Tobago Carnival Regatta — Got Off to a Fine Start Grenada Sailing Festival and in Carriacou Brutal

C A R I B B E A N On-line C MPASS MARCH 2009 NO. 162 The Caribbean’s Monthly Look at Sea & Shore

THE SOUTHERN CARIBBEAN CIRCUIT: Carriacou Sailing Series Grenada Sailing Festival and To b a g o Carnival Regatta

— see stories on pages 13 - 17 MARCH 2009 CARIBBEAN COMPASS PAGE 2 MARCH 2009 CARIBBEAN COMPASS PAGE 3 MARCH 2009 CARIBBEAN COMPASS PAGE 4

RUTH LUND ONNE VAN DER WAL The Caribbean’sMonthlyLookatSea&Shore ietm o oa aes... 12 Fine timeforlocalracers ...... Around St.Croix It’s NiceinNevis 20 A junglerivercruise ...... Oh, Mánamo! Grenada eventhadit Sail Fest2009 See Writers’Guidelinesatwww.caribbeancompass.com.Sendsubmissions [email protected]. Caribbean Compass [email protected] Dominica MarineCenter,Tel:(767)448-2705, Dominica: [email protected] Tel: (5999)767-9042,Fax:767-9003, Curaçao: Tel/Fax: (246)423-4600 Barbados: [email protected] Tel (268)720-6868 Antigua: Compass AgentsbyIsland: [email protected] Accounting...... Debra Davis [email protected] Art, Design&Production...... WilfredDederer [email protected] Advertising &Distribution...... TomHopman [email protected] Assistant Editor...... ElaineOllivierre [email protected] Editor...... Sally Erdle www.caribbeancompass.com [email protected] Tel: (784)457-3409,Fax:457-3410 Bequia, St.VincentandtheGrenadines. Compass PublishingLtd.,P.O.Box175BQ, Caribbean Compass Cruising Kids’Corner 34 ...... 33 Cartoons ...... Sailors’ Horoscope Island Poets 33 ...... Word SearchPuzzle 32 ...... Cruising Crossword Different Boats 26 ...... 18 Regatta News...... 9 Business Briefs ...... AdSales&Distribution-LucyTulloch Distribution - Cees de Jong Distribution-CeesdeJong Distribution - Doyle Sails Distribution-DoyleSails Distribution - Hubert J. Winston Distribution -HubertJ.Winston welcomes submissionsofshortarticles,newsitems,photosanddrawings. except shortexcerptsforreviewpurposes,maybemadewithoutwritten permissionofCompassPublishingLtd. ©2009 CompassPublishingLtd.Allrightsreserved.Noreproduction, copyortransmissionofthispublication, supplied byothercompanies. Compass PublishingLtd.acceptsnoliabilityfordelayeddistributionor printingqualityastheseservicesare responsibility foranystatementsmadetherein.Lettersandsubmissions maybeeditedforlengthandclarity. sole responsibilityoftheadvertiser,writerorcorrespondent,andCompass PublishingLtd.acceptsno We supportfreespeech! is published monthly by ispublishedmonthlyby MARCH 2009•NUMBER162 www.caribbeancompass.com ...... 33 ...... 32 ...... all ....14 ...... DEPARTMENTS ISSN 1605-1998 But the content of advertisements, columns, articles and letters to the editor are the Butthecontentofadvertisements,columns,articlesandlettersto editorarethe [email protected] Tel: (58-281)265-3844Tel/Fax:265-2448, Venezuela: [email protected] Tel: 868)634-2622Mob:(868)620-0978 Trinidad: Tel: (284)494-2830,Fax:494-1584 Tortola/BVI: Tel: (784)457-3527,[email protected] St. Vincent&theGrenadines: Tel: (340)7747931,[email protected] St. Thomas/USVI: Tel: (599)5533850,[email protected] Distribution -EricBendahan [email protected] Mob: +590(0)6904945 Advertisers’ Index 47 ...... 47 Classified Ads ...... 44 Caribbean Marketplace...... Breaking News 43 ...... Meridian Passage 42 ...... Readers’ Forum 40 ...... 38 Cooking withCruisers ...... Book Reviews 36 ...... 34 Dolly’s DeepSecrets ...... iassiga hmo!... 35 Tina’s stingrayshampoo! ...... Sea-Bath Shocker 23 Lingering inMayaland ...... Yucatan Time 22 The unexpectedhaven ...... Ad Sales & Distribution - Jack Dausend Ad Sales&Distribution-JackDausend Ad Sales & Distribution - Patty Tomasik AdSales&Distribution-PattyTomasik Ad Sales-StéphaneLegendre St. Maarten/St.Barths/Guadeloupe: [email protected] Tel: (758)484-0555, St. Lucia: [email protected] Tel: (0596)596686971,Mob:+(0)696932638 Martinique: Tel: (473)409-9451,[email protected] Ad Sales&Distribution-AlanHooper Grenada/Carriacou/Petite Martinique: Distribution-GladysJones Distribution - Bryan Lezama Distribution-BryanLezama Distribution -LisaKessell Ad Sales & Distribution - Isabelle Prado AdSales&Distribution-IsabellePrado

Ad Sales - Debra Davis, Ad Sales-DebraDavis, JOHN GIDEONSE JOHN 14 13 –15 11 9 9 8 Tortola,BVI,tel(284)495-1002,fax495-4184,[email protected], 8 6 –11 www.weyc.net (SMYC),tel(599)544-2075,fax544-2091,[email protected], 6 -9 5 -8 www.smyc.com 3 MARCH 24 DeclarationofIndependenceDay.Publicholiday 22 21 –30 20 18 –19 16 -3May 16 -21 15 –19 14 13 12 10 9 -13 9 -13 9 4 -28 APRIL FestivalinSt.Patrick’s,Grenada (758)452-8350,[email protected] 18 17 tel(596)632676,fax9448,[email protected] 14 –15 14 –15 14 –15 TBA 30 28 26 -May2 25 -30 24 –26 30 -Apr5 30 28 28 EmancipationDay.Publicholiday 26 -29 26 -29 DinghyRegatta,PuertoRico.www.culebrainternationalregatta.com 22 21 –22 20 -22 20 19 -22 18 -22 BaronBlissDay,PublicholidayinBelize CommonwealthDay.Publicholidayinsomeplaces InternationalWomen’sDay BudgetMarineMatchRacing,St.Maarten.MaartenYachtClub FULL MOON Cover Photo:WilfredDederer, TobagoCarnivalRegatta If youwouldlikeanauticalortourismevent listedFREEinourmonthlycalendar, NationalHeroesDay.Publicholiday FULLMOON,PublicholidayinSuriname(Phagwa) Earth Day EasterMonday.Publicholidayinmanyplaces GoodFriday.Publicholidayinmanyplaces Easter Sunday FlagDay.Publicholiday St.Patrick’sDay.Publicholiday SpiritualBaptistLiberationDay.PublicholidayinTrinidad&Tobago InternationalEarthDay

