ 'RQDOG 1DXPDQ ³,QÀXHQFHV RI ,PSUHVVLRQLVW 7RQDOLW\ RQ Selected Works of Delius, Griffes, Falla and Respighi.” Ph.D. diss., Indiana University, 1960. 163 p. $QDO\]HV VHOHFWHG ZRUNV IRU WKH LQÀXHQFH RI )UHQFK LPSUHVVLRQLVW concept of tonality. The chapter devoted to Delius analyzes selected songs, opera, works for chorus and orchestra, orchestra, choral music, and piano pieces. Includes handwritten musical examples and bibliography. Bibliography 241

1331. Mruzek, David Mitchell. “Percy Aldridge Grainger’s The Warriors: An Historical and Analytical Study.” Ph.D. diss., Ohio State University, 1996. 481 p. Percy Grainger dedicated his composition The Warriors to Frederick Delius. An overview of their friendship is followed by a summary of their relationship in connection with this work. Includes a bibliography.

1332. Neil, Gregory Alan. “The Violin and Piano Sonatas of Frederick Delius.” D.M.A., Boston University, 2006. xvi, 186 p. An analysis of the structure, tonal design, and melodic and rhythmic features of the Violin Sonatas nos. 1–3. Includes musical examples and bibliography.

1333. Proctor, Francis Wilcox. “The Harmonic Technique of Delius and Its Relation to His Orchestration.” M.A. thesis, University of Rochester, 1940. xiii, 255 p. Examines representative works from throughout his career in an effort to determine the essential elements of his harmonic style. Works analyzed: Brigg Fair, In a Summer Garden, A Song of Summer, On Hearing the First Cuckoo in Spring, Summer Night on the River. Includes a bibliography.

1334. Stoneman, Mark Alan. “The Delius Festival of Jacksonville, Florida.” M.F.A. thesis, University of Florida, 1986. vii, 113 p. A history of the Delius Festival, held annually in Jacksonville since 1961. The festival was an outgrowth of the all-Delius concerts sponsored by the Ladies Friday Musicale. Appendices contain the bylaws of the Delius Association of Florida, a catalog of the Delius archive at Jacksonville University, and lists of Delius works that have been performed at the festivals, lectures presented at the festivals, and winners of the festival composition contest (1969–1986). Includes a bibliography.

1335. Tamblyn, John William. “The Variation Technique of Delius in Appalachia.” M.M. diss., University of Rochester, 1950. iii, 94 p. Examines the melodic, rhythmic, and harmonic variations found in this work for orchestra and chorus.

1336. Tumino, Joseph E. “A History and Analysis of Frederick Delius’ The Magic Fountain.” M.M. thesis, Roosevelt University, Chicago Musical College, 1997. 54 p. 242 Frederick Delius: A Research and Information Guide

Provides background information for Delius’s opera. Includes plot synopsis, bibliography, and handwritten musical examples.

1337. Williams, Grier Moffatt. “A History of Music in Jacksonville, Florida from 1822–1922.” Ph.D. diss., Florida State University, 1961. xvi, 347 p. Although the actual Delius content is slim, this study provides excellent context for Delius’s Florida years. Includes a directory of professional musicians during that time and a bibliography.

1338 Yates, Elizabeth. “Actionless Opera: The Establishment of Dramatic Intensity in Three Operas.” M.A. thesis, San Francisco State University, 1988. viii, 109 p. Three examples of operas with little or no stage action are studied to determine how dramatic intensity is established or maintained. One chapter is devoted to Delius’s Fennimore and Gerda. Includes musical examples and a bibliography. The discography does not include any Delius recordings.

1339. Yie, HyounKyoung. “Harmonic Syntax in Delius’s Late Period Chamber Music (1905–1930).” Ph.D., The Ohio State University, 2008. vx, 164 p. An analysis of the general characteristics of Delius’s harmonic language through statistical analysis, and his characteristic harmonic devices and progressions as found in the late chamber works.

BOOK REVIEWS

This section contains reviews of books considered to be the “essential” Delius literature, and is necessarily selective in approach.

Reviews of Multiple Titles

1340. “Book Reviews.” Delius Society Journal no. 47 (1975): 10–12. Reviews of Frederick Delius, 1862–1934: A Catalogue of the Music Archive of the Delius Trust, London by Rachel Lowe (see no. 31) and Delius: The Paris Years by Lionel Carley (see no. 846).

1341. Anderson, Robert. “Delius in Letters.” Musical Times 125 (June 1984): 329. Review of Delius: A Life in Letters 1862–1908 (see no. 10) and Frederick Delius and Edvard Munch: Their Friendship and Their Correspondence (see no. 14). Bibliography 243

1342. Anderson, Robert. “Delius Listed.” Musical Times 128 (October 1987): 565. Review of Frederick Delius: A Supplementary Catalogue by Robert Threlfall (see no. 35) and Frederick Delius 1862–1934: A Reprint of the Catalogue of the Music Archive of the Delius Trust (1974) with Minor Corrections by Rachel Lowe (see no. 32).

1343. Anderson, Robert. “Delius—Seen and Catalogued.” Musical Times 119 (March 1978): 237. Review of Delius: A Life in Pictures (see no. 847) and A Catalogue of the Compositions of Frederick Delius (see no. 33).

1344. Anderson, Robert. “Master & Pupil.” Musical Times 138 (February 1997): 38–39. Review of The Search for Thomas F. Ward, Teacher of Frederick Delius (see no. 959) and Fenby on Delius (see no. 58).

1345. Anderson, Robert. “Prelude to Delius.” Musical Times 116 (October 1975): 881. Review of Delius: The Paris Years by Lionel Carley (see no. 845), and Catalogue of the Music Archive of the Delius Trust by Rachel Lowe (see no. 31).

1346. Anderson, Robert. “Reviews: Books.” Musical Times 136 (May 1995): 245–246. Review of Robert Threlfall’s Delius’ Musical Apprenticeship (see no. 981) and Frederick Delius: A Musical Notebook (see no. 982).

1347. Butler, Christopher. “Review of Books.” Music and Letters 67 (January 1986): 78–80. Review of Delius: A Life in Letters, volume 1 (see no. 10) and Frederick Delius & Edvard Munch: Their Friendship and Their Correspondence (see no. 14).

1348. Dearling, Robert. “Delius.” Music and Musicians 26 (March 1978): 46. Reviews A Catalogue of the Compositions of Frederick Delius by Robert Threlfall (see no. 33) and Delius: A Life in Pictures by Lionel Carley and Robert Threlfall (see no. 847). 244 Frederick Delius: A Research and Information Guide

1349. Foreman, Lewis. “Book Reviews.” Recorded Sound no. 69 (January 1978): 769. Review of Frederick Delius by Thomas Beecham (see no. 843), Delius: Portrait of a Cosmopolitan (see no. 863), and A Delius Companion (see no. 59).

1350. Hindmarsh, Paul. “Recent Books on British Music: Delius and His Contemporaries.” British Book News (August 1980): 453–458. This section covers the following books: Delius: Portrait of a Cosmopolitan (see no. 863), A Delius Companion (see no. 59), Warlock and Delius (see no. 984), Flecker and Delius: The Making of Hassan (see no. 1662), Catalogue of the Music of Frederick Delius (see no. 33), A Catalogue of the Archives of the Delius Trust (see no. 31), and Delius: A Life in Pictures (see no. 847).

1351. Hutchings, Arthur. “Reviews of Books.” Music and Letters 59 (July 1978): 339–340. Review of A Catalogue of the Compositions of Frederick Delius by Robert Threlfall (see no. 33) and Delius: A Life in Pictures by Lionel Carley and Robert Threlfall (see no. 847).

1352. Hutchings, Arthur. “Songs of Exile.” TLS: Times Literary Supplement no. 3945 (4 November 1977): 1305. Reviews of Delius: Portrait of a Cosmopolitan (see no. 863) and A Delius Companion (see no. 59).

1353. Lloyd, Stephen. “Book and Record Reviews.” Delius Society Journal no. 93 (1987): 14–15. Reviews of Rachel Lowe’s Frederick Delius 1862–1934: A Reprint of the Catalogue of the Music Archive of the Delius Trust (1974) with Minor Corrections (see no. 32) and Robert Threlfall’s Frederick Delius: A Supplementary Catalogue (see no. 35).

1354. MacDonald, Calum. “Books.” Tempo no. 125 (June 1978): 30–31. Reviews of Delius: A Life in Pictures by Lionel Carley and Robert Threlfall (see no. 847) and A Catalogue of the Compositions of Frederick Delius: Sources and References by Robert Threlfall (see no. 33).

1355. Oliver, Michael. “Bookshelf.” Gramophone 61 (March 1984): 1111. Review of Delius: A Life in Letters, Volume 1, 1862–1908 (see no. 10) and Frederick Delius and Edvard Munch (see no. 14). Bibliography 245

1356. Palmer, Christopher. “A Composer’s Archive.” TLS: Times Literary Supplement no. 3858 (20 February 1976): 192. Reviews of Frederick Delius, 1862–1934: A Catalogue of the Music Archive of the Delius Trust, London (see no. 31) and Delius: The Paris Years (see no. 846).

1357. Payne, Anthony. “Delius.” Music and Musicians 20 (August 1972): 41–42. Reviews the biographies by Eric Fenby (see no. 849) and Alan Jefferson (see no. 860).

1358. R. C. “Reviews of Books.” Music and Letters 33 (July 1952): 256–257. Review of The Songs of Delius by A. K. Holland (see no. 1602) and Frederick Delius by Philip Heseltine (see no. 855).

Individual Titles (Arranged by Author)

Beecham, Thomas. Frederick Delius. [842] 1359. “Reviews.” Musical Courier 163 (February 1961): 36.

1360. Chennell, Paul. “Retrospective Book Review: Frederick Delius, by Thomas Beecham.” Delius Society Journal no. 140 (2006): 115–116.

1361. Fenby, Eric. “Beecham Crowns his Service to Delius.” Music and Musicians (December 1959): 11. Reprint, Lloyd, Stephen, ed. Fenby on Delius (see no. 58), pp. 47–50.

1362. Hope-Wallace, Philip. “Frederick Delius by Sir Thomas Beecham.” The Listener 63 (7 January 1960): 35.

1363. Howes, F. S. “Composed by the Conductor.” TLS: Times Literary Supplement no. 3011 (13 November 1959): 658.

1364. Hutchings, Arthur. “Frederick Delius.” Music and Letters 41 (1960): 164–167.

1365. Lichtenwanger, William. “Frederick Delius.” Notes 17 (September 1960): 574–575.

1366. Pirie, Peter J. “Book Reviews.” Music Review 21, no. 2 (1960): 151–154. 246 Frederick Delius: A Research and Information Guide

1367. Rutland, Harold. “Books and Scores for Christmas.” Musical Times 100 (December 1959): 653.

1368. Stevenson, Ronald. “Book Reviews.” Chesterian 34, no. 202 (1960): 132–135.

Beecham, Thomas. Frederick Delius. Rev. ed. [843] 1369. Redwood, Christopher. “Book Review.” Delius Society Journal no. 50 (1976): 24–26.

Cahill, Mary. Delius in Danville. [844] 1370. Lloyd, Stephen. “Reviews.” Delius Society Journal no. 90 (1986): 18–19.

Carley, Lionel. Delius: A Life in Letters, 2 vols. [10]

VOLUME 1

1371. “Delius: A Life in Letters, 1862–1908.” Grainger Society Journal 5, no. 2 (1983): 24.

1372. “Delius: A Life in Letters Volume I.” Punch (27 June 1984): 62.

1373. “Delius: A Life in Letters. Vol. 1.” Choice 21(June 1984): 1474.

1374. Boyle, Andrew J. “Book Reviews.” Delius Society Journal no. 82 (1984): 11–13.

1375. Diamond, Harold. “Delius: A Life in Letters Volume I, 1862–1908.” Notes 41 (December 1984): 277–278.

1376. East, John Michael. “Delius: A Life Begins to Unfold.” Composer no. 81 (1984): 23–26.

1377. Foreman, Lewis. “In Touch with Europe.” TLS: Times Literary Supplement no. 4224 (16 March 1984): 281.

VOLUME 2

1378. “Delius: A Life in Letters. Vol. 2.” Choice 26 (January 1989): 815.

1379. Anderson, Robert. “Delius’s Letters.” Musical Times 130 (January 1989): 23–24. Bibliography 247

1380. Gillespie, Don C. “Delius: A Life in Letters Vol. 2, 1909–1934.” Notes 46 (September 1989): 71–74.

1381. Lloyd, Stephen. “Book and Record Reviews.” Delius Society Journal no. 98 (1988): 10–12.

1382. Mellers, Wilfrid. “A Song of Himself.” TLS: Times Literary Supplement no. 4481 (17 February 1989): 161.

1383. Reynolds, Peter. “Book Review.” Tempo no. 172 (March 1990): 34–36.

Carley, Lionel. Delius: The Paris Years. [845] 1384. Hutchings, Arthur. “Delius: The Paris Years.” Music and Letters 57 (April 1976): 184–186.

1385. Payne, Anthony. “Delius—The Paris Years.” Tempo no. 114 (September 1975): 33–34.

Carley, Lionel. Frederick Delius: Music, Art, and Literature. [56] 1386. “Frederick Delius: Music, Art, and Literature.” Classical Music no. 612 (1 August 1998): 27.

1387. “Music.” Reference & Research Book News 13 (November 1998): 172.

1388. Anderson, Robert. “Well Flirted.” Musical Times 139, no. 1865 (winter 1998): 64–65.

1389. Buckley, Roger. “Book Review.” Delius Society Journal no. 124 (1998): 55–62.

1390. Chase, Jeffrey K. “Book Reviews.” The Diapason 98 (January 2007): 17.

1391. Frogley, Alain. “Frederick Delius: Music, Art and Literature.” Music and Letters 80 (November 1999): 644–646.

1392. Jones, Philip. “Frederick Delius: Music, Art and Literature.” Notes 55, no. 4 (June 1999): 933–934.

1393. Matthew-Walker, Robert. “Book Reviews.” Musical Opinion 121 (1998): 295.

1394. Turbet, Richard. “Book Reviews.” Brio 36 (1999): 72–74. 248 Frederick Delius: A Research and Information Guide

Carley, Lionel. Grieg and Delius: A Chronicle of their Friendship in Letters. [11] 1395. Anderson, Robert. “Reviews: Books.” Musical Times 135 (March 1994): 163.

1396. Buckley, Roger. “Book Reviews.” Delius Society Journal no. 115 (1994): 17–20.

1397. Cai, C. “Grieg and Delius: A Chronicle of their Friendship in Letters.” Choice 31, no. 10 (June 1994): 1590–1591.

1398. Foreman, Lewis. “Book Reviews.” Tempo no. 190 (1994): 62–63.

1399. Matthew-Walker, Robert. “Grieg and Delius: A Chronicle of their Friendship in Letters.” Musical Opinion 117 (March 1994): 94.

1400. Mellers, Wilfrid. “Grieg and Delius: A Chronicle of their Friendship in Letters.” TLS: Times Literary Supplement no. 4735 (31 December 1993): 14–15.

1401. Perone, James E. “Grieg and Delius: A Chronicle of their Friendship in Letters.” Library Journal 118 (15 October 1993): 67.

1402. Weinstock, John. “Grieg and Delius: A Chronicle of their Friendship in Letters.” Notes 51 (March 1995): 942–943.

Carley, Lionel, and Robert Threlfall. Delius: A Life in Pictures. [846] 1403. “Delius—A Life in Pictures.” Australian Journal of Music Education no. 22 (April 1978): 68.

1404. Bellingardi, Luigi. “I libri.” Nuova Rivista Musicale Italiana 13 (1979): 705–706.

1405. Boulton, John. “Book Reviews.” Music Review 39 (1978): 63–64.

1406. Fenby, Eric. “Composer Who Loved Solitude.” Books and Bookmen 23, no. 6 (March 1978): 36–37. Reprint, Lloyd Stephen, ed. Fenby on Delius (see no. 58), pp. 98–102.

1407. Fenton, John. “Books Reviewed.” Music Teacher 64 (January 1985): 29. [Review of paperback edition.] Bibliography 249

1408. Hollander, Hans. “Lionel Carley/Robert Threlfall: Delius, a Life in Pictures.” Das Orchester 26 (June 1978): 501.

1409. Hurd, Michael. “Books.” Music in Education 42, no. 390 (1978): 86.

1410. Redwood, Christopher. “Book Review.” Delius Society Journal no. 57 (1977): 25.

Delius, Clare. Frederick Delius. [848] 1411. Colles, H. C. “Frederick Delius in His Family.” TLS: Times Literary Supplement no. 1761 (2 November 1935): 688.

Fenby, Eric. Delius. [849] 1412. “Book Browsing.” Music Educators Journal 59 (February 1973): 79.

1413. “Delius.” Kirkus Reviews (15 August 1972): 951.

1414. “Delius.” Library Journal (15 December 1972): 4071.

1415. “Two Composers.” TLS: Times Literary Supplement (22 October 1971): 1326.

1416. Canarina, John. “Books.” Tempo no. 102 (1972): 35–36.

1417. Palmer, Christopher. “Delius Illuminated.” Musical Times 112 (October 1971): 965–966.

Fenby, Eric. Delius As I Knew Him (1936, reprinted 1948, 1975). [850] 1418. “Delius As I Knew Him.” Musical Opinion (December 1936): 216.