12thAnnualDarkandStormyRegatta,BVI.WestEndYachtClub(WEYC), 29thSt.MaartenHeineken Regatta.www.heinekenregatta.com euaEse eat.wwbgscmesergta Easterval,UnionIsland,[email protected] BequiaEasterRegatta.www.begos.com/easterregatta CaribbeanArts&CraftsFestival,BVI.www.caribbeanartisan.net niu lsi ah eat.wwatgalsiscm AntiguaClassicYachtRegatta.www.antiguaclassics.com 14thSt.BarthFilmFestival.www.st-barths.com/film-festival St.BarthsBucketRace.www.newportbucket.com/StBarthsIndex.htm InternationalRolexRegatta,St.Thomas,USVI.www.rolexcupregatta.com CulebraHeinekenInternationalRegattaand 7thAnnualSt.JohnBluesFestival,USVI.www.stjohnbluesfestival.com GrenadaRound-the-IslandRace. AroundSt.LuciaRace(tobeconfirmed).YachtClub(SLYC), GardelTrophyRace,Guadeloupe.www.triskellcup.com

at thetimethisissueof please sendthenameanddate(s)of eventandthename J/24 Regatta,Barbados.BarbadosYachtClub(BYC),[email protected] Celebrations TrophyRegatta,Guadeloupe.www.triskellcup.com (see adonpage11) St. CroixFoodandWineExperience.www.ATasteofStCroix.com (see adonpage13) 10th J/24 Invitational,Barbados.BYC Bananas CupRegatta,Martinique.YachtClubdelaMartinique(YCM), Guadeloupe toAntiguaRace. Marlin MadnessTournament,Trinidad&Tobago.TTGFA José deDiegoDay. Pan-American Day. Curaçao InternationalKiteFestival.www.curacaokites.com Plymouth JazzFestival,Tobago J/24 Regatta,Barbados.BYC Parade ofSail,St.Lucia.HonoringWorldARC2008arrivals.SLYC Cruiser/Racer OffshoreRegatta,Barbados.BYC 13th AnnualTobagoGameFishingTournament.www.tgft.com Queen’s Birthday. National HeroesDay. St.MaartenCarnival.www.stmaartencarnival.com 42ndAntiguaSailingWeek.www.sailingweek.com BVI SpringRegatta&SailingFestival.www.bvispringregatta.org so pleasecontacteventorganizersdirectly forconfirmation. All informationwascorrecttothebestofourknowledge

Transcaraibes Rally,GuadeloupetoCuba.www.transcaraibes.com contact informationoftheorganizingbody to , Holy Thursday.Publicholiday CALENDAR [email protected].

Public holiday

Public holidayinHaiti Public holidayinPuertoRico Compass

Public holidayinBarbados

in Aruba wenttopress—butplanschange,

www.sailingweek.com nMnsra; in Montserrat;

in Dutchislands

See adonpage12 in PuertoRico

in St.Vincent&theGrenadines

in USVI

in Venezuela MARCH 2009 CARIBBEAN COMPASS PAGE 5

goes to press. The strike was organized by St. Lucia’s Marine Park Fees Restructured St. Lucia’s Marine la Raye for the Canaries Anse The user-fee system three 40 feet: up to two days, EC$50; • Yachts up to to two days, than 40 up to 70 feet: up • Yachts more up to two days, EC$200; • Yachts more than 70 feet: charter boats: EC$945 • Foreign-flagged crewed for licensed localThere are also special arrangements cost EC$21 (which The daily dive permit will now the SMMA at (758) 459- For more information contact Barbecue Nights in Dominica Association of Helen Hepp reports: The Portsmouth For more information contact Helen Guadeloupe on Strike A general strike that began on January 20th contin- Marine Management Area (CAMMA) and the Area (CAMMA) and Marine Management which Management Area (SMMA), Soufriere Marine 2004, has constant since January 1st, has remained effective increased. The new fees, now been slightly as follows: March 1st, are EC$120 days to one week, EC$160 EC$70; three days to one week, three days to one week, N/A the visit) annually (or you can pay by office for more information. vessels — ask at the SMMA operation of the includes a contribution toward An annual dive island’s new hyperbaric chamber). A daily snorkeling permit permit is available at EC$60. now costs EC$5.50. stop by the office 5500 or [email protected], or Lucia. at 3 Bay Street, Soufriere, St. hosting weekly Yacht Security (PAYS) has begun are US$20 per person Sunday night barbecues. Tickets for dinner, including a free rum punch and of course, lots of music and dancing. All proceeds benefit PAYS and especially the night-security operations that we manage in the bay. The barbecue venue changes each week but anyone interested can contact their yacht services provider for help. at [email protected]. ues to cripple the island of Guadeloupe as this issue of Compass the Komité kont pwofitasyon (Anti-profiteering Committee), an umbrella group that brings together trade unions, political groups and several Creole cultural groups. The group demands that the price of essential goods be reduced. Living costs are high on the French islands, which depend heavily on imports and use the euro. —Continued on next page Grande Anse d’Arlet has long been a popular yacht anchorage in Martinique. Now you can clear in there, too

CHRIS DOYLE Gaby) has had permission from the French Customs from the French Customs Gaby) has had permission This restaurant department to do yacht clearances. in is situated just on the beach fresh water front of the wharf. It also offers and WiFi connection.

New Clearance Spot in Martinique news for yachties — it Isabelle Prado reports: Good is possible now to clear into Martinique at the pretty Martinique at the pretty is possible now to clear into d’Arlet. Since January anchorage of Grande Anse (previously Chez 1st, the restaurant P’tit Bateau & Updates & Info MARCH 2009 CARIBBEAN COMPASS PAGE 6 cognizant CoastGuardCaptainofthePortpriorto position oftheguardshastobeacceptable side) ofthevesselwhileinU.S.ports.Thenumberand total visibilityoftheexterior(bothlandsideandwater- armed privatesecurityguardsandthattheyhave that eachaccesspointtotheshipisguardedby or examination,vesselsmayberequiredtoensure waters; and Guard CaptainofthePortpriortoarrivalintoUS in aporttheabovecountry; by theship’smasterandCompanySecurityOfficer; met, orprovidedbyoutsidesecurityforcesapproved are notexceededand/orminimumhoursofrest sary toensurethatlimitsonmaximumhoursofwork crewmembers shouldbeplacedontheshipifneces- be providedbytheship’screw,however,additional the vesselisinportsabovecountry.Guardsmay rior (bothlandsideandwaterside)ofthevesselwhile ed andthattheguardshavetotalvisibilityofexte- mil/safetylevels) whileinaporttheabovecountry; equivalent toMARSECSecurityLevel2(seewww.uscg. ditions, vesselsmust: ing theirlastfiveportcalls.Accordingtothenewcon- on “vessels”thathavevisitedportsinVenezueladur- the followingconditionsofentryintoUnitedStates affected bythestrike. has toldjournaliststhatthisislandbeenless February. However,theMartiniquePromotionBureau social situation,andthesituationisdeteriorating.” has createdapoliticallychargedanddangerous tells in Guadeloupesincethestartofstrike.Anobserver banks, schoolsandgovernmentofficeshavebeenshut events havebeencancelled.Mostshops,restaurants, ships haveturnedawayfromtheisland,andpublic most businesses. up asmallpercentageofthepopulationcontrols on anislandwherealargelywhiteelitethatmakes — • BasedonthefindingsofCoastGuardboarding • ReportactionstakentothecognizantUSCoast • Logallsecurityactionsintheship’slog; • AttempttoexecuteaDeclarationofSecuritywhile • Ensurethateachaccesspointtotheshipisguard- • Implementmeasurespertheship’ssecurityplan Effective January23,theUSCoastGuardimposed New Venezuela-USRuleNOTforYachts! Martinique beganitsowngeneralstrikeinmid- Roads andtheairporthavebeenblocked,cruise Thestrikeisalsoexposingracialandclasstensions Continued frompreviouspage Compass The Marina at Marigot BayMarigot St. Lucia St. , “The absence of food, water and power , “Theabsenceoffood,waterandpower Yachting Destination intheCaribbean The MostExclusive • • • • • • • • • • First-Class Facilities,Services,andStaff • • • • • Enjoy High-endAmenities – Guests, Captains,andCrew Airport transfers Chandlery Shop Spare partordering anddelivery Business Center:FedEx,carrental, travelagency Liquor andfoodprovisioning Floral arrangements High-speed fueling Single andthree phaseelectricity(50and60Hz) connection WiFi andhighspeedinternet Yacht capacity:250feetLOA;44beam;16draft Shop high-endretail atTheMarinaVillage Rainforest tours,skyrides,bikeandmore Water sports andbars Seven localrestaurants Five StarLuxuryResortandSpa–DiscoveryatMarigotBay of Weather ReportslistingspublishedintheJanuaryissue quency) totheSelectedCaribbeanShortwave ational vessels.Thankgoodnessforsmallfavors. us thatthisrulingdoesNOTapplytoprivaterecre- US CoastGuard.Muchtoourrelief,hehasinformed Brown, InternationalPortSecurityEvaluationDivision, having visitedVenezuela, the least—foryachtskippersenteringUSwatersafter the vessel’sarrival. Government andPolicehavereportedlyrecognized and crewsto“cleanuptheirownact.”The calls withinthemega-yachtindustryforcaptains an illegaldrugatthetimeofhisdeathhaveledto street lightingisalsobeingcarriedout. as wellvehiclepatrolintheareas.”Improvementto police stationbuttheywillbeonpatrolbothfoot before,” hesaid.“Notjustpoliceofficersbeingatthe full 24-hourpolicing,whichwasn’tnecessarilyinplace up securityintheEnglishHarbourarea.“Thereisnow Police CommissionerThomasBennettpromisedtostep by theAntigua&BarbudaMarineAssociation,and tourism industriesatapromptlyheldmeetingchaired spoke withabout350membersoftheyachtingand lowing theincident.High-levelgovernmentofficials in thedockyardsbutsomeyachtsleftislandfol- in courtonFebruary2nd,andwasdeniedbail. public andnumeroustipsinthearrest.Lindseyappeared also incustody.Policecredittheinvolvementof believe wasusedinthecrime.Threeotherpeopleare the attacker. her handbag,andDrewwasthenshotwhilechasing was reportedlyshotinthefootduringastruggleover child onJanuary22nd.Hisgirlfriend,AlenaSitkova, near EnglishHarbourwithhisgirlfriendandtheiryoung ging attemptwhilewalkinghomefromarestaurant captain wasshotandkilledduringanapparentmug- the 163-footPeriniNaviketch for themurderof38-year-oldDrewGollan,captain 21-year-old SylvesterLindsey,aresidentofAntigua, hours at7250LSB,andthenhechangesto7086LSB. Please notethefollowingchanges(timeandfre- SSB WeatherReportChanges Realizing thatthisrulingwouldbeconfusing—tosay Meanwhile, reportsthatGollanwasinpossessionof The killingresultedinAntiguapoliceboostingpatrols Police havefounda.32-caliberhandgunthatthey Antiguan policehavearrestedandcharged Antiguan HeldinMega-YachtSkipper’sDeath Compass : George(KP2G)transmitsweatherat0710 Contact UsforDetails: Compass Perseus phonedMichael . TheAustralian www.marigotbay.com • • • • • Then cometoMarigotBay–weguarantee: Have youmadeplansforthesummeryet? Marigot Bay-Nature’s HurricaneHole Competitive low-seasonberthingrates andsurveillanceatalltimes Security patrols Mega yachtberthinginhurricaneconditions accommodations,services,andrelaxation.Excellent captainandcrew Best windandseashelterbetweenPuertoRicoVenezuela This Bajan-builtschoonerisonestepclosertolaunching —Continuedonnextpage be missedbyallwhoknewher. happy andwarm-heartedCaribbeancruiser,Milliewill Virgin Islands,Grenada,Curaçao,andTrinidad.A Bermuda, Florida,TheBahamas,PuertoRico,the Caribbean, fromMainetoVenezuela,including spent 25yearscruisingtheUSEastCoastand husband, Earl,movedontotheirsailboat, after ashortillness.Afterretiringin1975,sheandher Rochester, NewYork,passedawayonJanuary31st and fishingschoonerplyingCaribbeanwaters. auxiliary packet(carryingbothcargoandpassengers) should becompletednextyear.Hedescribesitasan gaff-rigged two-master,designedbyThomasColvin, shortly. Accordingtothebuilder,30-metre-long the sprayingonofseveralcoatspaintwillbegin hull isnowfullyplated.Sandblastingtogetrustoffand Our manNormanFariainBridgetownreportsthatthe in Barbadosandreportedupon crewmembers atgunpointanddemandedmoney. Antigua’s JollyHarbour.Theyheldthecaptainandtwo kayaks andpaddledouttoayachtanchoredat Gollan wasshot,fourmenarmedwithgunsstoletwo Caribbean Safety&SecurityNet,fourdaysbefore users anddealers. the needtoenforcea“nodrugs”policyforboth Mildred NewhallO’Laughlin,bornMarch24,1920in Eight Bells Remember thatBluenose-typeschoonerbeingbuilt Barbados Schooner-BuildUpdate In relatednews,accordingtoreportsreceivedbythe • [email protected]

• (758) 451-4275 Compass

• VHF Channel12 Sequin lastyear?

, and NORMAN FARIA NORMAN MARCH 2009 CARIBBEAN COMPASS PAGE 7 dur- special! Compass Compass Compass , Thursday, April 9th at the we welcome new advertisers AM contributors! If you’ve had an contributors! If Compass Compass Writers’ Brunch is held just at the beginning Writers’ Brunch is held just at shipments & marine services providing easy access for large • Drive-down dock Compass Writers’ Brunch Next Month Compass Writers’ Calling all By reservation only. Please RSVP by April 1st (no fool- By reservation only. Please St. Croix Food Festival the committee for the The St. Croix Foundation and showcases the The St. Croix Food & Wine Experience The event benefits the St. Croix Foundation (www.stx- For more information visit www.ATasteofStCroix.com Welcome Aboard! In this issue of garbage disposal & washroom cable TV, 24hr security, water, fuel, telephone & internet, many islands and checking out local events. They checking out local events. many islands and to get down and artists and love chat with musicians is shared with a local chef. All this to serious cooking on their website. or poem published in the article, photo invited to months, you are cordially ing the past 12 and join us at this year’s bring a guest Writers’ Brunch at 10:00 ever-popular Mac’s Pizzeria in Bequia. The annual ever-popular Mac’s Pizzeria Compass so you can stay on for a of the Bequia Easter Regatta, Writers’ Brunch is absolute- whole weekend of fun. The a special thank-you to ly free — it’s our way of saying the everyone who helps make Ciao Pizza of Union Island, page 37; Canash Beach Apartments of St. Vincent and Atlantic Yacht Deliveries of the UK, in the Market Place. Good to have you with us! ing!) to [email protected] or phone Sally ing!) to [email protected] at (784) 457-3409. and A Taste of St. St. Croix Food & Wine Experience 2009 schedule of fund- Croix have announced their culinary events will take raising events. The week of on St. Croix, US Virgin place April 15th through 19th industry and raise Islands, to celebrate the restaurant funds for the St. Croix Foundation. diverse cuisine and wine available on St. Croix. The multi-day event includes gourmet dinners, wine seminars, wine auctions, and the annual island-wide culinary competition, A Taste of St. Croix. foundation.org), a non-profit community foundation that administers a number of local programs. The event was started in 2001 by restaurant owners Katherine Pugliese, original owner of Bacchus and now an on-premise wine consultant with Premier Wines & Spirits, and Kelly Odom of Tutto Bene, and is recognized as the pre-eminent food and wine event in the Caribbean. • Electricity (110, 220 & 380 3-phase), with full marina facilities • 30 stern-to berths, 30 alongside berths up to 350’ LOA, 21’ Draft • Excellent dockage for Super-yachts . Fortuna The highlight of the week takes place on March 17th The highlight of the week takes Cruisers’ Site-ings Check out the slideshow of images from Alexis The German SiebenMeere TV-team has crossed the with festivities that include a Freedom Run/Walk and Heritage Day where traditional local food will be on sale, along with a revival of traditional games, story- telling and performances by masked street dancers in traditional costumes. The Penny Concert for Senior Citizens and the annual St. Patrick’s Day lecture will be held on March 18th and the School Heritage Day, Karate Tournament and String Band Night on March 20th. The events will culminate with a Freedom Hike and Creole Breakfast at the Montserrat National Trust on March 21st. Andrews: Carriacou Sloops Volumes I and II at www. youtube.com/watch?v=vCR9iVxRup4. Atlantic with the ARC aboard the yacht Impressions from the 20-day crossing are shown in Episode 11 on the homepage www.siebenmeere.tv. Rolf and Joe are now cruising the Caribbean, visiting On the eve of St. Patrick’s Day, the Cultural Centre St. Patrick’s Day, the Cultural On the eve of Irish Cabaret. Community Singers presents the Emerald happen- the highlight of the day’s For some, however, and restau- rum shop tour: local bars ings will be the serve with shamrocks and rants will be decorated plenty of Guinness.