1419. Abraham, Gerald. “Delius as I Knew Him.” Music and Letters 18 (January 1937): 80–81.

1420. Chennell, Paul. “Retrospective Book Review: ‘Delius as I Knew Him,’ by Eric Fenby.” Delius Society Journal no. 138 (2005): 114–115.

1421. Colles, H. C. “Delius’s Amanuensis.” TLS: Times Literary Supplement no. 1813 (31 October 1936): 879.

1422. H. G. “The Musician’s Bookshelf.” Musical Times 77, no. 1125 (November 1936): 999–1000. 250 Frederick Delius: A Research and Information Guide

Fenby, Eric. Delius as I Knew Him. Rev. ed. (1966) [851] 1423. “Delius as I Knew Him.” Choice 5 (May 1968): 352.

Fenby, Eric. Delius as I Knew Him. New and rev. ed. (1981) [852] 1424. “Books.” High Fidelity 32 (May 1982): MA25.

1425. “Delius as I Knew Him.” Choice 19 (June 1982): 1412.

1426. Horton, John. “Delius as I Knew Him.” Music Teacher 61 (January 1982): 29.

Gillespie, Don. The Search for Thomas F. Ward, Teacher of Frederick Delius [959] 1427. Faulkner, Helen. “Book Reviews.” Delius Society Journal 119 (1996): 49–50.

1428. Henry, Barbara. “The Search for Thomas F. Ward, Teacher of Frederick Delius.” Notes 53 (March 1997): 801–803.

1429. Lister, Michael. “Book Reviews.” Tempo no. 205 (1998): 36–37.

1430. McNally, Michael J. “Book Reviews: American.” Catholic Historical Review 83 (July 1997): 519–520.

1431. Sutton, Vern. “The Search for Thomas F. Ward, Teacher of Frederick Delius by Don C. Gillespie.” Bulletin for the Society for American Music 26 (summer–fall 2000): 76–77.

+HDOH\'HUHN7KH,QÀXHQFHRI$IULFDQ$PHULFDQ0XVLFRQWKH:RUNV of Frederick Delius. [964] 1432. Redwood, Christopher. “Book Review.” Delius Society Journal no. 134 (2003): 69–71.

Heseltine, Philip. Frederick Delius. (1923) [853] 1433. Bennett, Rodney. “Music.” The Bookman 65, no. 386 (1923): 126–128.

1434. C. “The Musician’s Bookshelf.” Musical Times 64 (November 1923): 778–779.

1435. Fox-Strangways, Arthur Henry. “A Study of Delius.” TLS: Times Literary Supplement no. 1133 (4 October 1923): 651. Bibliography 251

Heseltine, Philip. Frederick Delius. Rev. ed. (1952) [854] 1436. “Books: Delius.” Canon 5 (June 1952): 540.

1437. “Frederick Delius.” Etude 71 (January 1953): 6.

1438. “Frederick Delius.” Music Teacher 31 (June 1952): 291.

1439. “Frederick Delius.” Musical Opinion 75 (August 1952): 665.

1440. “Reviews.” Musical Courier 146 (15 November 1952): 30.

1441. Bradbury, Ernest. “Frederick Delius.” Musical Times 93 (September 1952): 403–404.

1442. Haddon Squire, W. H. “Delius and Warlock.” Tempo no. 26 (1952–1953): 37–38.

1443. Howes, F. S. “Delius the Man and the Musician.” TLS: Times Literary Supplement no. 2625 (23 May 1952): 343.

 .LPPHO:LOOLDP³%ULHÀ\1RWHG´Notes 9 (September 1952): 615–616.

1445. R. S. “Books.” Musical America 73 (1 December 1953): 31.

Holland, Arthur Keith. The Songs of Delius. [1601]. 1446. “Book Reviews.” Chesterian 26 (January 1952): 63.

1447. “The Musician’s Bookshelf.” Musical Times 93 (March 1952): 115.

1448. “New Books.” Monthly Musical Record 82 (February 1952): 46.

1449. A. H. “New Books Received.” Music Teacher 30 (1951): 571.

1450. H. H. “Delius as Song Composer.” Musical Opinion 75 (January 1952): 217–218.

 .DJHQ6HUJLXV³%ULHÀ\1RWHG´Notes 9 (1952): 290.

1452. Robson, Dorothy. “Book Reviews.” Music Review 13 (February 1952): 62.

1453. W. V. “New Books.” Music Parade 2, no. 11 (1952): 21. 252 Frederick Delius: A Research and Information Guide

Hutchings, Arthur. Delius. [857] 1454. “Books.” Canon 2, no. 4 (November 1948): 161.

1455. “The Musician’s Bookshelf.” Musical Times 89 (April 1948): 115.

1456. Haddon Squire, W. H. “Delius and Nietzsche.” Tempo no. 7 (spring 1948): 27–30.

Jahoda, Gloria. The Road to Samarkand: Frederick Delius and His Music. [858] 1457. Coveney, John. “The Musical World of Frederick Delius: Magic and Mystery.” American Record Guide 36 (May 1970): 712–720.

1458. Finn, Robert. “Book Review.” Le Grand Baton 6 (1969): 62–63.

1459. Redwood, Christopher. “The Road to Samarkand by Gloria Jahoda.” Delius Society Newsletter no. 34 (1972): 4–6.

Jefferson, Alan. Delius. [859] 1460. “Book Browsing.” Music Educators Journal 65 (December 1978): 97.

1461. “Delius.” Choice 10 (June 1973): 632.

1462. “Delius Delayed.” TLS: Times Literary Supplement no. 3655 (17 March 1972): 294.

1463. Anderson, W. R. “New Books Reviewed.” Music Teacher 52 (February 1973): 37.

1464. Hurd, Michael. “Reviews: Books.” Music in Education 36 (1972): 139–140.

1465. Palmer, Christopher. “Earthbound Delius.” Musical Times 113 (May 1972): 460.

Jenkins, Lyndon. While Spring and Summer Sang: Thomas Beecham and the Music of Frederick Delius [860] 1466. Cairns, David. “Reviews: Books.” Gramophone 83, no. 1005 (2006): 115.

1467. Lloyd-Jones, David. “Book and CD Reviews.” Delius Society Journal no. 139 (2006): 138–141. Bibliography 253

1468. Talbot, John. “Books.” Tempo 60, no. 237 (2006): 76–77. Reprint, “Bookshelf.” British Music Society News no. 109 (2006): 26–27.

Jenkins, Lyndon and Paul Guinery. Delius & Fenby – A Photographic Journey [861] 1469. Lee-Browne, Martin. “Book, Recording, & Exhibition Reviews: “Delius & Fenby – A Photographic Journey,” by Lyndon Jenkins and Paul Guinery.” Delius Society Journal no. 137 (2005): 90.

Jones, Philip, ed. The Collected Writings of the German Musicologist Max Chop on the Composer Frederick Delius. [57] 1470. “Music.” Reference & Research Book News 17 (May 2002): 173.

1471. Buckley, Roger. “Book Reviews.” Delius Society Journal no. 132 (2002): 81–83.

Lloyd, Stephen. Fenby on Delius: Collected Writings on Delius to Mark Eric Fenby’s Ninetieth Birthday. [58] 1472. Green, Andrew. “Books.” Classical Music (3 August 1996): 4.

1473. Jenkins, Lyndon. “Book Reviews.” Delius Society Journal no. 119 (1996): 50–51.

1474. Matthew-Walker, Robert. “Book Review.” Musical Opinion 119 (1996): 177.

1475. Swain, Jonathan. “Being There.” Gramophone 75, no. 893 (October 1997): 24.

Lowe, Rachel. A Descriptive Catalogue with Checklist of the Letters and Related Documents in the Delius Collection of the Grainger Museum. [30] 1476. “Delius Collection of the Grainger Museum.” Grainger Society Journal 4 (1981): 22–23.

1477. “Review of Rachel Lowe, A Descriptive Catalogue with Checklist of the Letters and Related Documents in the Delius Collection of the Grainger Museum.” Studies in Music no. 15 (1981): 141–143.

1478. Anderson, Robert. “Delius Down Under.” Musical Times 122, no. 1662 (August 1981): 537–538. 254 Frederick Delius: A Research and Information Guide

1479. Diamond, Harold. “A Descriptive Catalogue with Checklist of the Letters and Related Documents in the Delius Collection of the Grainger Museum.” Notes 38, no. 2 (December 1981): 317–318.

1480. Finnissy, Michael. “Chronicle of a Friendship.” Composer no. 73 (1981): 25.

1481 Lloyd, Stephen. “Book Review.” Delius Society Journal no. 71 (1981): 21–22.

Lowe, Rachel. Frederick Delius, 1862–1934: A Catalogue of the Music Archive of the Delius Trust, London. [31] 1482. Bartlett, Clifford. “Reviews.” Brio 12 (1975): 20–21.

1483. Dunkley, Sally. “Frederick Delius 1862–1934, A Catalogue of the Music Archive of the Delius Trust.” Tempo no. 114 (September 1975): 34–35.

1484. Gillespie, Don C. “Frederick Delius, 1862–1934.” Notes 32 (March 1976): 547–548.

1485. Westrup, J. A. “Reviews of Books.” Music and Letters 56 (1975): 407– 408

Montgomery, Robert. Music and Copyright: The Case of Delius and His Publishers. [12] 1486. Lee-Browne, Martin. “Book Review.” Delius Society Journal no. 142 (2007): 139.

1487. Summers, Tony. “Book Review.” Delius Society Journal no. 143 (2008): 132–134.

Palmer, Christopher. Delius: Portrait of a Cosmopolitan. [861] 1488. “Books: Cosmopolitan.” The Economist (US) (17 July 1976): 113.

1489. “Delius: Portrait of a Cosmopolitan.” Choice 14 (April 1977): 214.

1490. “Delius: Portrait of a Cosmopolitan.” New Statesman (28 January 1977): 126.

Redwood, Christopher. A Delius Companion. [59] 1491. “Book Reviews.” Musical Opinion 99 (July 1976): 474. Bibliography 255

1492. Anderson, W. R. “Books Reviewed.” Music Teacher 55 (December 1976): 27.

1493. Boulton, John. “Book Reviews.” Music Review 38 (1977): 71–72.

1494. Jenkins, Lyndon. “Book Review.” Delius Society Journal no. 51 (1976): 15–17.

REVISED EDITION:

1495. “A Delius Companion.” Choice 15 (February 1978): 1655.

1496. “A Delius Companion.” Opera Journal 11 (1978): 24–28.

1497. Leighton Thomas, A. F. “Paperbacks.” Music Review 45 (1984): 304– 309.

Redwood, Dawn. Flecker and Delius: The Making of Hassan. [1611] 1498. Anderson, Robert. “Hassan.” Musical Times 119, no. 1629 (November 1978): 959.

1499. Biermann, David. “Books.” Music in Education 42, no. 399 (1978): 455.

1500. Mackerness, E. D. “Reviews.” Notes and Queries 27, no. 6 (1980): 563–564.

1501. Foreman, Lewis. “Book Review.” Delius Society Journal no. 59 (1978): 17–18.

1502. Foreman, Lewis. “Book Reviews.” Gramophone 56 (January 1979): 1272–1276.

Smith, Barry. Frederick Delius and Peter Warlock: A Friendship Revealed. [13] 1503. Anderson, Robert. “The Soul of the Thing.” TLS: Times Literary Supplement no. 5094 (17 November 2000): 11.

1504. Bishop, John. “Book Reviews.” Delius Society Journal no. 127 (2000): 61–62.

1505. Dibble, Jeremy. “Frederick Delius and Peter Warlock: A Friendship Revealed.” Notes 58 (September 2001): 97–98. 256 Frederick Delius: A Research and Information Guide

1506. Hutchings, Arthur. “Warlock and Delius.” Music and Letters 59 (January 1978): 61–62.

1507. Metcalfe, W. “Frederick Delius and Peter Warlock: A Friendship Revealed.” Choice 38, no. 4 (December 2000): 716.

1508. Ponsonby, Robert. “Reviews: Books.” BBC Music Magazine 9 (November 2000): 117–118.

Smith, John B. Frederick Delius & Edvard Munch. [14] 1509. “Frederick Delius & Edvard Munch.” Punch (27 June 1984): 62.

1510. Fenton, John. “Book Reviews.” Music Teacher 65 (June 1986): 37.

1511. Hodin, J. P. “Reviews.” Scandinavica 23 (1984): 182–183.

1512. Kitching, R. B. “Book Reviews.” Delius Society Journal no. 82 (1984): 16–17.

1513. Swanston, Roderick. “Frederick Delius & Edvard Munch.” Royal College of Music Magazine 80 (1984): 150–151.

1514. Vinten-Johansen, Peter. “Reviews.” Scandinavian Studies 59 (1987): 461–462.

Threlfall, Robert. A Catalogue of the Compositions of Frederick Delius. [33] 1515. Bartlett, Clifford. “Reviews.” Brio 14 (1977): 53–54.

1516. Chadwick, Nick. “Reviews.” Fontes Artis Musicae 26 (1979): 66–67.

1517. S. S. “Book Review.” Delius Society Journal no. 58 (1977): 22–23.

Threlfall, Robert. A Check-list of Printed Editions of the Stage Works by Frederick Delius. [34] 1518. Redwood, Christopher. “Book Reviews.” Delius Society Journal no. 133 (2003): 55.

Threlfall, Robert. Frederick Delius: A Supplementary Catalogue. [35]  %DQ¿HOG 6WHSKHQ ³Frederick Delius: A Supplementary Catalogue.” Music & Letters 69 (April 1988): 286–287. Bibliography 257

Threlfall, Robert. Delius’ Musical Apprenticeship: Incorporating a Survey of the Leipzig Notebooks. [982] 1520. Redwood, Christopher. “Book and Record Reviews.” Delius Society Journal no. 117 (1995): 25–26.

Threlfall, Robert. Frederick Delius: A Musical Notebook [983] 1521. Lloyd, Stephen. “Reviews.” Delius Society Journal no. 112 (1993): 9.

Tomlinson, Fred. Warlock and Delius. [982] 1522. Hutchings, Arthur. “Reviews of Books.” Music and Letters 59 (1978): 61–62.

1523. Lloyd, Stephen. “Book Review.” Delius Society Journal no. 53 (1976): 14–15.

Wilson, Jane. C. W. Orr, The Unknown Song-Writer: Including the Complete Delius–Orr Correspondence. [15] 1524. Hoare, Geoffrey. “No Orrdiences?” Delius Society Journal no. 104 (1990): 10–12.

1525. Hold, Trevor. “Mismatch.” Musical Times 132 (April 1991): 197.

1526. Smith, Mike. “Book Reviews.” Tempo no. 174 (1990): 64–66.

Genre Studies and Studies of Multiple Works

Dramatic Works

Reference Sources: Dictionaries and Encyclopedias 1527. “Delius, Frederick.” In The Metropolitan Opera Encyclopedia: A Comprehensive Guide to the World of Opera, edited by David Hamilton, p. 101. New York: Simon and Schuster, 1987. Also published: London: Thames and Hudson, 1987. ISBN 067161732X. ML 102.O6 M47 1987. Presents a brief biographical sketch and survey of Delius’s operas. There are separate entries for Irmelin, Koanga, and A Village Romeo and Juliet. These entries contain basic production and premiere information and synopsis.

1528. Anderson, Robert. “Delius, Frederick [Fritz] (Theodore Albert).” In The New Grove Dictionary of Opera, edited by Stanley Sadie, Vol. 1, pp. 1111–1112. London: Macmillan, 1992. Also published: New York: 258 Frederick Delius: A Research and Information Guide

Grove’s Dictionaries of Music, 1992. ISBN 0333485521. ML 102.O6 N5 1992. The entry for Delius includes an overview of his life and operas, a list of the operas, and a selective bibliography (nine titles). There are also separate entries for all six operas. Each of these entries provides information on the production, performance history, and an in-depth synopsis.

1529. Dahlhaus, Carl, ed. “Frederick Delius.” In Pipers Enzyklopädie des Musiktheaters, Vol. 1, pp. 705–707. Munich: Piper, 1997. ISBN 3492024114. ML 102.O6 P5 1986. Contains information on the text, performances, characters, orchestration, duration, manuscript location, score editions, origin, commentary, bibliography, and plot synopsis for Fennimore and Gerda, Koanga (by Nigel Burton), and A Village Romeo and Juliet (by Michael Hurd). In German.

1530. Ewen, David. “Delius, Frederick.” In The New Encyclopedia of the Opera, pp. 171–172. New York: Hill and Wang, 1971. First published, Encyclopedia of the Opera. New York: A. A. Wyn, 1955. ISBN 0809072629. ML 102.O6 E9 1971. Presents a brief biographical sketch and list of operas. There are separate entries for Fennimore and Gerda, Irmelin, Koanga, and A Village Romeo and Juliet. These entries include a description of the opera, librettist, VRXUFHRIWH[W¿UVWSHUIRUPDQFHDQGDEULHIV\QRSVLV

1531. Griffel, Margaret Ross. Operas in English: A Dictionary. Westport, Conn: Greenwood Press, 1999. xxviii, 978 p. ISBN 0313253102. ML 102.O6 G74 1999. Five of Delius’s operas (Margot la Rouge is omitted) are represented in this dictionary of operas by composers who were born in or worked in an English-speaking country. The operas are listed in a single alphabetical sequence, and entries contain details about the production, a brief synopsis, availability of musical scores, a bibliography, and a discography. Appendices include lists of composers, librettists, authors/ sources, and a chronology. There is a selective bibliography, and indexes of characters and names.

1532. Kuhn, Laura. “Delius, Frederick (Fritz Theodor Albert).” In Baker’s Dictionary of Opera, pp. 173–174. New York: Schirmer, 2000. ISBN 0028653491. ML 102.O6 B26 2000. Bibliography 259

The entry for Delius includes a survey of his life and works, a works list (limited to dramatic works), and bibliography. There are also separate entries for four of the six operas (omitting The Magic Fountain and Fennimore and Gerda); these entries include synopses.

1533. Warrack, John, and Ewan West. “Delius, Frederick.” In Oxford Dictionary of Opera, p. 182. Oxford: Oxford University Press, 1992. ISBN 0198691645. ML 102.O6 W37 1992. A brief discussion of the operas. The opera list includes information on the title, libretto, date of composition, and production. The bibliography section includes reference to the catalog by Robert Threlfall, and three other titles.

Reference Sources: Miscellaneous 1534. Boldrey, Richard. Guide to Operatic Roles and Arias. Dallas: Pst Inc., 1994. xiii, 554 p. ISBN 1877761648. ML 102.O6 B65 1994. This book includes three roles from A Village Romeo and Juliet (The Dark Fiddler, Sali, and Vreli). There are indexes of roles, voice categories, singers (notable performers), and composers.

1535. Bourne, Joyce. Who’s Who in Opera: A Guide to Opera Characters. Oxford: Oxford University Press, 1998. xviii, 457 p. ISBN 0192100238. ML 102.O6 B68 1998. Characters from A Village Romeo and Juliet and Fennimore and Gerda are included in this book. The character entries give the opera title and FRPSRVHUQDPHRIWKH¿UVWSHUIRUPHURIWKHUROHDQGGDWHDQGDEULHI description of the character.

1536. Boyden, Matthew. “Frederick Delius.” In The Rough Guide to Opera, edited by Joe Staines, pp. 405–409. London: Rough Guides, 2002. ISBN 1858287499. ML 156.4.O46 B69 2002. ,QFOXGHVDELRJUDSKLFDOSUR¿OHIROORZHGE\VHSDUDWHVHFWLRQVRQA Village Romeo and Juliet and Fennimore and Gerda. These sections include a synopsis, discussion of the opera, and an overview of recordings.

1537. Drone, Jeanette Marie. Index to Opera, Operetta, and Musical Comedy Synopses in Collections and Periodicals. Metuchen, N.J.: Scarecrow, 1978. x, 171 p. ISBN 0810811006. ML 128.04 D76 1978. Supplement, Musical Theater Synopses: An Index. Lanham, Md.: Scarecrow, 1998. 441 p. ISBN 0810834898. ML 128.O4 D76 Suppl. 260 Frederick Delius: A Research and Information Guide

Includes citations to synopses for Irmelin, Koanga, The Magic Fountain, and A Village Romeo and Juliet. The supplement contains entries for all six of Delius’s operas, plus Antony Tudor’s ballet The Tragedy of Romeo and Juliet.

1538. Eaton, Quaintance. Opera Production: A Handbook. 2 vols. Minneapolis: University of Minnesota Press, 1974. Reprint, New York: Da Capo, 1974. ISBN 0816606897. MT 955.E25. 3URYLGHVSURGXFWLRQLQIRUPDWLRQ FRPSRVHUOLEUHWWR¿UVWSHUIRUPDQFH description, setting, number of acts/scenes, lists of major and lesser roles, chorus, orchestration, publication, and synopsis) for Irmelin, Koanga, and A Village Romeo and Juliet.

1539. Harewood, George Henry Hubert Lascelles. “Frederick Delius.” In Kobbé’s Complete Opera Book, edited by George Henry Hubert Lascelles Harewood, pp. 1113–1119. London: Bodley Head, 1987. ISBN 0370310179. MT 95.K52 1987. Includes production information, list of characters, background information, and synopsis for Koanga and A Village Romeo and Juliet.

1540. Loewenberg, Alfred. Annals of Opera 1597–1940. 3rd ed. London: J. Calder, 1978. xxv, 1756 columns. Also published Totowa, N.J.: Rowman DQG/LWWOH¿HOG0/2/ This work, originally published in 1943, is a chronological listing of operas, 1597–1940. Three operas by Delius are included: Koanga, A Village Romeo and Juliet, and Fennimore and Gerda. Entries for the operas include information on the libretto, performances, and a brief description of the opera. There are indexes for the composers and operas, as well as a general index.

1541. Martens, Frederick H. A Thousand and One Nights of Opera. New York: D. Appleton, 1926. MT 95.M23. Narrative description and synopses of Fennimore and Gerda, Koanga, and A Village Romeo and Juliet.

1542. Martin, Nicholas Ivor. The Da Capo Opera Manual. New York: Da Capo Press, 1997. xxxvi, 676, xxxiv p. ISBN 0306808072. ML 102.O6 M35 1997. There are entries for Irmelin, The Magic Fountain, and A Village Romeo and Juliet that provide information on composer, dates, librettist, Bibliography 261

premiere, type of work, settings, major roles, chorus parts and roles, dance roles, orchestration, publisher, performance rights, and synopsis.

1543. Northouse, Cameron. Twentieth Century Opera in England and the United States. Boston: G. K. Hall, 1976. viii, 400 p. ISBN 0816178968. ML 128.O4 N7 1976. Delius’s operas (except for The Magic Fountain) are included in this FKURQRORJLFDO OLVWLQJ RI ¿UVW SHUIRUPDQFHV RI (QJOLVK DQG $PHULFDQ operas. Includes separate lists of operas based on literary works, and published operas.

1544. Parsons, Charles H. Mellen Opera Reference Index. 20 vols. Lewiston, N.Y.: Edwin Mellen Press, 1986. ISBN 0889464014. ML 102.O6 P25 1986. This comprehensive opera reference work includes volumes on composers, librettists, premieres (and reassessments), subjects, discography, bibliography, and videography. Delius is represented throughout.

1545. Rieck, Waldemar. Opera Plots. New York: New York Public Library, 1927. 102 p. ML 128.L4 R4. Contains entries for A Village Romeo and Juliet, Fennimore and Gerda, and Koanga.

1546. Sharp, Harold S., and Marjorie Z. Sharp. Index to Characters in the Performing Arts. 4 vols. Metuchen, N.J.: Scarecrow Press, 1969–1972. PN 1579.S45. Part 2 (Operas) includes characters from Fennimore and Gerda, Koanga, and A Village Romeo and Juliet.

1547. Stieger, Franz. “Frederick Delius.” In Opernlexikon, Vol. 1, p. 257. Tutzing: H. Schneider, 1975–1983. ISBN 3795201659. ML 102.O6 S8. Koanga, A Village Romeo and Juliet, Margot la Rouge, and Fennimore and Gerda are covered in this work. Each entry includes information on WKHOLEUHWWR¿UVWSHUIRUPDQFHDQGRSXVQXPEHU,Q*HUPDQ

1548. Studwell, William, and David A. Hamilton. Opera Plot Index: A Guide to Locating Plots and Descriptions of Operas, Operettas, and Other Works of the Musical Theater, and Associated Material. Garland Reference Library of the Humanities. New York: Garland, 1990. xxi, 466 p. ISBN 0824046218. ML 128.O4 S8 1989. 262 Frederick Delius: A Research and Information Guide

Includes citations to sources containing plot synopses for three of Delius’s operas (Irmelin, Koanga, and A Village Romeo and Juliet).

1549. White, Eric Walter. A Register for First Performances of English Operas and Semi-Operas from the 16th Century to 1980. London: Society for Theatre Research, 1983. vi, 130 p. ISBN 0854300368. ML 1731.W59 1983. 7KLVFKURQRORJLFDOOLVWRI¿UVWSHUIRUPDQFHVLQFOXGHVIRXURI'HOLXV¶V operas. Includes basic information on each opera.

Monographs and Chapters 1550. Aprahamian, Felix. “Delius.” In The Decca Book of Opera, pp. 159–164. London: T. Werner Laurie, 1956. MT 95.D43. An introduction to the operas followed by synopses of Irmelin, Koanga, and A Village Romeo and Juliet.

1551. Corsaro, Frank. “The Dormant Masterworks of Frederick Delius, Koanga and A Village Romeo and Juliet.” In Maverick: A Director’s Personal Experience in Opera and Theater, pp. 154–165. New York: Vanguard Press, 1978. ISBN 0814907903. ML 3858.C67. Corsaro describes his experiences with productions of both operas with the Opera Society of Washington. The production of Koanga in December 1970 was the American premiere of the work.

1552. Dace, Wallace. “Summer Night on the River: Frederick Delius.” In Opera as Dramatic Poetry, pp. 1–11. New York: Vantage Press, 1993. ISBN 0533104130. ML 3858.D33 1993. Investigates the response of four composers (Delius, Ferruccio Busoni, Arnold Schoenberg, and Alban Berg) to Richard Wagner’s idea that the composer must write his own libretto. The author makes an assessment RIWKHFRPSRVHU¶VOLWHUDU\WDOHQWDQGWULHVWRGHWHUPLQHWKHVLJQL¿FDQFHRI these talents vis-à-vis the creation of their works. The bulk of the chapter on Delius focuses on A Village Romeo and Juliet, although there is some discussion of Fennimore and Gerda at the end of the chapter. Includes a bibliography and an index.

1553. May, Robin. “Delius, Frederick.” In A Companion to the Opera, p. 51. New York: Hippocrene Books, 1977. Also published: Guildford: Lutterworth Press, 1977; London: Hamlyn, 1987. ISBN 388254439X. ML 102.O6 M37 1977. Bibliography 263

Gives a list of Delius’s staged operas along with their production history.

1554. Redwood, Christopher. “Delius as a Composer of Opera.” In A Delius Companion, edited by Christopher Redwood, pp. 217–238. London: J. Calder, 1976. Reprint, New York: Da Capo, 1977; New York: Riverrun Press, 1980. ISBN 0714535265. ML 410.D35 D44. Survey of Delius’s six operas.

1555. Teasdale, May Silva. Twentieth Century Opera at Home and Abroad. New York: E. P. Dutton, 1938. Reprint, Handbook of Twentieth Century Opera: Twentieth Century Opera at Home and Abroad, New York: Da Capo, 1976. ML 1705.T26 T9. Provides brief information on the premiere, source of text, libretto, setting, and synopsis for Koanga and A Village Romeo and Juliet.

Articles 1556. Arblaster, Anthony. “Musical Adventurers.” Opera 56 (June 2005): 655–660. A survey of the late nineteenth and early twentieth century, featuring works by Delius, Gustav Holst, Ethel Smyth, Ralph Vaughan Williams, and Charles Villiers Stanford.

1557. Forbes, Elizabeth. “Seven English Composers.” About the House 5, no. 10 (1979): 70. Delius’s six operas appear in this list of operas by English composers. ,QFOXGHVLQIRUPDWLRQRQWKHOLEUHWWLVWDQG¿UVWSHUIRUPDQFHRIHDFKZRUN

1558. Hutchings, Arthur. “Delius’s Operas.” Tempo no. 26 (1952–1953): 22– 29. Survey. Includes musical examples.

1559. Klein, John W. “Delius as a Musical Dramatist.” Music Review 22 (November 1961): 294–301. A discussion of Delius’s stage works. The author feels that the operas, in particular, suffer “persistent neglect.”

1560. Meyer, Andreas K. W. “Beginn einer Renaissance? Frederick Delius’ Opern in Deutschland am Ende des 20. Jahrhunderts.” Opernwelt Jahrbuch, 1997 (1997): 110–118. Reprint, “The Beginning of a Renaissance? The Operas of Frederick Delius in Germany at the End of 264 Frederick Delius: A Research and Information Guide

the Twentieth Century.” In Carley, Lionel, ed. Frederick Delius: Music, Art, and Literature (see no. 56), pp. 260–272. Examines the reception of Delius’s operas in Germany. Half of Delius’s six operas had premieres in Germany during Delius’s lifetime.

1561. Mitchell, Donald. “Delius and Opera.” The Listener 59 (23 January 1958): 177. A survey of Delius’s operas, with particular attention to Koanga.

1562. Redwood, Christopher. “Delius in the Opera House.” Musical Times 125, no. 1696 (June 1984): 319–321. The performance of all of Delius’s operas in England (excepting The Magic Fountain, for which a recording is available) prompts this reexamination of Delius’s contributions to opera.

1563. Sullivan, Jack. “Operas for a New World.” Opera 51 (October 2000): 1173–1179. Describes The Magic FountainDVWKH¿UVWJUHDW$PHULFDQRSHUD$OVR includes a discussion of KoangaDVZHOODVDSKRWRJUDSKIURPWKH¿UVW British production (1935).

1564. Vaughan, Denis. “English Naturalist.” Opera News 27 (29 December 1962): 32–34. Reprint, Delius Society Newsletter (December 1963): 7–10. Brief overview of Delius’s life and operas in commemoration of the Delius centenary.

Orchestra Works

Reference Sources: Dictionaries and Encyclopedias 1565. Barlow, Harold, and Sam Morgenstern. “Delius, Frederick (1862–1934).” In A Dictionary of Musical Themes, pp. 158–160. New York: Crown, 1975. Also published: London: E. Benn, 1978. ISBN 051724465. ML 128.I65 B3 1975. Includes principal themes for Appalachia, Brigg Fair, Violin Concerto, Eventyr, Hassan, In a Summer Garden, Irmelin Prelude, Paris, Violin Sonata no. 2, Two Pieces for Small Orchestra, and The Walk to the Paradise Garden.

1566. Ewen, David. “Delius.” In Ewen’s Musical Masterworks: The Encyclopedia of Musical Masterpieces, pp. 199–202. New York: Arco, Bibliography 265

1954. ML 105.E96 1967. First published as Music for the Millions. New York: Arco, 1944. Provides brief descriptions of A Village Romeo and Juliet, Brigg Fair, Dance Rhapsody no. 1, In a Summer Garden, On Hearing the First Cuckoo in Spring, and Over the Hills and Far Away. There are no musical examples.

1567. Ewen, David. “Delius, Frederick.” In Encyclopedia of Concert Music, p. 128. New York: Hill and Wang, 1959. ML 100.E85. 7KHHQWU\IRU'HOLXVFRQWDLQVDELRJUDSKLFDOSUR¿OH JLYHVDQLQFRUUHFW marriage date) and list of principal instrumental works. The following works receive their own entries: Brigg Fair, Eventyr, In a Summer Garden, On Hearing the First Cuckoo in Spring, Paris, A Song of the High Hills, A Song of Summer, Summer Night on the River, and The Walk to the Paradise Garden.

1568. Rehrig, William H. “Delius, Frederick.” In The Heritage Encyclopedia of Band Music Composers and Their Music, Vol. 1, p. 186. Westerville, Ohio: Integrity Press, 1991–1996. ISBN 0918048125. ML 102.B35 R4 1991. The entry for Delius contains brief biographical facts culled from Baker’s Biographical Dictionary of Musicians (but with Grez misspelled as “Greg,” although that error is corrected in the supplementary volume). There are arrangements of the following works listed in the main set and supplement: Marche Caprice, On Hearing the First Cuckoo in Spring, “La Calinda”, and The Walk to the Paradise Garden.

Reference Sources: Miscellaneous 1569. “Delius.” In The Orchestra on Record, 1896–1926: An Encyclopedia of Orchestral Recordings Made by the Acoustical Process, edited by Claude Graveley Arnold, p. 92. Westport, Conn.: Greenwood Press, 1997. ISBN 0313300992. ML 156.4.O5 A78 1997. Includes information on title, performers, catalog number, recording, DQGLVVXHGDWHVIRUHDUO\UHFRUGLQJVRI¿YH'HOLXVZRUNVBrigg Fair, Dance Rhapsody no. 1, Suite from Hassan, On Hearing the First Cuckoo in Spring, and A Song before Sunrise.

1570. “Frederick Delius.” In Great Orchestral Music: A Treasury of Program Notes, edited by Julian Seaman, pp. 123–128. New York: Rinehart, 1950. Rev. ed., New York: Collier, 1962. MT 125.S34. 266 Frederick Delius: A Research and Information Guide

Includes a biographical sketch and program notes by various writers for these works: On Hearing the First Cuckoo in Spring (notes by Louise Beck), Intermezzo, “The Walk to the Paradise Garden” from A Village Romeo and Juliet (George H. L. Smith), Brigg Fair: An English Rhapsody (Carl Paige Wood), and the Piano Concerto (Barbara Duncan).

1571. “Frederick Delius 1862–1934.” In The Columbia Book of Musical Masterworks, edited by Goddard Lieberson, pp. 159–162. New York: Allen, Towne and Heath, 1947. MT 90.L5. 2IIHUV D ELRJUDSKLFDO SUR¿OH ZLWK H[FHUSWV IURP SXEOLVKHG DFFRXQWV contrasting Delius’s early and later life, plus a description of his musical style. There are brief notes and suggested recordings for Brigg Fair, In a Summer Garden, On Hearing the First Cuckoo in Spring, Over the Hills and Far Away, and Sea Drift. These notes were originally issued with Columbia Masterworks recordings.

1572. Altmann, Wilhelm. “Delius, Frederick.” In Orchester-Literatur-Katalog, p. 75. Leipzig: F. E. C. Leuckart, 1929. ML 128.O5 A5 1926. This catalog by one of Delius’s publishers includes listings for twelve Delius works. In German.