, reported overdue on passage from , reported overdue on passage Mystery Solved

Marigold Falmouth Harbour Marina Falmouth celebrate this annual event with festivities held

Continued from previous page Continued from St. Patrick’s Celebrations in Montserrat Ishwar Persad reports: Montserrat is the only In honor of the island’s rich culture and dynamic mix Activities will begin with a Kite Festival at Festival On February 4th, the yacht was seen drifting off a On February 4th, the yacht Marigold on the lookout for the During January, vessels were Yacht Chef’s Abductor Confesses Yacht Chef’s Abductor Georgia, yacht chef from Savannah, Sara Kuszak, a www.antigua-marina.com [email protected] Tel: +1 268 460 6054 Fax: +1 268 460 6055 www.antigua-marina.com [email protected] Tel: +1 268 Caribbean island to boast a noticeable Irish heritage. The island was a haven for indentured Irish Catholic servants in the British West Indies and the influence of their culture is still felt today. of Irish and African heritage, Montserrat commemo- rates St. Patrick’s Day in true Caribbean style. With the distinction of being the only country in the world outside of Ireland to recognize St. Patrick’s Day as a national holiday, the Emerald Isle of the Caribbean will March 14th through 21st. Village on March 14, followed by the annual St. Patrick’s Day Dinner. The celebration continues on March 15 with a church service held at St. Martin de Porres Church in Salem, followed by a performance by the Junior Steel Orchestra at the Cultural Centre. the Canary Islands to Barbados. On January 15th, the the Canary Islands to Barbados. Terry Green, from yacht’s 65-year-old solo skipper, weatherman and com- London, England, radioed a attack. Coast Guard plained of suffering a mild heart countries including personnel from several Caribbean a wide area in the Trinidad & Tobago searched sighting the yacht. Eastern Caribbean without It was later discov- beach in Blanchisseuse, Trinidad. body aboard. He is ered washed ashore, with Green’s causes. assumed to have died of natural yacht was murdered on February 4th while in Puerto Rico to on February 4th while in Puerto was murdered Cheshire yacht with her fiancé, Captain help deliver a was who was five months pregnant, McIntosh. Kuszak, on the a morning jog at Ceiba kidnapped during call from She made a cell phone island's east coast. body was kidnapper’s car, and her the trunk of her call. Eliezer an hour after making the found in a field after the FBI traced Marquez Navedo was arrested phone. Navedo, age 36, the signal from Kuszak’s cell Navedo’s mother confessed to the random killing. convicted of an unre- had reportedly been previously lated murder. — MARCH 2009 CARIBBEAN COMPASS PAGE 8

endorsed by ReggaeThe Ambassadors world’s greatest the Antigua Hotels & Tourist Association May 1st & 2nd ‘09 and Ministry of Tourism The beautiful and exciting

doing a new style of Reggae Rock CALVIN TESSANNEJamaican song bird

CHIN plus other top artists Stephen Stills & Manassas formerlySAMUEL of CSNY and

09 “ The Climax FUZZY

Entertainment Behanzin

presents

”

Sailing Race Circuit

to the

Reggae Rock, Blues, Soca & Zouk Rock & Roll, Surf, Reggae, Caribbean as well as DJ music to include: House, Caribbean House Fusion, Dancehall & SocaCalypso.

www.sweetcryfestivalantigua.com

FridayFFrid Happy hourr from 3 am t to 4 am VenueDow Hill EntertainmentSaturday Park,id Interpretation Center ay from 10 pm to 5 ama Hill Entert om 10 pm US$2.00 from theticketpricewill be donatedto E from 7 pmp to 2 am nt er on Center m pm7 to om CO-SPONSORS ta inment en CRIME STOPPERS te r nt Park,

MARCH 2009 CARIBBEAN COMPASS PAGE 9 d 1 Min. by Foot r Open Air Market Downtown Nightlife 24 Hour Security Gated Marina Restaurant, Beach Bar & Grille Free Wi-Fi Always Mega-Yacht Docking to 600’ Alongside a

y a

up to 95 feet n l a n i VHF CHANNEL 16/9 o o n Out of the Water Storage Out of the Water CONTACT DALE WESTIN r r B y 876-715-6044 or 876-993-3209 a

WWW.ERROLFLYNNMARINA.COM [email protected] r l PORT ANTONIO, JAMAICA PORT ANTONIO, Full Service Marina 100 Ton Travel-lift 24 Hour Fuel Paint Sheds Engine and Parts Specialists Duty Free Zone in Marina Protected Harbor Depth up to 25 Feet at Face Dock Errol EErrol FFlynn MMarina && Boatyard , a 229-foot mega- Sherakhan

—Continued on next page Since opening in October 2006, The Marina at Marigot Bay has become the pre- Since opening in October 2006, The Marina at Marigot The company’s Marketing Manager, Danny Donelan, was joined by Grenada’s The company’s Marketing Manager, Danny Donelan, in Grenada. “Government Minister David remarked on the importance of yachting For more information on Port Louis see ad on page 23. St. Lucia’s Marigot Bay Welcomes its Largest Yacht to Date name was not released —On January 12th, a 241-foot private yacht — so private its Port Louis Invites Charter Yachts to ‘C’mon Down!’ Charter Yachts to ‘C’mon Port Louis Invites feedback been receiving excellent Port Louis Marina has Camper & Nicholsons

yacht. “We not only handle the big cruisers,” says marina manager, Bob Hathaway,yacht. “We not only handle the big cruisers,” says marina maintain a low profile.”“but we handle their need for privacy and the ability to offering a full range of mier mega- and super-yacht berthing marina in St. Lucia, The marina can berth amenities and services to its guests, captains and crews. the five-star Discovery at yachts up to 250 feet with a depth of 16 feet and fronts and crew can dine, Marigot Bay luxury resort and spa where the guests, captains relax around the pool and arrange an overnight stay. Minister of Tourism, Hon. Peter David. Donelan noted, “His presence at the show sig- Minister of Tourism, Hon. Peter David. Donelan noted, “His industry. We met nalled how serious Grenada is about developing the yachting they were impressed to see some of the most influential persons in the industry and together for the benefit of Grenada’s government and the private sector working the industry.” sector. We have recognized intends to place tremendous emphasis on the yachting work with Camper & it as one of our most important niches and we intend to and viable industry. Nicholsons and others in the industry to develop a vibrant tourists to Grenada but will Government knows that yachting will not only bring more our people can take advan- also create many high-value jobs and businesses which tage of.” length-list of luxury vessels thatglided into The Marina at Marigot Bay. The yacht tops the have berthed in Marigot Bay, the second longest being from its presence at the 47th Antigua Charter Yacht Meeting, held in December from its presence at the 47th attended the show to promote Grenada and the Port 2008. Camper & Nicholsons world’s top yacht brokers, international press, yacht Louis Marina to some of the builders and mega-yacht captains. Super size! This 241-footer has dwarfed all other yachts arriving in St. Lucia’s ‘Marina at Marigot Bay’ to date