1573. Bagar, Robert C., and Louis Biancolli, eds. The Concert Companion: A Comprehensive Guide to Symphonic Music. New York: Whittlesey House, 1947. Also published: The Complete Guide to Orchestral Music. 2 vols. New York: Grosset and Dunlap, 1947. MT 125.B15. Provides background information and descriptive notes for Paris, A Song of Summer, and “The Walk to the Paradise Garden”.

1574. Baldwin, Lillian. “Music Made in England: Frederick Delius.” In A Listener’s Anthology of Music, Volume II, the Musician as Poet, Painter, and Dramatist. Vol. 2, 433–442. New York: Silver Burdett, 1948 MT90. B25. Biographical sketch and analyses of On Hearing the First Cuckoo in Spring and Brigg Fair. Includes brief musical examples.

1575. Biancolli, Louis. The Analytical Concert Guide. Garden City, N.Y.: Doubleday, 1951. x, 722 p. Also published London: Cassell, 1957. Reprint: Westport, Conn.: Greenwood Press, 1971. MT 125.B46. A collection of program notes drawn from major American orchestras. There are notes for the following works: Piano Concerto (Felix Borowski), Brigg Fair (Neville Cardus), Paris (James G. Heller), “The Bibliography 267

Walk to the Paradise Garden” (Lawrence Gilman), and In a Summer Garden (Felix Borowski).

1576. Burrows, Raymond, and Bessie Carroll Redmond. “Delius.” In Concerto Themes, pp. 92–93. New York: Simon and Schuster, 1951. ML 128.O5 B8. Gives the principal themes from the Violin and Piano Concertos. Includes information on available score formats, published analyses, program notes, bibliography, and indexes.

1577. Chwiakowski, Jerzy. “Delius, Frederick (Fritz) (Theodore Albert).” In The Da Capo Catalog of Classical Music Compositions, pp. 322–326. New York: Da Capo Press, 1996. ISBN 030679666X. ML 113.C59 1996. 7KLVFODVVL¿HGOLVWRIZRUNVLQFOXGHVGDWHVDORQJZLWKUHIHUHQFHVWRWKH Robert Threlfall catalog and supplement (see no. 33, 35).

1578. Daniels, David. “Delius, Frederick.” In Orchestral Music: A Handbook, pp. 120–121. Lanham, Md.: Scarecrow Press, 1996. ISBN 0810832283. ML 128.O5 D3 1996. Contains information on editions, duration, and instrumentation for fourteen of Delius’s orchestral works.

1579. Hinson, Maurice. “Frederick Delius (1862–1934).” In The Pianist’s Guide to Transcriptions, Arrangements, and Paraphrases, pp. 46–47. Bloomington: Indiana University Press, 2000. ISBN 0253327458. ML 128.P3 H536 2000. Includes information on transcriptions of the following works: Brigg Fair, “La Calinda,” Dance Rhapsody no. 1, On Hearing the First Cuckoo in Spring, Summer Night on the River, A Song before Sunrise, and Late Swallows.

1580. Hutchings, Arthur. “Frederick Delius (1862–1934).” In The Concerto, edited by Ralph Hill, pp. 261–275. London: Penguin, 1952. Reprint, Westport, Conn.: Greenwood Press, 1978. MT 125.H498. Provides analyses of the Piano, Violin, Violoncello, and Double Concertos.

1581. Kennedy, Michael. “The Concerto in Britain: Delius.” In A Companion to the Concerto, edited by Robert Layton, pp. 332–335. New York: Schirmer Books, 1988. ISBN 0028719611. ML 1263.C64 1989. Short background information and discussion of Delius’s four concertos. 268 Frederick Delius: A Research and Information Guide

The accompanying discography includes two recordings (for the Violin Concerto and the Violoncello Concerto).

1582. Lindeman, Stephan D. “Delius, Frederick (1862–1934).” In The Concerto: A Research and Information Guide, pp. 222–223. New York: Routledge, ISBN 2006 0415976197. ML128.C84 e L56 2006. Bibliography for the seven concerted works: Suite for Violin and Orchestra, Légende for Violin and Orchestra, Piano Concerto, Double Concerto, Violin Concerto, Violoncello Concerto, and Caprice and Elegy for Cello and Chamber Orchestra.

1583. Mordden, Ethan. “Frederick Delius, 1862–1934.” In A Guide to Orchestral Music: The Handbook for Non-Musicians, pp. 321–327. New York: Oxford University Press, 1980. ISBN 0195044258. MT 125.M72. Describes Delius’s music as an “acquired” taste (p. 321), but notes that it is worth the effort. The author encourages potential listeners to begin not with the short orchestral works, but with Appalachia, Paris—The Song of a Great City or Eventyr. Includes introductory remarks and brief descriptions of the Violin Concerto, Paris—The Song of a Great City, Eventyr, Florida Suite, Brigg Fair, Dance Rhapsody no. 1, Summer Night on the River, Over the Hills and Far Away, The Walk to the Paradise Garden, and Prelude to Irmelin.

1584. Newmarch, Rosa. The Concert-Goer’s Library of Descriptive Notes. London: Oxford University Press, 1933. Reprint, Freeport, N.Y.: Books for Libraries, 1971. MT 125.N5. Contains a narrative description of Brigg Fair and A Dance Rhapsody. No musical examples.

1585. O’Connell, Charles. “Frederick Delius.” In The Victor Book of Overtures, Tone Poems and Other Orchestral Works, pp. 136–141. New York: Simon and Schuster, 1950. MT 125.O3. Contains a biographical sketch, remarks on his musical style, and analytical notes for Brigg Fair, In a Summer Garden, On Hearing the First Cuckoo in Spring, The Song of the High Hills, and “The Walk to the Paradise Garden.” Some of the notes include musical examples. Includes a discography.

1586. Rabson, Carolyn. “Delius, Frederick.” In Orchestral Excerpts: A Comprehensive Index, pp. 50–51. Berkeley, Calif.: Fallen Leaf, 1993. ISBN 0914913263. ML 128.O5 R2 1993. Bibliography 269

Provides citations to collections containing orchestral excerpts for various Delius works.

1587. Saltonstall, Cecelia D., and Henry Saltonstall. A New Catalog of Music for Small Orchestra. Music Indexes and Bibliographies. Clifton, N.J.: European American Music, 1978. xxv, 323 p. ISBN 0913574147. ML 128.O5 S33. Each entry in this catalog contains information on publication, date, orchestration, and duration. The following works are included: “Intermezzo” from Fennimore and Gerda, “Prelude” and “Serenade” from Hassan, Irmelin Prelude, Two Pieces for Small Orchestra, and A Song before Sunrise.

1588. Spaeth, Sigmund. “Other Musical Impressionists.” In A Guide to Great Orchestral Music, pp. 299–301. New York: Modern Library, 1943. xii, 532 p. MT 125.S7. Brief descriptions of On Hearing the First Cuckoo in Spring, Brigg Fair, Piano Concerto, “The Walk to the Paradise Garden,” Irmelin Prelude, Lebenstanz, and Paris.

1589. Toskey, Burnett R. “Delius, Frederick.” In Concertos for Violin and Viola: A Comprehensive Encyclopedia, p. 202. Seattle, Wash.: B. R. Toskey, 1983. ISBN 0960105484. ML 128.V4 T68 1983. Contains information on the Double Concerto, the Lionel Tertis arrangement of the Double Concerto for violin, viola and piano, and the Violin Concerto.

1590. Upton, George P., and Felix Borowski, eds. The Standard Concert Guide. Chicago: A. C. McClurg, 1930. MT 90.U63 1930. Descriptive notes for A Dance Rhapsody, Lebenstanz, On Hearing the First Cuckoo in Spring, and Paris.

1591. Voorhees, Anna Tipton. “Delius, Frederick.” In Index to Symphonic Program Notes in Books, pp. 39–40. Kent, Ohio: Kent State University School of Library Science, 1970. ML 128.O5 V6. Contains citations to sources containing program notes for several of Delius’s orchestral works. 270 Frederick Delius: A Research and Information Guide

Articles 1592. Foss, Hubert. “The Instrumental Music of Frederick Delius.” Tempo no. 26 (1952–1953): 30–37. This survey is divided into two sections based on the presence or absence of formal design of the works.

1593. Heseltine, Philip. “Music from Tonight’s Delius Concert.” Radio Times 25, no. 315 (11 October 1929): 126. Reprint, Delius Society Journal no. 94 (1987): 48–51; partially reprinted in Delius Society Journal no. 142 (2007): 61. Program notes for works presented in the 18 October concert: Eventyr, Cynara, the Piano Concerto, An Arabesque, and Appalachia.

1594. Hull, Robert H. “The Quintessence of Delius.” Musical Times 68, no. 1012 (1 June 1927): 497–500. $QDO\]HV ¿YH RI 'HOLXV¶V ³FRQWHPSODWLYH´ ZRUNV Brigg Fair, In a Summer Garden, Dance Rhapsody no. 1, Summer Night on the River, and On Hearing the First Cuckoo in Spring. Includes musical examples. Subsequent issues of Musical Times featured several letters to the editor that were written regarding this article, including one from Philip Heseltine (Musical Times 68, no. 1013 (July 1927): 643).

1595. Lloyd Webber, Julian. “Delius and the Cello.” Music and Musicians 24 (June 1976): 22–23. $VXUYH\RI'HOLXV¶V¿YHZRUNVIRUYLRORQFHOOR5RPDQFHIRUYLRORQ cello and piano (1896), Double Concerto, Sonata for violoncello and piano, Violoncello Concerto, and Caprice and Elegy for violoncello and chamber orchestra.

1596. Lloyd Webber, Julian. “The Cello Music of Delius.” Strad 89 (July 1978): 279–285. An overview of Delius’s works for cello. Includes musical examples.

Choral and Vocal

Reference Sources 1597. Barlow, Harold, and Sam Morgenstern. “Delius, Frederick (1862–1934).” In A Dictionary of Vocal Themes, pp. 91–92. New York: Crown, 1950. Also published: London: E. Benn, 1950; rev. ed. published: A Dictionary of Opera and Song Themes. New York: Crown, 1976. ML 128.V7 B3. Bibliography 271

Includes principal themes for Appalachia, Cradle Song, Hassan (closing chorus), Indian Love Song, Irmelin Rose, Love’s Philosophy, The Nightingale [“Sing, Sing”], and To the Queen of My Heart. There is also a “notation index” with the themes transposed to the key of C. The revised edition contains the same themes as the original edition.

1598. Espina, Noni. “Frederick Delius, 1862–1934.” In Repertoire for the Solo Voice: A Fully Annotated Guide to Works for the Solo Voice Published in Modern Editions and Covering Material from the 13th Century to the Present, pp. 77–80. Metuchen, N.J.: Scarecrow Press, 1977. ISBN 0810809435. ML 128.S3 E8. Presents information on twenty-two songs (source of text, translation, GDWH GLI¿FXOW\ OHYHO UDQJH ZKHWKHU LW LV DYDLODEOH LQ D FROOHFWLRQ RI songs, and remarks) and one collection. Also includes brief biographical information.

1599. Green, Jonathan D. “Delius, Frederick.” In A Conductor’s Guide to Choral-Orchestral Works, pp. 61–69. Metuchen, N.J.: Scarecrow Press, 1994. ISBN 0810827123. ML 128.C48 G7 1994. &RQWDLQVDELRJUDSKLFDOSUR¿OHOLVWVRIKRQRUVDQGSULQFLSDOZRUNVDQG a select bibliography, followed by in-depth entries for Appalachia, Sea Drift, and Requiem. These entries contain information on duration, date, WH[W SHUIRUPLQJ IRUFHV ¿UVW SHUIRUPDQFH HGLWLRQ DXWRJUDSK QRWHV SHUIRUPLQJ LVVXHV LQFOXGLQJ GLI¿FXOW\ OHYHO  D GLVFRJUDSK\ DQG D bibliography.

Monographs and Chapters 1600. Danuser, Hermann. “Der Orchestergesang des ¿Q GH VLqFOH eine historische und ästhetische Skizze.” Die Musikforschung 30, no. 4 (1977): 425–452. &KLHÀ\ D GLVFXVVLRQ RI 'HOLXV¶V Mitternachtslied and other works (Sakuntala, Maud, Songs of Sunset, Cynara). In German.

1601. Hold, Trevor. “Frederick Delius.” In Parry to Finzi: Twenty English Song-Composers, pp. 73–86. Woodbridge, Suffolk: Boydell Press, 2002. ISBN 0851158870. ML 2831.H65 2002. Studies Delius’s English-language songs and concludes that perhaps 'HOLXV¶V JUHDWHVW FRQWULEXWLRQ ZDV KLV LQÀXHQFH RQ D VXFFHVVLYH generation of songwriters. Includes musical examples, a chronological list of English song-composers of the period covered in the book, a general bibliography, glossary, and index. 272 Frederick Delius: A Research and Information Guide

1602. Holland, Arthur Keith. The Songs of Delius. The Musical Pilgrim. London: Oxford University Press, 1951. 56 p. ML 410.D35 H7. First published Musical Opinion (1936–1937): 19, 118, 306, 403, 592, 695, 783. A survey of Delius’s songs. After an introduction and a general chapter on the texts of the songs, subsequent chapters are organized by the language of the song text (Norwegian, Danish, French, German, and English). There is a helpful chronological listing of the songs and musical examples, but no bibliography or index.

1603. Leopold, Silke, and Ullrich Scheideler, eds. Oratorienführer. Stuttgart: J. B. Metzler; Kassel: Bärenreiter, 2000. ISBN 3476009777. MT 110. O73 2000. Includes information on the composer, text, translations, forces required, duration, date, manuscript, editions, and bibliography, followed by an analysis of the two works: Mass of Life (Sabine Prüser) and Requiem (Katherine Ribbe).

1604. Pilkington, Michael. Delius, Bridge and Somervell. English Solo Song: Guides to the Repertoire. London: Thames, 1993. viii, 97 p. ISBN 0905210956. ML 128.S3 P55 1993. A concise guide to the songs of Delius, Frank Bridge, and Arthur 6RPHUYHOO &RQWDLQV D IXOO GHVFULSWLRQ RI HDFK VRQJ WLWOH ¿UVW OLQH poet, date of composition, publication information, tonality, range, PHWHU WHPSR GXUDWLRQ GLI¿FXOW\ OHYHO VXEMHFW RI WH[W GHVFULSWLRQ RI the accompaniment, and miscellaneous comments). The Delius songs are listed in the order of appearance in the collected edition of Delius’s works, and include only the songs in which Delius set English texts or those for which an English translation was made or authorized by Delius. 7KHUHLVDVHOHFWELEOLRJUDSK\DQGVHYHUDOLQGH[HVWLWOHVDQG¿UVWOLQHV (divided by composer and subdivided by language), poets, translators, special categories (cycles, those with alternative accompaniment, GLI¿FXOW\OHYHOHWF DQGYRLFHV

1605. Pilkington, Michael. “Frederick Delius.” In English Solo Song: A Guide for Singers, Teachers, Librarians and the Music Trade of Songs Currently Available, pp. 37–38. London: Thames, 1998. ISBN 0903413930. ML 128.S3 P542 1998. This guide lists “virtually all recital songs by British composers currently in print or available from publisher’s archives.” Each entry contains information on publication, poet, key, range, and editor. There are appendices for settings of foreign texts, and for songs with Bibliography 273

accompaniment other than piano (unaccompanied or up to six players). The Delius entry includes forty songs in six collections in the main section, and nineteen songs in three collections in the list of settings of foreign texts. Includes a title index.

Articles 1606. “Songs Worth Singing: Coleridge-Taylor and Delius.” Musical Opinion and Music Trade Review (July 1914): 800–801. 6XUYH\RIWKHVRQJVGHVFULEHGDV³DPRQJVWWKH¿QHVW´,QFOXGHVPXVLFDO examples.

1607. Burton, Anthony. “Elgar, Delius, Holst: English Partsongs/Choral Works.” BBC Music Magazine 13 (April 2005): 6–8. A brief overview and comparison of partsongs and choral works of the three composers, focusing on the works included on the covermount CD. The Delius works on the CD include “To be Sung of a Summer Night on the Water, no. 1–2,” “Midsummer Song,” “Durch den Wald,” “An den Sonnenschein,” “Ave Maria,” “Sonnenscheinlied,” and “Frühlingsanbruch.” Also includes a list of “key songs” on the CD, suggestions for further listening, and information on the performers.

1608. Carley, Lionel. “Frederick Delius of Skandinavien.” Dansk musik tidsskrift 72 (May 1998): 225–227. A survey of Delius’s songs with Danish texts prepared in conjunction with the “Dansk–engelsk musikfestival—Frederick Delius og venner” (“Frederick Delius and friends”) concerts. In Danish.

1609. Foster, Beryl. “Grieg and Delius: Settings of the Same Norwegian Texts.” Studia musicologica norvegica 25 (1999): 209–219. Eight Norwegian texts were set by both Delius and Edvard Grieg. The settings are compared, as well as two German poems and a poem by Hans Christian Andersen set by both composers. Includes musical examples and references.

1610. Holland, A. K. “Delius as a Songwriter.” Tempo no. 26 (1952–1953): 18–22. A discussion of Delius’s songs and texts. Five brief musical examples accompany the text.

1611. Lowe, George. “Two Modern Song Writers: Sibelius and Delius.” Musical Standard (9 July 1910): 25. 274 Frederick Delius: A Research and Information Guide

Notes the contrasting songs and styles of the two composers.