Grenada’s public and private sectors have extended a warm invitation for yachts to Grenada’s public and private sectors have extended a visit Port Louis Marina and the Spice Island BUSINESS BRIEFS BUSINESS MARCH 2009 CARIBBEAN COMPASS PAGE 10 CURACAO MARINE call: +(5999)4658936email:[email protected] website:www.curacaomarine.com AWL gripapplicationandmanyotherservices Teakworks, stainlessandaluminumfabrication Yacht storagemaintenanceandrepair They fixedmybottom

situated justoutsideofthehurricanebelt curacao M ARINE East Coasthas renewed itsrelationshipwithDYTforanotheryear.ASpring/Summerscheduleon the Key WestRaceandtakingsecondatAcuraWeek.Itrecently Maxi YachtRolexCup.ItthenrangintheNewYearbywinningFt.Lauderdale to Malta YachtClub’sRolexMiddleSeaRaceandtheClubCostaSmeralda’s Newport BermudaRace,theNYYCAnnualRegattaSponsoredbyRolex,Royal Trysail Club’sBlockIslandRace, Yacht Club’s(NYYC)RaceWeekatNewportpresentedbyRolexandtheStorm Rosebud/Team DYT —Continuedonnextpage ence unequalledanywhereelseintheCaribbean. set itintheparishwithlowestcrimerate inJamaica,andyou’vegotanambi- staff you’llfindanywhere.Addabackdrop oftheBlueandJohnCrowMountains, reaches yourboat,garbagedisposal,24-hour security,andthemostfriendly,helpful showers andtoilets,theswimmingpool,a BlueFlagsandbeach,aWiFihotspotthat good answer.ForananchoragefeeofUS$12 aday,yougetuseofthemarina’s using myownanchor?”Well,ErrolFlynnMarina inPortAntonio,Jamaica,hasa show forDockwiseYachtTransport’sservices.” couldn’t behappierwiththerepresentationtheygiveusandenthusiasm cially overlongdistanceswhentheboatisbestnotdeliveredonitsownbottom. We the teamtransportsitspreciouscargosafelyandefficientlytoeachvenue,espe- der Werf.“Thebuzzisnotonlyabouttheteam’sperformancebutalsohow some ofthesport’smostnotableevents,”saidDYTPresidentandCEOClemensvan — Racing Club’sRolexFastnetRaceinAugust. of toppingoffitsseasonwithvictoryatSkandiaCowesWeekandtheRoyalOcean Week presentedbyRolex.TheboatwillthengototheUnitedKingdomwithgoal Race, theNYYCAnnualRegattaandStormTrysailClub’sBlockIslandRace formed RogerSturgeon’s(Ft.Lauderdale,Fla.)Farr-designedSTP65 leading yachtlogisticscompanywithitsownfleetofsemi-submersibleships,trans- headlines sinceitslaunchin2007,andDockwiseYachtTransport(DYT),theworld’s Waeco/Adler Barber,GrunertandSentrybrands. Islands, St.Croix,Maarten,andGrenada.TheydistributetheCruisair,MarineAir, Outstanding ServiceAward. companies werepresentedwithaSalesGrowthAwardand15recognizedan of sevenPlatinum,GoldandelevenSilverSalesAwardswerehandedout;six Corporation, EnvironmentalDivision’sCruisairandMarineAirbrands.Thisyearatotal and OutstandingService.TheEnvironmentalAwardisforsalesofDometic Distributors. Parts&PowerLtdofTortolareceivedanOutstandingServiceAward. equipment, hasannouncedthewinnersofitsEnvironmentalAwardsforInternational products aredesignedforeaseofinstallation,serviceandroutinemaintenance.” strong warranty.WehaveaglobalservicingdealernetworkandallNorthernLights propulsion productsandstandbehindthemwithunparalleledfactorysupporta PTOs, afullrangeofpanels,transmissionsandmuchmore.Wethoroughlytestallour tions,” saidPuckett.“TheL6125Hisfullycustomizablewithoptionsincludingfrontmount is abletorunallday,everyday. and salesadministration.“It’sanidealsolutionforanyoneinneedofenginethat endary Luggerdurability,”saidColinPuckett,NorthernLightsmanagerofmarketing L6125H reachesahighoutputratingof470horsepoweratmodest2300rpm. whose fivedecadesofexperiencearewellknowntomarinersacrosstheglobe.The trial engineblock,andiscustom-marinizedbytheNorthernLightsengineeringteam, rail (HPCR)fuelsystem. L6125H dieselengine,featuringanelectronicallycontrolledhigh-pressurecommon- and Luggerdieselengines,hasintroduceditsnewestpropulsionsolution—the cane season.Tosignupforamonthlynewslettervisitwww.marigotbay.com. an ice-colddrinkatthenewRowley’sCaribbeancafé. browse throughhigh-endboutiques,enjoyafreshlybakedcroissantatthebakeryor come intotheharbor.Visitorsandlocalsareencouragedtovisitvillage tive courtyardgardenisagreatplacetorelaxandwatchtheyachtsboats tourism sector.ThecolourfulCaribbean-stylewoodenvillagebuiltaroundanattrac- circuit tional racing the interna- she starson Transport as Yacht Dockwise profile of raises the Rosebud good ship sorship —the Powerful spon- For moreinformationonErrolFlynnMarina seeadonpage9. Say “anchoragefees”andboatownerswill say,“WhatamIpayingforwhenI’m Has ErrolFlynnGotaDealforYou! For moreinformationonDockwiseYachtTransportseeadpage18. “ The partnershipbetweenRosebudRacing,theSTP65teamthathasbeenmaking Dockwise YachtTransportLovesRosebudRacing For moreinformationonPartsandPowerseeadpage22. Parts &PowerLtdistheDometicEnvironmentalDistributorforBritishVirgin The awardcategoriesareSalesPlatinum,GoldandSilver,Growth Dometic Corporation,aleaderinmarineairconditioningandsanitationsystems Parts &PowerWinsOutstandingServiceAward For moreinformationonNorthernLightsintheCaribbeanseeadpage21. “Luggers arelegendaryfortheirtoughnessandadaptabilitytoavarietyofapplica- “The LuggerL6125Hcombinesstate-of-the-artdieselenginetechnologywithleg- The L6125Hisbasedonthetime-testedreliabilityofheavy-dutyKomatsuindus- Northern Lights,agloballyrecognizedmanufacturerofmarinedieselgeneratorsets Northern LightsIntroducesNewLuggerEngine For moreinformationonTheMarinaatMarigotBayseeadpage6. The MarinaatMarigotBayisalsoagreatplacetoberthyachtsduringthehurri- The MarinaVillagesupportstheactivitiesofmarinawithunitsthatcaterto Continued frompreviouspage Rosebud/Team DYT

Rosebud/TeamDYT , repletewithare-brandedhullandsails.WinningtheNewYork , whileittravelstheworld,createsabuzzondocksat Rosebud/TeamDYT competingintheFortLauderdaletoCharleston alsotook2008trophiesinthe Rosebud into

MARCH 2009 CARIBBEAN COMPASS PAGE 11 Remember this album? Band Remember this album? Band be member Fuzzy Samuel will rocking his homeland of Antigua at the Sweet Cry Festival, May 1st and 2nd, during the apex of Antigua Sailing Week 2009 Continued from previous page Continued from A star-studded line-up has been contracted to perform to include the world’s A star-studded line-up has been contracted to perform is of paramount impor- The safety of the visitors to the shores of Antigua & Barbuda Much Music — Sweet Cry Festival Antigua Much Music — regatta action feature some of the hottest reports: March and April Donald Charles 09 have of Sweet Cry Festival Antigua tenets that the producers It is these same more perfect is shaping up to be. A music festival SCF Antigua And what a two-day respective genres of music. As a result of the diverse mix of visitors who will be in Antiguarespective genres of music. As a result of the diverse mix together a music mix that willfor the Antigua Sailing Week 2009, the producers have put soca and zouk, as well as DJinclude live rock ’n roll, surf, reggae, reggae rock, blues, and soca. music to include house, Caribbean house fusion, dancehall and exciting Jamaican greatest reggae ambassadors, Third World; the beautiful Calvin “Fuzzy” Samuel for- songbird Tessanne Chin doing a new style of reggae rock; with his friends that include merly of CSNY and Stephen Stills & Manassas who, along through a musical journey a number of Grammy winners, will take the audience on to the USA and South from South Africa to the Caribbean to the UK and then of Fuzzy. America and then right back to Antigua, the birthplace will be donating US$2 tance and the production company, Behanzin Entertainment, this organization to secure from the price of each ticket to Crime Stoppers to assist will have a safe and the English Harbour and Falmouth areas so that everyone enjoyable time. 29 —Continued on page in the Caribbean. As all sailors would agree, the chance of their yacht becoming a the chance of their yacht As all sailors would agree, in the Caribbean. execution. preparation and to a large extent on planning, winner will depend 2nd what will staging on May 1st and they work assiduously toward embraced as months of racing. climax to an exciting two certainly be the have been English Harbour, could not Dow’s Hill Entertainment Park, venue than the will showcase some of the world’s foremost artists in theirselected to stage an event that — MARCH 2009 CARIBBEAN COMPASS PAGE 12 northwest cornerofSt.Croix. culty. Somecrewsreportedseeingwhalesatthis anchored inthecriticalarea,addedadegreeofdiffi- speed. Avoiding the bluffmayresultinfindinglightflukyairandslow from shoremakesadifferencehere:beingtoocloseto bearing offsharplytowardHam’sBluff.Thedistance heading toshoreonlylongenoughcrossit,then Petersen 44, Grande band Tony’sandmynew-to-usJ/36 Jeff Fangmann’sThomas35, Teegull trimaran, festivities atCoconuts.JoeSanMartin’sNewick23 and thirstysailorstoenjoyappetizers,sunset vided tothefleetafteranchoring,enablinghungry Coconuts Bar.Tenderandshuttleserviceswerepro- ran northpasttheFrederikstedpiertoafinishlineoff reported seeingalargeleatherbackturtle,thecourse leading tosomeconfusionandcontroversy. oil refinery.Notallskippersfollowedthesuggestion, three-mile securityexclusionzoneofftheHOVENSA ment atthepre-racemeetingsuggestedhonoringa navigational markslefttostarboard,butanannounce- shore ofSt.Croix.Sailinginstructionssimplyhadall board, thenboreoffona27-milerunalongthesouth States andhungaright,leavingPointUdalltostar- trimaran beattotheeasternmostpointofUnited racer/cruisers, sevenheavycruisersandonesmall backdrop. clouds overtheislandprovidedanidyllicCaribbean breeze, skiesremainedmostlysunnyandfair-weather CSA racing.Witha12-to16-knoteast-northeasterly regulars andcasualcruiserstomakeforsomefine Good Girl local racerswereawayatKeyWestRaceWeekhelping trip inajust-for-funpowerboatrally.Althoughseveral January 24thand25th.Twopowerboatsalsodidthe THE On Sunday,theupwindstartinglinehadfleet From beautifulSandyPoint,whereoneboat’screw From thestartinglineoffofPullPoint,afleettwo ; andJimGailNealon’sformerlive-aboard winthePHRF-2Class,therewereenough Endymion Juliet Piglet

, alargethree-masteddive-boat around theirislandintwolegs, Crucian sailboatstorace weather wasperfectforten , wasfirsttofinish,followedby . El Presidente Cayennita ; myhus- ish orderwasthesameasSaturday’s,except Christiansted, tothefinishlineatPullPoint.Thefin- shore, avoidingthereefsoffSaltRiverand tacked inandoutofthecurrentalongnorth it seemed),whilethelighterracer/cruisersshort- sail abouthalfwaytoSt.Thomasbeforetacking(orso End. Thetrimaranandtheheavycruiserstendedto broke inthechoppyseas. Guneagal, twins), Altom’s Morgan45live-aboard(withseven-monthold arrived about90secondsafterDaveandShannon AROUND ST.CROIXRACE2009 Once pastthebluff,it’salongbeatbacktoEast Ten LocalBoats,TwoFineDays Serenity wasforcedtoretirewhenherheadstay . Sadly,BobFerris’sSunOdyssey37, Endymion by EllenSanpere

winners were: holding theperpetualtrophy;Ellen’sgot“keeper” Sanpere, EllenSanpereandDaveFlaherty.Tonyis Heather Rippl,ScottJohnston,GeoffRivinius,Tony The winningCayennitaGrandecrew.Fromleft: 3) 2) 1) Once theCSAcorrectionfactorswereapplied, BarbaricYawp ElPresidente CayennitaGrande , Thomas35,JeffFangmann , Tartan30,TaylorBabb , J/36,TonyandEllenSanpere MARCH 2009 CARIBBEAN COMPASS PAGE 13 from Bloody (above) with an th Hugo second, and Hugo sailed ‘brilliantly’, but couldn’t defeat Trinidadian invader Wajang Carriacou-based Bloody Mary sailed brilliantly, stay- Bloody Mary barely clear - April 13 - first, th Bloody Mary Wayward Wajang and went into the final day in a strong position. final day in a strong position. went into the April 9 . This was truly a great day’s racing. . This was truly • Yacht Races • J/24 Races • Local Double-Ender Races • Coconut Boat Races • Crazy Craft Race • Sandcastle Competition and Jerry Stewart’s Carriacou-based Hughes Carriacou-based Hughes and Jerry Stewart’s that saw Wajang Wajang Hugo Die Hard Wayward and unfortunately damaged a sail and dropped back, making the unfortunately damaged a sail and dropped back, making Hugo Wayward , also caught third. took the windward mark first with an excellent tactical leg. The run to The took the windward mark first with an excellent tactical Bloody Mary With two wins from two starts, With two wins to eight-knot range. The start was in unusually light wind — in the five- The party after prizegiving was great and went on too late! (Sailors will overdo it The party after prizegiving was great and went on too inside overlap at a mark rounding. Race Three was the most challenging of the series. The start was from Tyrell Bay, as the series. The start was from the most challenging of Race Three was to The Sisters, a mark in the bay, a run course went to a windward usual, then the to Mabouya and Sandy Island to starboard, another run beat into Hillsborough with Hillsborough, a third run to The Sisters, then farther The Sisters, a beat again into finish. This is one of the best west to the leeward mark, culminating in a last beat to every point of sailing. courses I have ever sailed, with challenges and tests on Sir Hugh Bailey, showed her Antigua, the Beneteau First skippered by the legendary first. From then on the power by taking the pole position and rounding The Sisters went inshore first took early race could only be described as fantastic. The boats that wind, and then the roles advantage over the boats that stayed out looking for heavier the inside. A tacking duel were reversed with the outside boats taking profit over ensued between Mary many times. Sisters had many wind-holes in it and the lead changed ing out of trouble. day’s final result — and the overall winners — 38, new Southern Circuit over, it whenever they get the chance.) With the first leg of the then to Tobago for the final. If was on to Grenada Sailing Festival for the second leg, be great. Carriacou was anything to go by, the next two would defended that lead to the end. defended that Wayward

JJ SLATER (2)

out Wajang Wajang, , from Grenada in third place. THE SOUTHERN CARIBBEAN CIRCUIT 2009 CARIBBEAN THE SOUTHERN caught her on the run and Die Hard

‘Fantastic’ ‘Fantastic’ Wajang www.begos.com/easterregatta www.begos.com/easterregatta Notice of Race & Yacht Pre-Registration: Pre-Registration: Yacht Notice of Race &

Robert Yearwood’s J/24,

Tel: (784) 457-3649 e-mail: [email protected] (784) 457-3649 e-mail: Tel: 2009 Carriacou Sailing Series, held January 10th through 14th, 2009 Carriacou Sailing Series, being lower saw some of the tightest racing ever, despite numbers having than usual (seven boats raced), mainly owing to sailors was first out of Hillsborough Bay and started the reach to the was first out of Hillsborough Bay and started the