1612. Mitchell, Donald. “Delius: The Choral Music.” Tempo no. 26 (1952– 1953): 8–17. Survey. Includes musical examples.

1613. Ould, Hermon. “Songs of Delius.” English Review 47 (November 1928): 603–607. 6XUYH\RI'HOLXV¶VVRQJV7KHDXWKRUQRWHVGLI¿FXOW\LQGHWHUPLQLQJWKHLU chronology (the dates of publication bearing little relation to the dates of composition).

1614. Sirbaugh, Nora. “The Vocal Point: A Conversation with Denis Stevens.” Journal of Singing 60, no. 3 (January–February 2004): 297–300. 6WHYHQVDXWKRURI³$+LVWRU\RI6RQJ´EULHÀ\UHPDUNVRQKLVLQWHUHVW in Delius’s music.

1615. Taylor, Stainton de B. “Great Song-Writers X, Frederick Delius.” Musical Mirror & Fanfare (November 1931): 309. %ULHISUR¿OHDQGGLVFXVVLRQRIVRQJV

1616. York, Steve. “Sir Peter Pears: An Annotated Bibliography.” Notes 63 (September 2006): 43–66. This bibliography, based on the one found in Christopher Headington’s biography of Pears, has been expanded and updated. Pears edited two collections of Delius songs (“A Book of Songs,” 2 vols., published by Oxford University Press in 1969, and “Nineteen Songs” published by Oxford in 1987 as vol. 19 of the Delius Complete Works).

Chamber and Instrumental Music

Reference Sources 1617. Baron, John H. “Frederick Delius (1862–1934).” In Chamber Music: A Research and Information Guide. 2nd, rev. ed., 315–316. New York: Routledge, 2002. Lists three articles by Arthur Hutchings Hubert Foss, and Robert Threlfall plus the (also) unexamined dissertation by Frederic Bacon-Shone.

1618. Cohn, Arthur. “Delius, Frederick (1862–1934).” In The Literature of Chamber Music, Vol. 1, pp. 661–663. Chapel Hill: Hinshaw Music, 1997. 4 vols. ISBN 0937276162. ML110.C63 1997. Bibliography 275

Brief description and analysis of the Violoncello Sonata, Violin Sonatas, and String Quartet.

1619. Everett, William A. British Piano Trios, Quartets, and Quintets, 1850– 1950: A Checklist. Detroit Studies in Music Bibliography. Warren, Mich.: Harmonie Park Press, 2000. xii, 234 p. ISBN 08999005X. ML 120.G7 E94 2000. There are two entries for the Double Concerto: one for piano arrangement of the orchestra by Philip Heseltine and another for the version of the work with the violin part arranged for viola by Lionel Tertis. Delius is DOVRPHQWLRQHGEULHÀ\LQWKHLQWURGXFWRU\HVVD\

1620. Gray, Cecil. “Delius, Frederick.” In Cobbett’s Cyclopedic Survey of Chamber Music, Vol. 1, pp. 320–323. London: Oxford University Press, 1929. 2nd ed., 1963; Reprint, London: Oxford University Press, 1986. ML 1100.C7. Biographical sketch and discussion of the String Quartet, Violin Sonatas, and Violoncello Sonata (1922).

1621. Hollfelder, Peter. “Frederick Delius.” In Klaviermusik: Internationales Chronologisches Lexikon: Geschichte, Komponisten, Werke, Literatur, p. 728. Wilhelmshaven: F. Noetzel, 1999. First published as Geschichte der Klaviermusik, Wilhelmshaven: F. Noetzel, 1989. ISBN 3795907705. ML 102.P5 H65 1999. Presents a brief overview of Delius’s life and works, a separate list of works for keyboard, and a general bibliography.

1622. Katz, Mark. “Frederick Delius (1862–1934).” In The Violin: A Research and Information Guide, pp. 213–214. New York: Routledge, 2006. ISBN 0815336373. ML 128.V4 K38 2006. Brief bibliography (four items).

1623. Magrath, Jane. “Frederick Delius (1862–1934).” In The Pianist’s Guide to Standard Teaching and Performance Literature, p. 153. Van Nuys, Calif.: Alfred, 1995. ISBN 088284654X. ML 128.P3 M24 1995. The Three Preludes and Five Piano Pieces are given brief descriptions DORQJZLWKSXEOLVKHULQIRUPDWLRQDQGDGLI¿FXOW\UDWLQJ

1624. Rangel-Ribeiro, Victor, and Robert Markel. Chamber Music: An International Guide to Works and Their Instrumentation. New York: Facts on File, 1993. xiv, 271 p. ISBN 0816022968. ML 128.C4 R3 1993. 276 Frederick Delius: A Research and Information Guide

Includes listings for Interludes (2) (1910) and the String Quartet. Each entry includes date, key, duration, orchestration, and publisher information.

1625. Williams, Michael. “Delius, Frederick.” In Music for Viola, p. 89. Detroit: Information Coordinators, 1979. ISBN 0911772952. ML 128. V36 W53. Contains information on four Delius works: the Caprice and Elegy, “Serenade” from Hassan, and Violin Sonatas nos. 2–3 (the last three works arranged by Lionel Tertis).

Articles 1626. Hutchings, Arthur. “The Chamber Works of Delius,” parts 1–4. Musical Times 76, no. 1103 (January 1935): 17–20; 76, no. 1105 (March 1935): 214–216; 76, no. 1106 (April 1935): 310–311; 76, no. 1107 (May 1935): 401–405. A detailed study of Delius’s chamber works. After an introductory section covering his compositional technique, individual works are appraised. Includes musical examples and publication information. 1RWHVRIFODUL¿FDWLRQDQGFRUUHFWLRQE\WKHDXWKRUDSSHDULQWKH0DUFK and June 1935 issue (pp. 253 and 540, respectively).

Individual Compositions (Alphabetical by Composition Title)

Air and Dance

1627. Rawlinson, Harold. “Famous Works for String Orchestra: No. 18, Air and Dance,” parts 1 and 2. Strad 60 (September 1949): 142–146; (October 1949): 176–178. $ EULHI ELRJUDSKLFDO SUR¿OH RI 'HOLXV IROORZHG E\ FRPPHQWDU\ RQ this work. The author notes that Philip Heseltine erroneously lists this work twice in the list of works in his book on Delius. Includes a list of misprints in the 1931 Winthrop Rogers score.

American Rhapsody

1628. Jones, Philip. “Delius’s American Rhapsody.” Musical Times 127 (December 1986): 677–679. Reprint, Delius Society Journal no. 93 (1987): 7–10. A discussion of the work, reconstructed from surviving orchestral parts. Includes a comparison with Appalachia, and musical examples. Bibliography 277

Appalachia

1629. Delius, Frederick. Appalachia. Harmonie, 1907. http://books.google. com/books?id=ZgARAAAAYAAJ&pg=PP2&dq=appalachia++harvard +harmonie+delius&lr=#PPA5,M1 (accessed 12 August 2008). Score of the piano reduction by Otto Singer in pdf format.

1630. Hesse, Lutz-Werner. “Elgar, Delius und Holst.” Musica 38 (July–August 1984): 341–344. Delius’s Appalachia is used as an example of English music that had EHHQIUHHGIURPFRQWLQHQWDOLQÀXHQFHV,Q*HUPDQ

1631. Réti, Rudolf. “Frederick Delius: Appalachia.” Musikblätter des Anbruch 1 (November 1919): 30. Review. In German.

Brigg Fair

1632. “Brigg Fair (Delius, Frederick).” International Music Score Library Project/Petrucci Music Library: The Public Domain Music Score Library. http://imslp.org/wiki/Brigg_Fair_%28Delius%2C_Frederick%29 (accessed 20 October 2008). Part for timpani, chimes, bass drum, triangle (Universal Edition, 1910).

1633. Barber, Nicola J. “Brigg Fair. A Melody, Its Use and Abuse.” Grainger Journal 6, no. 2 (1984): 4–20. A detailed study of the origins of the folk song Brigg Fair. Settings of the folk song by Percy Grainger and Delius are examined. Includes musical examples and references.

1634. Dallas, Karl. “The Taylor Tradition.” Melody Maker 47 (15 April 1972): 53. %DFNJURXQGPDWHULDORQ-RVHSK7D\ORUZKRZRQ¿UVWSUL]HLQDPXVLFDO competition judged by Percy Grainger. Afterward, Taylor sang a fragment of a song to Grainger that would later inspire Delius’s work. Includes information on a recording containing Taylor’s rendition of Brigg Fair (“Unto Brigg Fair” Leader LEA4050).

1635. Guinery, Paul. “Delius: Brigg Fair.” BBC Music Magazine 11, no. 6 (February 2003): 58–59. Discussion of several recordings of Brigg Fair. 278 Frederick Delius: A Research and Information Guide

1636. “Lincolnshire Folk Archive, 1908–1991.” University of Nottingham Department of Manuscripts and Special Collections. http://www. nottingham.ac.uk/mss (accessed 2 October 2008). This archive was established to preserve area folksong, building on Percy Grainger’s early recording activities. The collection contains many of Grainger’s recordings of Lincolnshire folksongs, including the “Brigg Fair” upon which Delius based his orchestral work of the same title.

1637. O’Connell, Charles. “Frederick Delius.” In The Victor Book of the Symphony, pp. 202–204. New York: Simon and Schuster, 1941. MT 150. O25 V52 1941. Contains a biographical sketch and analytical notes for Brigg Fair. Includes discography but no musical examples.

1638. “Percy Aldridge Grainger (1882–1961).” http://www.bardic-music.com/ Pag.htm (accessed 20 October 2008). This website devoted to Grainger has a link to Joseph Taylor singing the folksong “Brigg Fair.”

Eventyr

1639. Iliffe, Barrie. “Eventyr and the Fairy Tales in Delius.” In Carley, Lionel, ed. Frederick Delius: Music, Art, and Literature (see no. 56), pp. 273– 289. An extensive study of Delius’s orchestral ballad Eventyr: Once upon a Time composed in 1917 after folklore collected by Peter Christen Asbjørnsen (1812–1885). Includes musical examples.

Fennimore and Gerda

1640. Blom, Eric. “A Musical Novel by Frederick Delius.” In Stepchildren of Music, pp. 249–263. London: G. T. Foulis, 1925. Reprint, New York: Dial, 1926; New York: MacVeagh, 1926; Freeport, N.Y.: Books for Libraries, 1967. ML 60.B67. Delius’s Fennimore and Gerda (“two episodes from the life of Niels Lyhne in eleven scenes after the novel by J. P. Jacobsen”) is included in this collection of essays about music that has been ignored by critics or the public. Blom notes that this work is truly unlike any previous opera, and praises the conciseness of the writing. Includes a synopsis.

1641. Clark, Andrew. “Fennimore and Gerda: Bielefeld, 1988.” Opera (special issue, 2005): 44–45. Bibliography 279

Report of a performance at Stadttheater, Bielefeld on 5 March 1988 conducted by David de Villier.

1642. Cooke, Deryck. “Fennimore and Gerda.” Opera 13 (May 1962): 352– 353. ,QFOXGHVDEULHIUHYLHZRIWKH¿UVW(QJOLVKSHUIRUPDQFHRIWKLVRSHUD

1643. Heseltine, Philip. “Delius’s New Opera.” Musical Times 61, no. 926 (April 1920): 237–240. Reprint, Delius Society Journal no. 94 (1987): 12–17. Examines the opera Fennimore and Gerda.

1644. Loppert, Max. “Fennimore and Gerda.” Opera 34 (Festival Issue, autumn 1983): 67–68. Review of the Opera Theatre of St. Louis production performed at the International Festival, Edinburgh, 8 September 1983. Includes cast list and a picture from the production.

1645. Redwood, Christopher. “Delius’s Danish ‘Pictures.’” Opera 21 (May 1970): 403–404. Describes the interesting construction of Delius’s opera Fennimore and Gerda. The opera features a succession of scenes with some linked together by orchestral intermezzi.

1646. Redwood, Christopher. “Fennimore and Gerda.” Composer, no. 27 (1968): 6–8. Background information and synopsis.

1647. Rosenthal, Harold. “Fennimore and Gerda.” Opera 30, no. 5 (May 1979): 493. Review of the Park Lane Opera production at the Camden Festival, 21 March 1979.

1648. Simon, John. “Not So Fragile Frederic.” New Leader 81, no. 4 (9 March 1998): 18–19. Extended review of a sound recording (Chandos 9589). Includes background information on the opera, synopsis, score highlights, and comparison with a previous recording. 280 Frederick Delius: A Research and Information Guide

1649. Walsh, Michael. “Three Premieres, Three Hits.” Time 117, no. 26 (29 June 1981): 58. Review of the American premiere given by the Opera Theatre of St. Louis and hailed as “a major discovery.” Includes color illustration from WKH¿QDOVFHQH

Five Piano Pieces

1650. “5 Pieces (Delius, Frederick).” International Music Score Library Project/Petrucci Music Library: The Public Domain Music Score Library. http://imslp.org/wiki/5_Pieces_%28Delius%2C_Frederick%29 (accessed 20 October 2008). Contains the score issued by Universal Edition, 1925.

Folkeraadet

1651. Carley, Lionel. “Delius’s Norwegian Suite.” Anglo-Norse Review (December 1978): 12–14. The banning of a Swedish jazz group’s version of the Norwegian national anthem brought to mind a situation from Delius’s past—the premiere of Gunnar Heiberg’s play Folkeraadet, with incidental music by Delius. Delius set the national anthem in an untraditional manner, resulting in a great outcry in the press and branding Delius as “the most unpopular man in Norway.” A production of the work was broadcast on the BBC on Delius’s birthday in 1974, but has not been heard live in Norway since its premiere in 1897.

1652. Carley, Lionel. “Folkeraadet: Performance and History.” In Carley, Lionel, ed. Frederick Delius: Music, Art, and Literature (see no. 56), pp. 211–259. A detailed study of the work’s premiere and aftermath.

Hassan

1653. “Elster Kay: Film Script for Flecker’s Hassan (MS.Add.7636).” Cambridge University Library, Department of Manuscripts and University Archives. http://www.archiveshub.ac.uk/cgi-bin/deadsearch. FJL"VHUYHULG 9632.(6HDGFDPXQLOLE ERRO $1' QXPUHT  ¿HOG FRQW  IRUPDW VXPPDU\ ¿HOGLG[ GRFLG VFDQSRVLWLRQ PLGGOH ¿UVWUHF  QRIUDPHV RQ DFFHVVHG2FWREHU  Annotated typescript from the play by James Elroy Flecker with music by Delius. Bibliography 281

1654. Brian, Havergal. “Hassan.” Monthly Musical Record 54 (1924): 2–3. Review.

1655. Chatterton, Julia. “Delius and the Music to Hassan.” Musical Standard (20 October 1923): 166. Review.

1656. Dean, Basil. “Memories of Hassan.” Radio Times 117 (31 October 1952): 5–6. 'HDQ UHODWHV KRZ WKH SOD\ ¿QDOO\ UHDFKHG WKH VWDJH HLJKW \HDUV DIWHU WKHDXWKRU¶VGHDWK+HDOVRUHFDOOVWKH¿QDOGUHVVUHKHDUVDODWWHQGHGE\ Delius.

1657. Dean, Basil. Seven Ages: An Autobiography 1888–1927. London: Hutchinson, 1970. x, 340 p. ISBN 0091042402. PN 2598.D33 A3. Includes a description of Delius’s involvement with the Basil Dean production of James Elroy Flecker’s Hassan.

1658. Findon, B. W. “George Grossmith and J. A. E. Malone’s Production of Hassan and How He Came to Make the Golden Journey to Samarkand.” Play Pictorial 43, no. 261 (1923): 113–132. A lavishly illustrated account of the production. Includes an extended synopsis and portraits of the playwright James Elroy Flecker (1884– 1915) and Delius, who composed the music for the production.

1659. Hogg, James. “James Elroy Flecker’s ‘Hassan’: A Near Master-Piece?” In Poetic Drama & Poetic Theory, edited by James Hogg, 52–121. Salzburg: Institut für Englische Sprache und Literatur, Universität Salzburg, 1975. PR 3614.H64. A detailed account of the production of Hassan, including information about the process of selecting Delius as the composer of the incidental music.

1660. Hussey, Dyneley. “Hassan—the Figure in the Carpet.” Music and Letters 5, no. 1 (January 1924): 59–64. Criticism regarding the form and structure of James Elroy Flecker’s Hassan in the Basil Dean production. There is no discussion of Delius’s incidental music. 282 Frederick Delius: A Research and Information Guide

1661. Matthew-Walker, Robert. “Obituaries: Sidonie Goossens.” Musical Opinion 128, no. 1445 (March–April 2005): 5–6. This obituary of Goossens noted her participation in the premiere of Basil Dean’s production of James Elroy Flecker’s Hassan with music by Delius.

1662. Redwood, Dawn. Flecker and Delius: The Making of Hassan. London: Thames, 1978. 103 p. ISBN 0905210069. PR 6011.L4 H337. An extended version of two articles originally published in the Delius Society Journal and a talk given at a Delius Society meeting. Individual chapters of the book are devoted to playwright James Elroy Flecker (1884–1915), the process of choosing a composer to write incidental music for the production, parallels between Flecker and Delius, and productions of the play in Darmstadt and London. Christopher Redwood provides a chapter of musical analysis. Appendices contain excerpts from reviews of productions in Darmstadt, London, and America, and a GLVFXVVLRQRIWKHGLI¿FXOWLHVZLWKWKHW\SHVFULSW7ZHOYHSDJHVRISODWHV and a facsimile of the London production program complement the text.