, and then

Wayward

Event One: Event This race saw the lead change several times. The beat into Hillsborough can be This race saw the lead change several times. The beat After that relatively gentle introduction to the new sailing season, we went into fullAfter that relatively gentle introduction to the new sailing Race One was very competitive with Darcy Carr’s Beneteau 10 Metre, Race One was very competitive with Darcy Carr’s Beneteau For Race One, the winds were in the 15- to 18-knot range at the start. The course For Race One, the winds were in the 15- to 18-knot range Carriacou Series 2009 Carriacou The new Southern Caribbean Circuit — including the Carriacou Sailing Series, the Circuit — including the Carriacou Sailing Series, the The new Southern Caribbean the Tobago Carnival Regatta — got off to a fine start Grenada Sailing Festival and in Carriacou brutal. middle mark, then the beat. However, regatta mode for Race Two, a course distance about 20 miles which took us from theregatta mode for Race Two, a course distance about 20 by a beat into Hillsborough,start in Tyrell Bay out past The Sisters rocks, followed between Carriacou and Unionthen back away from the capital for a reach to a point most windward mark of theIsland. This was followed by a beat to Myers mark (the into the finish at Tyrell Bay. course), a run back down to The Sisters and a final beat of Trinidad, winning. She was closely followed by my own Beneteau Oceanis 430, of Trinidad, winning. She was closely followed by my Wayward for this race is a short one to ensure an early finish so racers can get to nearby Sandy for this race is a short one to ensure an early finish so As usual, this was a Island for the Carriacou Series’ now-famous lobster barbecue. persuading sailors high on blast, and as usual the most difficult part of the day was the spirit of sailing to leave the uninhabited islet. THE former November dates. planned to have time off for the well-established event’s by Jerome McQuilkin MARCH 2009 CARIBBEAN COMPASS PAGE 14 Sailing Festival! Louis Grenada Live atPort Event Two: block, gouginganeatlittleholeinmyfingerandcolor- finger madecontactwithsomemetalonthemainsheet the chute,roundupandre-start. were abitearlyforourspinnakerstartsohadtodrop their ratingandexpectedtofinishclosetogether.We the ratingsystemasallboatsarestartedaccordingto Grand AnsetoTrueBlue—agoodwayspot-check back endandwatchedallthewaterdrainout. boat backupandweallskippedankledeeptothe did broach,thecockpittookinwater,weget the movementsof other boatouttherethatday.Butlikeanywildhorse, had someamazingdownhillrides,fasterthanany our skipperRichardSzyjan’s14-year-oldson. action performedbythesmallestcrewmember,Kenzo, into thecockpit,attimesnecessitatingsomebucket over thedeckof gusting to30andlargeseas.Blue-greenwaterwashed races wereonthesouthsideofGrenada,withwinds ing himbackonboard.Thishappenedtheday wrested fromhisarmbyoneofthemanyhandspull- sive wristwatchthough,didnotsurvive,asitwas down enoughforhimtoswimtheboat.Hisexpen- with abodydragginginthewater,wereabletoslow — hesurfacedtenfeetastern.Wedroppedthejiband, lifeline, dragginginthewater.Nicolawasnotsolucky onto mystanchion.Rogerwasabletohangonthe bodies forwardofmewentheadlongoverboard,Iheld a stanchion.Thelifelinewentsuddenlyslack,both water byaliterallifeline.Iwasattheaftend,nextto on eachsideoftheboat. rail insynchronizedmovementswithonecrewmember did notallowtheagilityrequiredtoracefromrail jacket, butthatonlyworkedbetweenraces.Thejacket taking theedgeoffwastobringmyfoul-weather us throughouttheracingdays.Mypersonalmeansof blessed 14timesthatfirstday.Theblessingsfollowed taking theedgeoffitcalledthemblessings.Wewere towards us.Afellowcrewmember,Roger,inhopesof marched asifonsteppingstonesdownthemountains east dissolvingslowlyintotheskyasrainshowers clear waters,verdantgreenmountainprofilestothe turtle sightings. the cockpit,prematureroundings,360penalties,and aloft, menoverboard,bucketinthecockpit,blood February 3rd.Spinnakerbroaches,falsestarts,man Sailing Festival,heldfromJanuary30ththrough course happenedtousduringthisyear’sGrenada During anunexpectedjerkymovementmymiddle We startedthisdaywiththepursuitracefrom We sawturtlesonthesouthsidethatday.also The rail:wheresixbodieshungsuspendedoverthe It allstartedinlovelyGrandAnseBay.Sparkling Almost everythingthatcouldhappenontherace- Category 5 by JeffFisher Category 5 , amodifiedHobie33,and aretemperamental.We THE SOUTHERNCARIBBEANCIRCUIT2009 Port LouisRaceSeriesmadethefinaldayofracing. in theHeinekenRaceSeries.TheCamper&Nicholsons lowed bytheever-popularSouthCoastTrianglecourses Pursuit Racestartedtheday.Thewasfol- schedule: forthefirsttime,Moët&Chandon Monday morningsawanotherchangeintheFestival Series, andSundaysawtheTrueBlueRace.The and J/24.TheSaturdayfeaturedtheMountGayRace competed infourclasses:Racing,Cruising,Charter Camper &NicholsonsPortLouisMarina.Theyachts 2009 PortLouisGrenadaSailingFestival,basedat the boat. the foredeck,whoeasilycontrolledpointyendof come insecondracingclass.Kudostothekidson these over-the-call-of-dutyantics,westillmanagedto these potentiallycatastrophicshenanigans.Inspiteof concluded thatweactuallylostverylittletimeon our way. the halyard.Here-attached,hoistedandwewereon son, donnedaharnessandwassentuptoretrieve nest atthetopofmast.Romain,Richard’solder ing thespinnakerhalyardflyingskywardtoitslittle shackle, droppingthespinnakerondeckandsend- was abletoalsogripthereleaseonhalyard lower spreaderandtheeased-outmainsail.Something hoist, theheadofchutegotpinnedbetween After roundingtheweathermark,onspinnaker where onelastforcedexercisewasthrustuponus. waters offGrandAnseBeachincalmerconditions, blessings pursuingusallthewayback. we stillhadtosailbackSt.George’swithmore selves. Aftertwoboisterousracesonthesouthcoast another boat.Wedidaquick360toexonerateour- reaching mark,creatingapossibleinfringementwith it didtakeawhileforthecirculationtoreturn. as itisdesignedtodo.Though,attheendofday works reallywell;Icouldfeelitcontinuallysqueezing, the wholefingerandstopbleeding.Thisstuff some rigger’stapeonboardwhichIusedtomummify ing thecockpitwithredsplotches.Fortunatelywehad Thirty-two yachts and 23 work boats took part in the Thirty-two yachtsand23workboatstookpartinthe In analyzingallthatwewereforcedtoexecute, The lastdayoftheregattasawusbackon In oneraceweroundedupearlyjustbeforethe JeromeMcQuilkin,Trinidad Grand AnseBeach. great supportattheDigicelWorkBoatRegattaon Deyna’s andGrenadaElectricalContractorsfortheir Steele’s AutosLtd.,HorizonYachtChartersandto ers CocaCola,GlenelgSpringWater,SOLECLtd., Bleu andTheAquarium,aswelllong-termsupport- Thanks alsogotonew2009partyvenuesLePhare Ltd., 809DesignandCOTCaribbeanGraphics. Boval, IslandDreamsYachtServices,TSLGrenada Insurance; andCrewClubMembers:BudgetMarine, Chandon andBeringerWines,ScotiaBankUnited Gay Rum,Heineken,NorthSouthWineswithMoet& for 2009:BritishAirways,ColombianEmeralds,Mount as wellTrueBlueBay,plusCaptains’ClubMembers ers alsothankWorkBoatRegattatitlesponsorDigicel, tion withtheGrenadaBoardofTourism.Theorganiz- ners PortLouisandCamper&Nicholsons,inassocia- HansSchrederhof,Netherlands &RussellCarrie,Barbados 2009 innextmonth’s 2) 1) Cruising 3) 2) 1) Racing The overallyachtclasswinnerswere: The eventfor2009wasrunwithpresentationpart- 2) 1) J/24 3) Netherlands 2) 1) Charter 3) 3) We’ll haveareportontheDigicelWorkBoatRegatta For fullresultsvisitwww.grenadasailingfestival.com. Bloody Mary Wayward Storm Category 5 Lost Horizon Jabulani Ambushe Sacajawea IV Second Chance My Mistress Jaguar Die Hard , ReichelPugh44, , Frers43,PeterMorris,Trinidad , CharlieGloumeau , RobertYearwood,Grenada , StephenBushe,Trinidad , BeneteauOceanis430, , Hobie33,RichardSzyjan,Grenada , Bavaria46,JohnCouper,UK , J/122,JamesDobbs,UK , Hughes38,JerryStewart,UK , Moorings44.3, , Moorings44.3,