1663. Webb, F. Gilbert. “The Music of Hassan.” Musical News and Herald (6 October 1923): 278. Description and review of the incidental music written by Delius for the play produced at His Majesty’s Theatre in September 1923.

Idyll

1664. Fenby, Eric. “Idyll: Delius Lovers Will Not Be Disappointed.” Radio Times (29 September 1933): 736. Reprint, Lloyd, Stephen, ed. Fenby on Delius: Collected Writings on Delius to Mark Eric Fenby’s Ninetieth Birthday (see no. 58), p. 188–192. 'HVFULEHVWKHZRUNZKLFKZDVVRRQWRKDYHLWV¿UVWSHUIRUPDQFH)HQE\ who was involved in the creation of the work, comments on Delius’s mental and physical conditions, and the problems of musical dictation.

In a Summer Garden

1665. “In a Summer Garden (Delius, Frederick).” International Music Score Library Project/Petrucci Music Library: The Public Domain Music Score Library. http://imslp.org/wiki/In_a_Summer_Garden_%28Delius%2C_ Frederick%29 (accessed 20 October 2008). Part for timpani, triangle, glockenspiel (F. E. C. Leuckart, 1911). Bibliography 283

Irmelin

1666. “Missionary to the English.” Time 61, no. 20 (18 May 1953): 60–61. Review of the premiere at the Oxford New Theatre, conducted by Sir Thomas Beecham. The title of the article refers to a Beecham quote about English critics.

1667. Gelatt, Roland. “Irmelin at Oxford.” Saturday Review 36, no. 22 (30 May 1953): 32. 5HYLHZRIWKH¿UVWSHUIRUPDQFH

1668. Porter, Andrew. “Delius’s Irmelin.” Musical Times 94, no. 1324 (June 1953): 275. Review of the premiere.

Koanga

1669. “Ante Bellum Aida.” Time 97, no. 1 (4 January 1971): 56. Reprint, Delius Society Newsletter no. 31 (1971): 18. 5HYLHZRIWKH2SHUD6RFLHW\RI:DVKLQJWRQSURGXFWLRQWKH¿UVWVWDJLQJ of a Delius opera in the United States.

1670. Delius’s Koanga: Reviews of the Pegasus Opera Production. http:// thompsonian.info/koanga-pegasus-2007-reviews.html (accessed 15 October 2008). Includes interview clip and poster.

1671. “Treasures of South Florida Libraries: A Celebration of Rare & Unique Materials.” University of Miami Libraries Special Collections Division. http://scholar.library.miami.edu/treasure/ (accessed 20 October 2008). The Carl S. Swisher Library, Jacksonville University (Jacksonville, Florida) is represented in this publication with the manuscript score for Delius’s opera, Koanga, based on a character from George Washington Cable’s The Grandissimes: A Story of Creole Life (New York: Charles Scribner’s Sons, 1880). Includes information on the Library and its Delius collection, the manuscript and Cable’s story.

1672. Depardieu, Benoît. “Koanga de Frederick Delius: Cherche Premier Opéra Afro-Américain Désespérément.” La Revue LISA 4, no. 2 (2006): 37–51. 284 Frederick Delius: A Research and Information Guide

An examination of the libretto and performance reviews of Delius’s opera Koanga  UHYHDOVWKDWWKLVRSHUDFRXOGEHFRQVLGHUHGWKH¿UVW $IULFDQ$PHULFDQRSHUDLQVWHDGRIWKHZRUNVWUDGLWLRQDOO\LGHQWL¿HGDV WKH¿UVWRIWKDWGHVFULSWLRQ *HRUJH*HUVKZLQ¶VPorgy & Bess [1935] or Scott Joplin’s Treemonisha [1910]). In French, with an English abstract.

1673. East, Leslie. “Koanga.” Music and Musicians 20 (August 1972): 53–54. Review of the Camden Festival performance.

1674. Fenby, Eric. “The Story of Koanga.” Radio Times (20 September 1935): 11. Reprint, Lloyd, Stephen, ed. Fenby on Delius: Collected Writings on Delius to Mark Eric Fenby’s Ninetieth Birthday (see no. 58), pp. 204–206. 'HVFULEHV WKH ZRUN WKDW ZDV WR KDYH LWV ¿UVW (QJOLVK SHUIRUPDQFH DW Covent Garden. Includes a brief history of the work and synopsis.

1675. Hall, George. “Koanga.” Opera 58 (June 2007): 720–721. Reprint, Delius Society Journal no. 142 (2007): 86–87. Review of the Pegasus Opera production at Sadler Wells, 11–14 April 2007, directed by Helena Kaut-Howson.

1676. Hussey, Dyneley. “Koanga at Covent Garden.” Spectator 155, no. 5596 (27 September 1935): 463. Review.

1677. Kurth, Ulrich. “Frederick Delius.” In Aus der neuen Welt: Untersuchungen zur Rezeption Afro-Amerikanischer Musik in Europäischer Kunstmusik des 19. und frühen 20. Jahrhunderts, pp. 158–169. Göppingen: Kümmerle Verlag, 1982. ISBN 3874525597. ML 3556.K95 1982. The author examines KoangaIRULQÀXHQFHVRIVSLULWXDOVEOXHVUDJWLPH and jazz. Includes English summary of the German text, a bibliography, a discography, and an index.

1678. Loskill, Jörg. “Liebesmüh’ für ein vergessenes Werk: In Trier wieder entdeckt Koanga von Frederick Delius.” Das Orchester 48, no. 3 (2000): 34–35. Review of a performance at the Stadttheater under the direction of Heinz Lukas-Kindermann.

1679. Nettel, Reginald. “Historical Introduction to La Calinda.” Music and Letters 27 (1946): 59–62. Bibliography 285

Discusses the origins of the Calinda dance and Delius’s use of the dance in Koanga.

1680. Nettel, Reginald. “An Opera from an Orange Grove.” In Great Moments in Music, pp. 99–106. London: Phoenix House, 1958. Also published: New York: Roy, 1958. ML 3930.N48. Tells the story behind the inspiration for the opera Koanga.

1681. Newman, Ernest. “Delius and the Opera: A Quest for the Impossible.” In From the World of Music, edited by Felix Aprahamian, pp. 122–126. London: J. Calder, 1956. Reprint, New York: Coward-McCann, 1957; New York: Da Capo, 1978. ML 60.N49. First published in the Sunday Times (London) (29 September 1935). Review of the Covent Garden production of Koanga.

1682. Palmer, Christopher. “Delius’s Negro Opera.” Opera 23 (May 1972): 403–407. ([DPLQHVWKHVLJQL¿FDQFHRIKoanga among Delius’s works. Includes musical examples and an illustration from the 1935 Covent Garden production.

1683. Randel, William. “Koanga and Its Libretto.” Music and Letters 52 (April 1971): 141–156. Describes the production of the libretto (based on an episode from George W. Cable’s novel The Grandissimes, but considerably altered) DQG WKH ¿UVW SHUIRUPDQFH RI WKH RSHUD 7KH SURGXFWLRQ ZDV JLYHQ DW Covent Garden, 23 September 1935, about a year after Delius’s death.

1684. Redwood, Christopher. “The First Negro Opera?” Musical Opinion 95 (May 1972): 407. Background information on the opera Koanga, which was to be performed at Sadler’s Wells Theatre, 17–20 May 1972. Includes a brief list of previous productions.

1685. Reuling, Karl F. “Washington.” Opera News 35, no. 14 (30 January 1971): 30. Reprint, Delius Society Newsletter no. 31 (1971): 19. Review of the American premiere. Includes an illustration from the production.

1686. Stevenson, Florence. “Koanga: Frederick Delius’ Slave Opera Makes News in Washington.” Opera News 35, nos. 8–9 (December 1970): 34–35. 286 Frederick Delius: A Research and Information Guide

Provides background information on the opera and its production by the Opera Society of Washington; includes remarks by the director, Frank Corsaro, the conductor, Paul Callaway, and the singer William Roy.

1687. Threlfall, Robert. “The Early History of Koanga.” Tempo, no. 110 (1974): 8–11. %DFNJURXQGLQIRUPDWLRQRQWKHRSHUDWKH¿UVWRI'HOLXV¶VRSHUDVWREH staged.

1688. Turner, W. J. “Delius at Covent Garden.” New Statesman and Nation n.s. 10, no. 241 (5 October 1935): 445–446. 5HYLHZRIWKH¿UVW(QJOLVKSURGXFWLRQ

Late Swallows

1689. Threlfall, Robert. “Delius: Late Swallows in Florida.” Composer no. 51 (1974): 25–27. Using a phrase from Late Swallows as an example, the author discusses Delius’s “self-borrowing” from music twenty years earlier.

Lebenstanz

1690. “Mr. Delius’s ‘Dance of Life.’” Musical Times 49, no. 780 (February 1908): 111. Review of a performance given 19 January 1908 at the Royal Albert Hall.

The Magic Fountain

1691. Feuchtner, Bernd. “Kiel: Delius: The Magic Fountain.” Opernwelt 38, no. 8 (August 1997): 50–51. Review of the stage premiere of the opera, 25 June 1997. Includes one photograph from the production.

1692. Hall, George. “From around the World: Glasgow.” Opera News 63 (June 1999): 68. Review of the British stage premiere by Scottish Opera at the Theatre Royal, Glasgow, 20 February 1999. Previous performances included a %%&VWXGLRSHUIRUPDQFHLQDQGWKH¿UVWVWDJHGSURGXFWLRQLQ.LHO Germany, in 1997. Bibliography 287

1693. Milnes, Rodney. “Catching up on Delius.” Opera 50 (May 1999): 507– 510. )HDWXUH UHYLHZ RI WKH ¿UVW %ULWLVK VWDJLQJ RI WKH RSHUD The Magic Fountain.

1694. Redwood, Christopher. “Delius’s Magic Fountain.” Musical Times 118, no. 1617 (November 1977): 909. A brief introduction to Delius’s second opera, The Magic Fountain.

1695. Threlfall, Robert. “Delius’s Unknown Opera: The Magic Fountain.” Studies in Music, no. 11 (1977): 60–73. Examines the characters, orchestration, and structure of Delius’s opera. Includes a scene-by-scene analysis.

Margot la Rouge

1696. Gurewitsch, Matthew. “Before Moulin Rouge, there was Margot.” High Fidelity 34 (January 1984): 86–87. Feature review of Arabesque 8134-L. Includes a considerable amount of discussion of and an illustration from the Opera Theatre of St. Louis production.

1697. Norquet, Mattias. “Spiegel des Musiklebens: Nach 40 Jahren Archivschlaf Erweckt: Doppelpremiere in Trier: Delius’ Margot la Rouge.” Das Orchester 49, no. 4 (2001): 38–39. Review of the production under the direction of Heinz Lukas- Kindermann.

1698. Porter, Andrew. “Musical Events: A Torch, a Flame, a Will-o’-the-Wisp.” New Yorker 59, no. 22 (18 July 1983): 84–87. Review of the production by the Opera Theatre of St. Louis, June 1983, conducted by Eric Fenby.

A Mass of Life

1699. “Delius: A Mass of Life.” British Musician and Musical News (April 1933): 74–75. Review of a performance in Berlin. The anonymous reviewer feels the work is “antiquated.” 288 Frederick Delius: A Research and Information Guide

1700. “Music: Frederick Delius.” Saturday Review 148, no. 3862 (2 November 1929): 509. Background information on Delius’s music for an upcoming performance of A Mass of Life.

1701. “Neue Chor-Symphonien: Frederick Delius, Eine Messe des Lebens.” Musikblätter des Anbruch 7, no. 4 (April 1925): 216. Review. In German.

1702. “Posthumous Mass.” Time 31, no. 4 (24 January 1938): 59–60. Review of the American premiere of A Mass of Life given by Schola Cantorum and conducted by Hugh Ross. Includes brief biographical sketch and portrait of Delius.

1703. Bartók, Béla. “A Delius Première in Vienna.” In Béla Bartók Essays, edited by Benjamin Suchoff, pp. 449–450. London: Faber and Faber, 1976. First published as “Delius-bemutató Bécsben,” Zeneközlöny 9 (1911): 340–342. An English translation of an article written in conjunction with the premiere of Delius’s A Mass of Life. Bartók is quite taken with Delius’s use of the wordless chorus.

1704. Boyle, Andrew J. “A Mass of Life and Its ‘Bell-Motif.’” Music Review 43 (February 1982): 44–50. A four-note “bell-motif” is used both as a metaphor for Nietzsche’s symbolic midnight bell and as a unifying factor in A Mass of Life. Includes musical examples.

1705. Collins, Adrian. “Delius’s Mass of Life.” Chesterian, no. 77 (March 1929): 165–169. Descriptive notes and evaluation of the text and music.

1706. Cooper, Martin. “Music.” Spectator 186, no. 6415 (8 June 1951): 781. Review of a performance of A Mass of Life with the Royal Philharmonic Orchestra conducted by Sir Thomas Beecham. A letter to the editor by Delius’s goddaughter Yvonne Hudson regarding this review appears on pp. 817–818 of the 22 June issue.

1707. East, Leslie. “A Mass of Life.” Music and Musicians 23 (July 1975): 47–48. Bibliography 289

Review of a performance by the Royal Choral Society.

1708. Evans, Edwin. “A Delius–Nietzsche Mass.” Radio Times (19 October 1934): 185. Descriptive notes for a broadcast by the BBC Symphony from the Queen’s Hall. Evans ponders whether music can express a philosophy.

1709. Foa, Giorgio R. “Vita musicale: Lettera da Londra.” Musica d’oggi 14, no. 8–9 (August–September 1932): 362–363. Review of a performance of A Mass of Life at Covent Garden.

1710. Haym, Hans. Frederick Delius: “Eine Messe Des Lebens.” Leipzig: Universal-Edition, 1913. 31 p. ML 410.D35 H45. English translation published as Frederick Delius, “A Mass of Life”: Introduction to the Words and Music. Vienna: Universal-Edition, 1925. 38 p. ML 410.D45 H39 1925. A biographical sketch, analysis, and text of A Mass of Life. Originally published in German, the English translation was published (minus the biographical sketch) in 1925.

1711. Henahan, Donal. “A Mass of Life: Delius’ Important and Lovely Score in a Welcome New Recording from Angel.” High Fidelity Magazine (July 1972): 72. Reprint, Delius Society Newsletter no. 38 (1973): 4–5. Review of Angel SB 3781.

1712. Hussey, Dyneley. “Music: The Delian Mode.” Saturday Review 139, no. 3624 (11 April 1925): 385. Review of a performance by the Philharmonic Society conducted by Paul Klenau.

1713. Istel, Edgar. “A Mass of Life.” Monthly Musical Record (March 1913): 62. 5HYLHZ RI WKH ¿UVW FRPSOHWH SHUIRUPDQFH 0XQLFK  -DQXDU\  Delius was present at the concert.

1714. Keller, Adolf. “Uraufführung von Frederick Delius’s Lebensmesse.” Signale für die musikalische Welt (15 December 1909): 1827. Review of the premiere. 290 Frederick Delius: A Research and Information Guide

1715. Oehlerking, H. “Fred. Delius, Eine Messes des Lebens.” Neue Zeitschrift für Musik 40. Jhrg., Heft 39 (23 December 1909): 565–566. 5HYLHZRIWKH¿UVWSHUIRUPDQFHLQ*HUPDQ\ (OEHUIHOG'HFHPEHU 1909). In German.

1716. Orr, C. W. “A Mass of Life.” Radio Times (25 October 1929). Reprint, Delius Society Journal no. 104 (1990): 15–16. &RPPHQWDU\RQWKHZRUNDVEURDGFDVWLQWKH¿QDOFRQFHUWRIWKH Delius Festival.

1717. Payne, Anthony. “Also Sprach Delius.” Music and Musicians 13 (November 1964): 20–21. Background information and commentary on A Mass of Life. There are no musical examples.

1718. Pirie, Peter J. “A Mass of Life.” Music and Musicians 23 (May 1975): 28–29. Description and evaluation of the work, in preparation for a performance by the Royal Choral Society.

1719. Puffett, Derrick. “A Nietzschean Libretto: Delius and the Text for a Mass of Life.” Music and Letters 79 (May 1998): 244–267. Reprint, Derrick Puffett on Music, edited by Kathryn Bailey Puffett, pp. 47–82. Aldershot: Ashgate, 2001. ISBN 0754603997. ML 60.P984 2001. Notes that the original layout and orthography was not preserved when the libretto was printed. The author provides a version of the libretto based on the new critical edition of Nietzsche’s writings (1988). Delius’s additions to and omissions from Nietzsche’s text are marked. Includes musical examples.

1720. Sackville-West, Edward. “Apropos of Delius.” Spectator 134, no. 5050 (11 April 1925): 589–590. Review of a performance with Roy Henderson as soloist and Paul Klenau, conductor.

1721. Schrenk, Walter. “Delius Messe des Lebens in Berlin.” Musikblätter des Anbruch (December 1927): 434. Review of a performance conducted by Carl Schuricht. Bibliography 291

1722. Schubert, Giselher. “Frederick Delius: Eine Messe des Lebens: Kommentare und analytische hinweise.” In Beitrage zur Geschichte des Oratoriums seit Handel: Festschrift Gunther Massenkeil zum 60. Geburtstag, edited by Rainer Cadenbach and Helmut Loos, pp. 357–377. Bonn: Voggenreiter, 1986. ISBN 3802401468. ML 55.M3 1986. Discussion and analysis of the Nietzsche text of A Mass of Life, including its form, use of motives, and the relationship of the text to the music. Includes musical examples and references.

On Hearing the First Cuckoo in Spring

1723. Hold, Trevor. “Grieg, Delius, Grainger, and a Norwegian Cuckoo.” Tempo no. 203 (1998): 11–19. Delius’s On Hearing the First Cuckoo in Spring is indebted to Edvard Grieg’s arrangement of the Norwegian folksong I Ola-dalom, i Olakjönn. Delius’s work is compared to Grieg’s arrangement and concludes with DORRNDWWKHFXFNRRLWVVRQJDQGKRZLWPLJKWKDYHLQÀXHQFHG'HOLXV

1724. Palmer, Geoffrey, and Noel Lloyd. “Delius: On Hearing the First Cuckoo in Spring.” In Music Tells the Tale: A Guide to Programme Music, pp. 34–36. London: F. Warne, 1967. MT 6.P177 M9. %ULHIELRJUDSKLFDOSUR¿OHDQGGHVFULSWLYHQRWHV

Paa Vidderne

1725. “Monte Carlo: Fritz Delius, ‘Sur les cimes’ (‘Paa Vidderne’), komponeret over en tekst af Henrik Ibsen.” Skandinaviske Signaler no. 4 (June 1894): 29. Review. In Danish.

1726. Lowe, Rachel. “Delius’s First Performance.” Musical Times 106, no. 1465 (March 1965): 190–192. The discovery of a program dated 10 October 1891 presents evidence RI WKH ¿UVW SXEOLF SHUIRUPDQFH RI DQ\ 'HOLXV ZRUN Paa Vidderne performed by the Christiana Music Society. Delius’s correspondence is subsequently combed for additional information about this performance. Includes musical examples.

Paris

1727. Barthelmes, Barbara. “Grobstadt und Musik.” In Musikwissenschaft zwischen Kunst, Ästhetik und Experiment: Festschrift Helga de la Motte- 292 Frederick Delius: A Research and Information Guide

Haber zum 60. Geburtstag, pp. 29–40. Würzburg: Königshausen and Neumann, 1998. ISBN 382601524X. ML 55.M587 1998. Delius’s Paris: A Nocturne (The Song of a Great City) is one of four works examined. In German.

1728. Grew, Sydney. “Delius’s Paris, the Song of a Great City.” Musical Opinion (March 1911): 408. Descriptive notes.

Piano Concerto

1729. “Mr. Delius’s Pianoforte Concerto.” Musical Times 48, no. 777 (November 1907): 739. 5HYLHZ RI WKH ¿UVW (QJOLVK SHUIRUPDQFH RQ  2FWREHU  ZLWK Theodor Szánto as soloist.

1730. “Piano Concerto (Delius, Frederick).” International Music Score Library Project/Petrucci Music Library: The Public Domain Music Score Library. http://imslp.org/wiki/Piano_Concerto_%28Delius%2C_Frederick%29 (accessed 20 October 2008). Contains the two-piano reduction by Otto Singer (Harmonie Verlag, 1907).

1731. Anderson, Colin. “Insights and Ideas from Conductor David Lloyd- Jones.” Fanfare 29, no. 3 (January–February 2006): 40–43. Lloyd-Jones discusses his musical background, love of Russian and British classical music, and an upcoming recording project featuring the original three-movement version of Delius’s piano concerto for Hyperion (see D84).

1732. Anderson, Colin. “Piers Lane, on Exploring a Pandora’s Box of Musical Treasures.” Fanfare 29 (March–April 2006): 43–45. The pianist Piers Lane discusses recording the piano concerto in the version played by Julius Buths (1904) (see D84).

1733. Friskin, James, and Irwin Freundlich. “Frederick Delius (1863–1934).” In Music for the Piano: A Handbook of Concert and Teaching Material from 1580 to 1952, p. 367. New York: Rinehart, 1954. Reprint, New York: Dover, 1973. ML 128.P3 F7. A brief description and publisher information is given for the Piano Concerto. Bibliography 293

1734. Hinson, Maurice. “Frederick Delius (1882–1934).” In Music for Piano and Orchestra: An Annotated Guide, pp. 78–79. Bloomington: Indiana University Press, 1993. ISBN 0253339537. ML 128.P3 H53 1993. Contains a brief description of Delius’s compositional style and commentary on the Piano Concerto. Delius’s birth date is erroneously given as 1882 (an error that also appears in the 1981 edition).

1735. Hughes, Gervase. “Delius’ Piano Concerto.” In Sidelights on a Century of Music (1825–1924), pp. 39–44. London: Macdonald, 1969. Reprint, New York: St. Martin’s Press, 1970. ISBN 0356028334. ML 196.H83 1970. This collection of writings about lesser-known or overshadowed music and musicians includes an essay about Delius’s Piano Concerto.

1736. Lachert, Piotr. “Zlote Klawisze.” Ruch Muzyczny 48, no. 19 (19 September 2004): 36–37. 7KH3LDQR&RQFHUWRLVEULHÀ\GLVFXVVHGLQWKLVVXUYH\RIODWHQLQHWHHQWK century piano concertos.

1737. Threlfall, Robert. “Delius’s Second Thoughts, and an Unknown Version of His Piano Concerto,” parts 1 and 2. Musical Opinion 93 (August 1970): 579–581; 95 (October 1971): 14–15. Revised reprint, “The Early Versions of Delius’s Piano Concerto,” Delius Society Journal no. 86, pp. 239–247. Traces the various versions of the Piano Concerto.

Preludes for Piano

1738. “3 Preludes (Delius, Frederick).” International Music Score Library Project/Petrucci Music Library: The Public Domain Music Score Library. http://imslp.org/wiki/3_Preludes_%28Delius%2C_Frederick%29 (accessed 20 October 2008). Contains the score issued by the Anglo-French Music Company, 1923.

1739. Bryant, Celia Mae. “A Delius Prelude.” Clavier 4 (September 1965): 30–33. Biographical sketch of Delius and teaching instructions for Preludes for piano, no. 2. The music for the prelude is printed in full.

1740. “The Nelson Riddle Collection, 1900–1995, MMS 4.” University of Arizona School of Music. http://web.cfa.arizona.edu/riddle/(accessed 20 October 2008). 294 Frederick Delius: A Research and Information Guide

The Nelson Riddle Collection consists of some 126 linear feet of materials, including musical arrangements, correspondence, photographs, and recordings. The above link is to the online collection inventory. Riddle orchestrated Delius’s Three Piano Preludes; these arrangements were premiered at the Hollywood Bowl on 26 July 1960.

Requiem

1741. Bogen, Artur. “Requiem von Frederick Delius: Zur Uraufführung im Rühlschen Gesangverein in Frankfurt.” Musikblätter des Anbruch 4, no. 9–10 (May 1922): 154–15. Review. In German.

1742. Carley, Lionel. “Delius’s Song of the Earth.” Fanfare from the Royal Philharmonic Society no. 3 (spring 1994): 3–4. Reprint, The Delian (October 1997): 5–6. Background material on the Requiem. According to the author, the reprinted article contains some errors.

1743. Payne, Anthony. “Delius’s Requiem.” Tempo no. 76 (1966): 12–17. An in-depth analysis of the work. Includes musical examples and a reproduction of the Kapp drawing of Delius.

1744. Payne, Anthony. “Resurrected Requiem.” Music and Musicians 14 (January 1966): 41–42. Commentary and review of a performance by the Royal Liverpool Philharmonic Choir and Orchestra, conducted by Charles Groves.

1745. Rippin, John. “Delius’ Requiem.” Musical Opinion 89 (May 1966): 465–467. Provides a description and commentary of the Requiem, along with Delius’s authorized “explanation” of the work. There are no musical examples.

1746. Robertson, Alec. “Requiems of the First World War: Foulds, Elgar, Bliss, Delius.” In Requiem: Music of Mourning and Consolation, pp. 262–264. London: Cassell, 1967. Also published: New York: Praeger, 1968. ML 3088.R62. Provides critical evaluation of A World Requiem by John Foulds (1880– 1939), The Spirit of England by Edward Elgar, Morning Heroes by Arthur Bibliography 295

Bliss, and Delius’s Requiem. The discussion of the Delius work receives the bulk of the coverage in this chapter. Includes musical examples.

Romance for Violoncello and Piano

1747. “Delius Cello Work Newly Discovered.” Boosey and Hawkes Newsletter 10 (winter/spring 1976–1977): 6. Notes the rediscovery of Romance, for violoncello and piano. The ¿UVW SHUIRUPDQFH RI WKH ZRUN ZDV JLYHQ E\ -XOLDQ /OR\G :HEEHU LQ Helsinki. Also notes plans to publish two Delius orchestral works and the availability of miniature scores for Fennimore and Gerda and the Piano Concerto.

Sea Drift

1748. Lambert, Constant. “Delius and Sea Drift.” Radio Times (27 January 1933): 188. Descriptive notes for an upcoming broadcast. The text of Sea Drift was printed on p. 223.

1749. Smith, Ken. “Discovering a Masterwork: The Ebbs and Tides of Delius’s Sea Drift.” Chorus! (May 1993): 5. 'HVFULEHV WKH GLI¿FXOWLHV HQFRXQWHUHG ZKLOH SUHSDULQJ Sea Drift for performance, namely Delius’s disregard for prosody and narrative structure and human limitations in performance. Includes musical examples.

1750. Sutton, Wadham. “Music and the Sea.” Musical Opinion 94 (June 1971): 445–446. A survey of music inspired by the sea, including Sea Pictures by Edward Elgar, La Mer by Claude Debussy, Songs of the Sea by Charles Villiers Stanford (1852–1924), Sea Symphony by Ralph Vaughan Williams, Sea Wanderers by Granville Bantock, and Delius’s Sea Drift.

1751. Weltzien, O. Alan. “Walt Whitman and Frederick Delius, Endlessly Rocking.” Walt Whitman Quarterly Review 13, no. 3 (1996): 129–148. Examines Delius’s use of Whitman’s “Out of the Cradle” in Sea Drift, and the cross-disciplinary origins of the work. The author traces the IRUPDO DQG SKLORVRSKLFDO DI¿QLWLHV EHWZHHQ WKH :KLWPDQ SRHWU\ DQG Delius’s setting of it in detail with musical examples. 296 Frederick Delius: A Research and Information Guide

Seven Danish Songs

1752. Debussy, Claude. “At the Société Nationale: Orchestral Concert.” In Debussy on Music: The Critical Writings of the Great French Composer Claude Debussy, edited by François Lesure, pp. 15–19. New York: .QRSI5HYLHZ¿UVWSXEOLVKHGLa Revue Blanche (1 April 1901). &RPSLODWLRQ¿UVWSXEOLVKHGDVMonsieur Croche et autres écrits. Paris: Gallimard, 1971. ISBN 0394481208. ML 410.D28 A333. English translation, “Debussy on Delius Songs.” Delius Society Journal no. 59 (1978): 12–13. Reprint of a review of Delius’s Danish Songs in which the French composer Claude Debussy (1862–1918) describes the songs as “music to soothe convalescents in well-to-do neighborhoods.” The editor notes that these exact words were later used to describe Edvard Grieg’s The Swan! The English translation that appears in the Delius Society Journal was done by Sydney Vale.

The Song of the High Hills

1753. Boyle, Andrew J. “The Song of the High Hills.” Studia musicologica norvegica 8 (1982): 143–148. A study of the work for wordless chorus and orchestra. The author describes this work as the culmination of Delius’s “mountain music”— music that was inspired by the Norwegian mountains. Includes musical examples and a summary of the article in Norwegian.

1754. Kennedy, Michael. “The Song of the High Hills.” Hallé no. 73 (December 1954): 1–3. Descriptive notes in preparation for a performance by the Hallé Orchestra and Choir, conducted by Sir John Barbirolli.

Songs of Sunset

1755. “Songs of Sunset (Delius, Frederick).” International Music Score Library Project/Petrucci Music Library: The Public Domain Music Score Library. http://imslp.org/wiki/Songs_of_Sunset_%28Delius%2C_Frederick%29 (accessed 20 October 2008). Score issued by F. E. C. Leuckart, 1911.

Summer Night on the River

1756. Ainsley, Rob. “Music for Summer Days.” Classic CD no. 51 (August 1994): 36–37. Bibliography 297

Includes Summer Night on the River in a list of “summer”-themed music. Includes a brief discography.

To Be Sung of a Summer Night on the Water

1757. “Frederick Delius: To Be Sung of a Summer Night on the Water.” Choral Public Domain Library. http://wso.williams.edu/cpdl/sheet/deli-tob.pdf (accessed 20 October 2008). Score and audio clip.

A Village Romeo and Juliet

1758. A Village Romeo and Juliet. Internet Movie Database. http://www.imdb. com/title/tt0884222/ (accessed 20 October 2008) The entry for the video release of the opera (1992) contains a cast list and credits.

1759. “A Village Romeo and Juliet. (Delius, Frederick).” International Music Score Library Project/Petrucci Music Library: The Public Domain Music Score Library. http://imslp.org/wiki/A_Village_Romeo_and_ Juliet_%28Delius%2C_Frederick%29 (accessed 20 October 2008). Contains a piano transcription by Harold Perry of The Walk to the Paradise Garden (Harmonie, 1910).

1760. “A Village Romeo and Juliet: The Story of Frederick Delius’s Opera.” Music Teacher (May 1932): 245–246. 'HVFULSWLYH QRWHV DQG EULHI ELRJUDSKLFDO SUR¿OH ,QFOXGHV PXVLFDO examples.

1761. “Village Romeo and Juliet, A.” In Plots of the Operas: 266 Stories of the Operas, edited by Oscar Thompson, pp. 490–491. Cleveland, Ohio: World Publishing, 1943. MT 95.T54 P6 1943. Provides information on the libretto, a list of characters, and a synopsis drawn from the editor’s International Cyclopedia of Music and Musicians.

1762. Almquist, Sharon G. “A Village Romeo and Juliet.” In Opera Mediagraphy: Video Recordings and Motion Pictures, pp. 175–176. Westport, Conn.: Greenwood Press, 1993. ISBN 0313284903. ML 158. O6 O64 1993. The entry for this opera includes information on the production company, primary distributor, running time, catalog number, soundtrack, language, 298 Frederick Delius: A Research and Information Guide

credits, and reviews. In the credits, the names of the singers as well as the actors and actresses are given.

1763. Blom, Eric. “A Village Romeo and Juliet: The Story of Frederick Delius’s Opera.” Music Teacher (August 1932): 375. Descriptive notes.

1764. Chop, Max. “Der Fall Delius in Berlin (Romeo und Julia auf dem Dorfe).” Kritik der Kritik pt. 10 (1907). Reprint with English translation, Jones, Philip, ed. The Collected Writings of the German Musicologist Max Chop on the Composer Frederick Delius (see no. 57), p. 249. Critical commentary in response to a review of the opera.

1765. Cooke, Deryck. “Delius’s Operatic Masterpiece.” Opera 13 (April 1962): 226–232. Describes the writing of A Village Romeo and Juliet, plus plot information and an assessment of the music.

1766. Davidson, Gladys. “A Village Romeo and Juliet.” In More Stories from the Operas pp. 48–57. London: T. Werner Laurie, 1924. Also published: Philadelphia: J. B. Lippincott, 1924. MT 95.D282. ([WHQGHG V\QRSVLV DQG D EULHI ELRJUDSKLFDO SUR¿OH RI 'HOLXV SS ± 6LPLODUV\QRSVHVRIWKHRSHUDDQGSUR¿OHRI'HOLXVDSSHDULQ Davidson’s other compilations, Standard Stories from the Operas (pp. 584–593. London: T. Werner Laurie, 1935) and The Barnes Book of the Opera (pp. 176–179. New York: A. S. Barnes, 1962).

1767. Dent, Edward J. “English Opera in Berlin (A Village Romeo and Juliet).” Monthly Musical Record (April 1907). Reprint, Redwood, Christopher, A Delius Companion (see no. 59), pp. 25–30. A review of the opera’s premiere.

1768. Dent, Edward J. “Music: A Village Romeo and Juliet.” Athenæum, no. 4691 (26 March 1920): 422–423. Review of the Covent Garden revival of the opera conducted by Sir Thomas Beecham.

1769. Hammond, Tom. “A Village Romeo and Juliet.” Music and Musicians (April 1962): 21, 45. Preview of the production to be staged at the Delius Centenary Festival, Bibliography 299

Bradford, and London. Includes cast list, synopsis, and illustrations by designer Leslie Hurry.

1770. Heseltine, Philip. “Contingencies.” The Sackbut 1 (May 1920). Reprint, Delius Society Journal no. 94 (1987): 17–20. Writing as “Prosdocimus,” Heseltine discusses the reception of the opera A Village Romeo and Juliet, recently revived by Sir Thomas Beecham.

1771. Hilb, Emil. “Frederick Delius.” In The Metropolitan Book of the Opera, edited by Pitts Sanborn, pp. 63–64. New York: Simon and Schuster, 1937. Also published: Garden City, N. Y.: Garden City Publishing Co., 1942. MT 95.S19 1937. Provides a biographical sketch, notes on Delius’s musical style, and a synopsis of A Village Romeo and Juliet.

1772. Holl, Karl. “Frederick Delius, Romeo und Julia auf dem Dorfe.” Musikblätter des Anbruch 10, no. 1 (January 1928): 20. Review. In German.

1773. Hussey, Dyneley. “An English Opera.” Spectator 153, no. 5532 (6 July 1934): 15. Review of A Village Romeo and Juliet given at the Royal College of Music.

1774. Kestner, Joseph A. “Deathless Love.” Opera News 50 (18 January 1986): 11–15. A Village Romeo and Juliet is mentioned as one example of an opera inspired by the legend of Romeo and Juliet.

1775. Klein, John W. “Delius’s Advance to Mastery.” Tempo no. 60 (1961– 1962): 2–6. A discussion of the opera A Village Romeo and Juliet.

1778. Klein, John W. “Delius’ Greatest Masterpiece.” The Chesterian 36, no. 208 (1961): 43–49. Background information on the Opera A Village Romeo and Juliet.

1777. Klein, John W. “Delius’s Masterpiece—After 42 Years!” Musical Opinion 85 (April 1962): 399–401. The author recalls the 1920 production of A Village Romeo and Juliet 300 Frederick Delius: A Research and Information Guide

and looks forward to the upcoming Sadler’s Wells production. He calls WKLVRSHUD³WKH¿QHVWRIDOO%ULWLVKRSHUDV´

1778. Klein, John W. “Delius’ Neglected Masterpiece.” Music Magazine/ Musical Courier 164 (January 1962): 18. Describes the revival of Delius’s opera A Village Romeo and Juliet for the upcoming Bradford Delius Festival (April 1962).

1779. Klein, John W. “‘The Loveliest of Operas’.” Musical Times 103 (April 1962): 227–228. Provides background information on A Village Romeo and Juliet, proclaimed by one critic to be “the loveliest of operas” in a review of a 1934 production at the Royal College of Music. Includes an illustration of Leslie Hurry’s design for the fairground scene.

1780. Kolb, Waltraud. “Romeo und Julia auf dem Dorfe: von der Novelle zur Oper.” Lenau-Forum 19, nos. 1–4 (1993): 57–71. A study of the opera A Village Romeo and Juliet, based on the story “Romeo und Julia auf dem Dorfe” (1856) by Gottfried Keller.

1781. Mackinnon, Douglas A. “Delius in Yorkshire.” Opera News 26, no. 24 (5 May 1962): 29–30. Review of the Delius Centenary Festival Sadler’s Wells production at Bradford.

1782. Mann, William. “A Village Romeo and Juliet.” The Listener 67, no. 1723 (5 April 1962): 617. Background information on the opera in preparation for an upcoming broadcast.

1783. Mellers, Wilfrid. “A Village Romeo and Juliet as a Parable of Childhood, Love, and Death.” In Singing in the Wilderness: Music and Ecology in the Twentieth Century, pp. 13–21. Urbana: University of Illinois Press, 2001. ISBN 0252025296. ML 197.M268 2001. Essay.

1784. Milnes, Rodney. “A Village Romeo and Juliet.” Opera 31, no. 8 (August 1980): 824–825. Bibliography 301

Review of the English National Opera North production at the Grand Theatre, Leeds, 29 May 1980.

1785. Milnes, Rodney. “A Village Romeo and Juliet.” Opera 35, no. 8 (August 1984): 929. Review of the Opera North production at the Grand Theatre, Leeds, 6 June 1984.

1786. Newstone, Harry. “A Village Romeo and Juliet.” Disc 3 (Spring 1949): 74–77. Background information to the opera and review of a recording made under the auspices of the Delius Trust (HMV DB 6751/62).

1787. Nichelson, Dennis. “Washington.” Opera News 37, no. 1 (July 1962): 22. Review of the Opera Society of Washington production with particular attention to the multimedia approach to the production. Includes a photograph from the production.

1788. Porter, Andrew. “Bradford: Delius Centenary Festival.” Musical Times 103 (May 1962): 326–327. After a few remarks on the Delius Festival, the author gives background information and a review of a performance of A Village Romeo and Juliet staged in conjunction with the festival. Includes a photograph of John :DNH¿HOGDQG(OVLH0RULVRQLQWKHWLWOHUROHV

1789. Schultze, Adolf. “Romeo und Julia auf dem Dorfe: romantische Idyll von Frederik Delius.” Neue Zeitschrift für Musik/Musikalisches Wochenblatt, no. 10 (7 March 1907): 243. Review of the premiere at the Komische Oper, Berlin, 21 February 1907.

1790. Von Uthmann, Jörg. “The Alpine Muse.” Opera News 72 (May 2008): 46–49. The Swiss writer Gottfried Keller inspired many composers, including Delius, who turned Keller’s novella into the opera A Village Romeo and Juliet.

1791. Warrack, John. “Bradford Delius Festival.” Opera 13 (May 1962): 342–345. 302 Frederick Delius: A Research and Information Guide

A review of the Delius Festival performance. Includes cast list and a photograph of the lead characters.

Violin Concerto

1792. “Violin Concerto (Delius, Frederick).” International Music Score Library Project/Petrucci Music Library: The Public Domain Music Score Library. http://imslp.org/wiki/Violin_Concerto_%28Delius%2C_Frederick%29 (accessed 20 October 2008). Contains the piano reduction prepared by Philip Heseltine (Augener, 1919).

1793. Blom, Eric. “Delius, Concerto for Violin and Orchestra.” Music Teacher (August 1932): 375. Descriptive notes.

1794. Tovey, Donald F. “Violin Concerto.” In Essays in Musical Analysis, Vol. 3, pp. 203–205. London: Oxford University Press, 1936. MT 90.T6 E8. Analysis with musical examples.

Violin Sonatas

1795. “Violin Sonata (Delius, Frederick).” International Music Score Library Project/Petrucci Music Library: The Public Domain Music Score Library. http://imslp.org/wiki/Violin_Sonata_No.1_%28Delius%2C_ Frederick%29 (accessed 20 October 2008). Score and part (Forsyth, 1917).

1796. Beechey, Gwilym. “Delius’s Violin Sonatas.” Musical Opinion 107 (June 1984): 259–261. Description and commentary on the four violin sonatas.

1797. Bye, Frederick. “The Two Violin Sonatas of Frederick Delius,” parts 1 and 2. Strad (January 1930): 484–486; (February 1930): 538. Analysis with musical examples.

1798. Van der Straeten, E. “Modern Violin Solos, Frederick Delius, Sonata no. 2.” Strad 37 (November 1926): 403–404. Analysis and review of the score edited by Albert Sammons and Evlyn Howard-Jones. No musical examples. Bibliography 303

Violoncello Concerto

1799. Bennett, J. R. “Delius and the ’Cello Concerto.” Hallé (November 1953): 7–9. Brief background and analysis of the work. Includes musical examples.

1800. Dale, S. S. “Contemporary Cello Concerti: Delius and Dohnanyi.” Strad 86 (September 1975): 341–349. Biographical sketches of the two composers and analyses of their concertos for violoncello.

1801. Harrison, Beatrice. “From the Performer’s Point of View.” Music Bulletin (August 1927). Reprint, “The Cello and the Nightingales.” Delius Society Journal no. 87 (1985): 38–39. A brief excerpt about the Violoncello Concerto taken from Miss Harrison’s autobiography, The Cello and the Nightingales (see no. 1019).

1802. Heseltine, Philip. “Music.” Weekly Westminster Gazette 2 (14 July 1923): 14. Descriptive notes on Delius’s Violoncello Concerto.

1803. Kupferberg, Herbert. “They Shall Have Music: Music of Our Time.” Atlantic 217, no. 5 (May 1966): 118–120. Feature review of recordings of composers “who exist apart from the mainstream.” The Delius recording included is Angel S-36285 (Jacqueline du Pré with the Royal Philharmonic Orchestra conducted by Malcolm Sargent), recorded under the auspices of the Delius Trust.

Violoncello Sonata

1804. “Cello Sonata (Delius, Frederick).” International Music Score Library Project/Petrucci Music Library: The Public Domain Music Score Library. http://imslp.org/wiki/Cello_Sonata_%28Delius%2C_Frederick%29 (accessed 20 October 2008). Score (Winthrop Rogers, 1919).

1805. Bye, Frederick. “Frederick Delius, Sonata for Cello and Piano.” Strad (November 1929): 343–344. Analysis with musical examples. 304 Frederick Delius: A Research and Information Guide

“The Walk to the Paradise Garden”

1806. Doran, Mark. “Wagner and the ‘Paradise Garden’: An Inter-Operatic Reference in Delius.” Tempo no. 216 (2001): 24–29. At the conclusion of Delius’s “Walk to the Paradise Garden” (from A Village Romeo and Juliet) there is a brief reference to the closing portion of “Liebestod” from Richard Wagner’s Tristan und Isolde. The author claims this went “unobserved by Delians everywhere,” but Eric Fenby does note the similarity in his book Delius (pp. 49–50, see no. 850).

Zum Carnival Polka

1807. Hinson, Maurice. “Frederick Delius: Individualist and Student of Nature.” Clavier 20 (September 1981): 26–31. Provides an overview of Delius’s life and keyboard works and gives performance suggestions for Zum Carnival Polka. Includes the entire score.

“Zwei bräune Augen”

1808. Gillespie, Don. “Frederick Delius’s Zwei braune Augen.” In The Rosaleen Moldenhauer Memorial: Music History from Primary Sources, a Guide to the Moldenhauer Archives, edited by Jon Newson and Alfred Mann, pp. 206–212. Washington, D.C.: Library of Congress, 2000. ISBN 0844409871. ML 93.R67 2000. Available online, http://memory. loc.gov/ammem/collections/moldenhauer/2428126.pdf (accessed 20 October 2008). Describes the manuscript of the 1885 song, “Zwei bräune Augen,” a setting of a poem by Hans Christian Andersen in a German version by Wilhelm Henzen. Includes some background information on Delius’s Florida years, a comparison of the setting with that of Edvard Grieg, and DIDFVLPLOHRIWKH¿UVWSDJHRIPXVLF

Audiovisual Resources

Commercially Produced Films and Video

1809. Beecham: Chicago Symphony Orchestra, 20 March 1960. (VHS). West Long Branch, N.Y.: Kultur, 2000. Kultur 2239. ISBN 0769775012. Also issued: New York: Warner Music Vision/NVC Arts, n.d. Warner Music Vision 8573-84096-3. Beecham conducts the second movement of the Florida Suite (“On the River”). Bibliography 305

Reviewed: Delius Society Journal no. 129 (2001): 87.

1810. Delius: Song of Summer. (DVD). London: British Film Institute, 2001. BFIVD 518. Encoded for all regions. , Maureen Pryor, , actors; , director and producer; photographer, Dick Bush. '9'UHLVVXHRIWKH¿OP VHHQR ,QFOXGHVFRPPHQWDU\E\WKH director and an on-screen biography.

1811. Discovering Delius: A Portrait of Frederick Delius, 1862–1934. (VHS-PAL). London: Landseer Film and Television Productions for the Delius Trust in association with RM Associates, 1992. Produced and written by Jan Younghusband. Directed and narrated by Derek Bailey. 59:00. 'RFXPHQWDU\ ¿OP FRQFHQWUDWLQJ RQ WKH HDUO\ DQG PLGGOH SRUWLRQV RI Delius’s life, and the works of Delius. Includes several musical excerpts ¿OPHGLQ1RUZD\DQG*UH]VXU/RLQJFRPPHQWDU\E\VHYHUDO'HOLXV experts (Robert Threlfall, Felix Aprahamian, Anthony Payne, Eric )HQE\ DQGDQH[WUDFWIURP.HQ5XVVHOO¶V¿OPSong of Summer (see no. 1820). Featured performers: Tasmin Little; Julian Lloyd-Webber; Thomas Hampson; David Wilson-Johnson; Brindisi Quartet; Orchestra; Brabant Orchestra; Brighton Festival Orchestra/ Charles Mackerras, Richard Armstrong, conductors. Reviewed: Delius Society Journal 111 (1993): 21–22.

1812. From the High Solitudes ¿OP 15.7HOHYLVLRQ ,QFOXGHVDQH[WUDFWIURPWKH¿OPPaa Vidderne (see no. 1816).

1813. Ken Russell at the BBC. (DVD). London: BBC Video, 2008. 3000017038. Encoded for Region 1. Disc three of this set includes Russell’s Song of Summer (see no. 1817). Extra features of the DVD set include “Ken Russell in Conversation” and “Russell at Work.”

1814. The Lost Child. (VHS-PAL). London: BBC, 1997. Presented and performed by Tasmin Little; produced and directed by Michael Darlow. This program, featuring the violinist Tasmin Little, was originally broadcast on BBC2 (29 June 1997). Little traveled to Florida to gather evidence on whether Delius fathered a child while he lived in Florida. Includes footage of a Delius Association of Florida meeting, as well as 306 Frederick Delius: A Research and Information Guide

Jacksonville University, where a collection of Delius memorabilia and the reconstructed Delius cottage reside.

1815. “Modern Ballet,” A Time to Dance  PP ¿OP  %RVWRQ :*%+ 1959. 29:00. Reissued as videocassette (VHS). Bloomington, Ind.: Indiana University Audio-Visual Center, 1970. Discusses and illustrates ballet trends and developments since the 1940s. Includes excerpts from various Antony Tudor ballets, including Romeo and Juliet.

1816. Paa Vidderne ¿OP 15.7HOHYLVLRQ By Charles Farncombe.

1817. Sea Drift. (Film). Swedish Television, 1987. Per-Arne Wahlgren, Radiokoren, Radio Symfonikerna; Gustav Sjokvist, conductor; Benny Wilhelmson, photography; Margaretha Ferm, director, producer. c. 26:00.

1818. Sir John Barbirolli: Delius, Walton, Brahms. (DVD). Pleasantville, N.Y.: VAI, 2004. DVD 4304. Encoded for all regions. 94:00. Originally telecast in 1959. The only extant video of Barbirolli conducting the Boston Symphony Orchestra includes a performance of “The Walk to the Paradise Garden.”

1819. Song of Farewell PP¿OP /HHGV

1820. Song of Summer PP¿OP /RQGRQ%%&7HOHYLVLRQ0D[ Adrian, Maureen Pryor, Christopher Gable, actors; Ken Russell, director and producer; Dick Bush, photographer. $ELRJUDSKLFDO¿OPEDVHGRQ(ULF)HQE\¶VDelius As I Knew Him (see nos. 851–853). Reissued on DVD, 2001 under the title Delius: Song of Summer (see no. 1810), and 2008 as part of the set Ken Russell at the BBC (see 1813). Reviewed: Music and Musicians 17 (November 1968): 29; review and video clips, BFI Screenonline http://www.screenonline.org.uk/tv/ id/482807/(accessed 27 August 2008). Bibliography 307

1821. A Village Romeo and Juliet. (VHS-NTSC). London: Decca, 1992. Decca 071 234–3. Helen Field, soprano; Arthur Davies, tenor; Thomas Hampson, Barry Mora, baritones; Stafford Dean, bass; Arnold- Schönberg-Chor; ORF Symphonieorchester/Sir Charles Mackerras, conductor. Also released in LaserDisc [CLV] format. 9LGHRUHOHDVHRIDSURGXFWLRQ7KHPXVLFDOSRUWLRQVRIWKH¿OPZHUH recorded in the Grossersaal, Konzerthaus, Vienna, 1–13 February 1989. Produced by Mediascope, Munich, in coproduction with WDR Köln, ORF Vienna, CST Bratislava, BBC London, the Delius Trust, London, the Decca Record Company Limited, London. Includes program notes in English with French translation. Reviewed: Delius Society Journal no. 109 (1992): 18–20; Gramophone (December 1990) (videodisc); Fanfare 16 (November/December 1992): 487; Opera Quarterly 13, no. 3 (1997): 153–159 (VHS).

1822. A Village Romeo and Juliet. (DVD-NTSC). London: Decca, 2003. Decca B0000838–09. Helen Field, soprano; Arthur Davies, tenor; Thomas Hampson, Barry Mora, baritones; Stafford Dean, bass; Arnold- Schönberg-Chor; ORF Symphonieorchester/Sir Charles Mackerras, conductor. 171:00. Previously issued in laserdisc and VHS-NTSC formats, 1992; also issued in DVD-PAL format encoded for Region 2 (Decca 741779). DVD release of the 1992 video (see no. 1821). Additional material on WKH'9'LQFOXGHVWKH¿OPDiscovering Delius (see no. 1811). Includes program notes by Christopher Palmer and synopsis. Reviewed: Delius Society Journal no. 135 (2004): 68–70; Fanfare 27 (March–April 2004): 155.

Broadcasts, Podcasts, Etc.

1823. “Composer of the Week: Frederick Delius.” BBC Radio 3, 6–10 June 1994.

1824. “Composer of the Week: Frederick Delius.” BBC Radio 3, 8–12 March 1999. Composer factsheet available, http://thompsonian.info/Delius- BBC-3-week910.html (accessed 15 October 2008). A series of broadcasts highlighting the music of Delius. The archived composer factsheet features a biographical sketch.

1825. “Composer of the Week: Frederick Delius.” BBC Radio 3, 26–30 May 2008. http://www.bbc.co.uk/radio3/cotw (accessed 15 October 2008). 7KHZHESDJHLQFOXGHVSOD\OLVWVIRUWKH¿YHHSLVRGHVDQGDSRGFDVW 1826. “Great Composers: Delius.” Classic FM, 13 August 2000. Survey of Delius’s life and works. Christopher Redwood points out some errors and inconsistencies in a letter to the Delius Society Journal no. 128 (2000): 92.

1827. Suchet, John. “The Part Played by Money in the Life of the Great Composers.” Classic FM, 12 June 1995. Delius was one the “great composers” included in this program; several of his works were heard in the broadcast.