Compass. ONNE VAN DER WAL DER VAN ONNE Sailing Festival2009 the excitingGrenada Szyjan’s happened aboardRichard ‘Almost everything’

Peter Peake,Trinidad Category 5

Jaap Eringa, during MARCH 2009 CARIBBEAN COMPASS PAGE 15 to the needs of cruising yachtsmen 18.25.50N 69.36.67W newest marina catering The Dominican Republic's • Immigration office in the marina for clearance • Free WIFI and Free Internet • Dinghy Dock • 12 miles East of Santo Domingo and 7 miles East of International Airport Wind lovers united! The ‘Festival of Wind’ was windy indeed, creating thrilling conditions Wind lovers united! The ‘Festival of Wind’ was windy sailors alike at Tobago’s for yacht crews, kiteboarders, windsurfers and ‘bumboat’ spectacular Pigeon Point Heritage Park

Event Three: Event by Sally Erdle

• High Quality Sheltered Moorings • Slips to 120’ with depth 10’ • Shore power 30, 50 and 100 amps • All slips with fingers • Showers, Laundry, Restaurant, 24 hour security ALL PHOTOS: WILFRED DEDERER WILFRED PHOTOS: ALL THE SOUTHERN CARIBBEAN CIRCUIT 2009 CARIBBEAN THE SOUTHERN nothing else nothing else quite like it in the Caribbean. a aa Z MM Zar-Par Marina

gg g The Yacht Races 2009 A fleet of 23 yachts raced in the event under the CSA The wind gods were listening when the event’s motto

Tobago has hosted a well-respected annual interna- Tobago has hosted a well-respected THERE’S Tel: 809 523 5858 Visit: marinazarpar.com Contact MARINA ZARPAR VHF Channel 5 email: [email protected] Tel: 809 523 5858 Visit: marinazarpar.com Contact MARINA ZARPAR VHF rating rule in five classes: Maxis, Racer/Cruiser, Cruiser, J/24 and Melges. —Continued on next page was changed from “The Friendliest Regatta in the was changed from “The Friendliest Regatta in the Caribbean” to “A Festival of Wind”. Typically in Tobago the wind starts light in the morning, picks up to a good breeze during the day, and eases back by dark. During the former May dates, racers could usually expect some 15 to 20 knots. But on February 12th, it was a solid 20 to 25 knots with higher gusts in squalls, forc- ing cancellation of that afternoon’s “bumboat” race in deteriorating conditions. (The next morning, rough seas disrupted the fast ferry service from Trinidad.) But the show went on. & Tobago Sailing Association and Regatta Promoters & Tobago Sailing Association and Regatta Promoters Ltd., definitely got the “27 year itch” and February 10th through 14th, 2009, saw the event broadened in scope, rescheduled, relocated and rebranded as the Tobago Carnival Regatta, the final regatta of the new Southern Caribbean Circuit. tional yacht regatta since 1982, first known as the tional yacht regatta since Regatta, then Angostura Angostura Yachting World organizers, the Trinidad Tobago Sailing Week. But the True, a few miles northwest, both the Grenada Sailing northwest, both the Grenada True, a few miles famously race Bequia Easter Regatta Festival and the farther to the sailboats. And yachts and indigenous Curaçao includes kite- west, the Heineken Regatta But at what other regional boards, yachts and more. for yachts, indigenous sail- regatta do you have events plus two after- ing craft, windsurfers and kiteboarders, kids and any crew with noons of beach games for the venue offers offshore energy to spare? What other and a reef-protected “lake” courses for the keelboats by a preposterous sweep for the board sailors, set off by soaring palms, with of white sand beach backed and clean public toi- beach bars, shops, picnic tables mention a top-notch race lets and showers? Not to ladies dressed in different committee including elegant wraps every day. Only in matching swimsuits and island of the Lesser Tobago, the farthest southeastern Antilles chain. & Tobago Sailing Association and Regatta Promoters MARCH 2009 CARIBBEAN COMPASS PAGE 16 “I think we’re doing okay,” he said with a twinkle in his “I thinkwe’redoingokay,”hesaidwithatwinkleinhis in 1982,wasaskedonedayhowtheracinggoing. petitors, manypreviousveteransofTobagoregattas. adding tothechallengesposedbyotherkeencom- winds andcurrent(fullmoonhadbeenonthe9th) start boatbyKaren,Pauline,Ruth,MeganandIndra. events inGrenada.Theywereablyassistedaboardthe Carriacou RegattaFestival,aswellatnumerous race officerattheBequiaEasterRegattaand the GrenadaYachtingAssociationandhasservedasa of theGrenadaYachtClub,whoisViceChairman well astop-notcheventsintheUS;andJamesBenoit Rolex inSt.ThomasandtheBVISpringRegatta,as has servedasaraceofficerintheCaribbeanat eran racerandFloridaSailingAssociationjudgewho much morecompetitiveandkeenatmosphere.” and itmakestheracingmuchmorebalanced,ina where therewillbewindsoneithersideofthecourse north, wheretheshiftsofwindareoutthisworld, predictable. Wehavemovedthenewcoursefurther last fiveyears,butwefoundtheywerebecomingabit Jerome McQuilkin,“Thecourseshaveevolvedoverthe the committeeboatjustpriortostart. others thenumberofcoursewasdisplayedfrom some racesthecoursewaspostedinadvance,andfor courses fortheRaceCommitteetochoosefrom.For scored separately.Therewasamenuofnumbered and “Melgii”(fourofeach)startedtogetherwere Cruisers andone-designsatotalofeight.TheJ/24s Maxi ClassessailingfiveracesinallandtheRacer/ Cruiser Class. Cruiser/Racer ClasseswerecombinedasRacer/ from leavingsnughavens.TheproposedRacingand raced inGrenadanotlongbefore,anddeterredothers taken itstollonsomeoftheboatsandcrewsthat this winter’songoingblusteryweather,whichhad — Rawle Barrow, one of the originators of the event back Rawle Barrow,oneoftheoriginatorseventback The racingwasashotlycontestedever,withhigh Officiating overtheraceswereDaveBrennan,avet- According toTTSAofficialandlong-timeracer There werefourracedays,withtheCruisingand Thefleetwouldnodoubthavebeenlargerbutfor hfdiht d i i C th ith d f Th Continued frompreviouspage

WILFRED DEDERER (3) Maxis, with eightfirstson Solomon, alsoacedhisclass,Racer/Cruiser, Careme five bulletsaboardtheindomitable eye. HecapturedafirstinCruisingClasswith Below: PaulSolomon’s Petite Careme Above right:ThemightyRawleBarrowdoesitagain!HeracedinthefirstTobagoRegatta27yearsago,andhis Stephen Bushe’s Above left:Someofthemostcourageousyachtracingwasaboardsmallestclasses—24-footone-designs. in eightstarts In theone-designs,resultsweremoremixed. Spirit ofIsis . Another long-time participant, Paul . Anotherlong-timeparticipant,Paul handilyplacedfirstinCruisingClassthisyear Ambushe woneveryrace. bMobile Enzyme —Continued onnextpage bMobile Enzyme endedupatthetopofJ/24s,asithadalsodoneinGrenada . And in the . Andinthe sailedfromTrinidadtoconquertheRacer/CruiserClasswitheightwins Petit

MARCH 2009 CARIBBEAN COMPASS PAGE 17 , Die Intrepid TOHATSU attendance at the Tobago Carnival , of Trinidad & Tobago, and a well- , of Trinidad , of Grenada. Getting a “new” regatta is like getting a new boat. The Tobago Carnival Regatta — and the For full results visit www.sailweek.com. Many thanks to the TDC, THA, Regatta Promoters Tobago Regatta regulars Phyllis Serrao and Nancy regulars Phyllis Serrao and Tobago Regatta venue? Phyllis says, And what about the new The Tobago House of Assembly’s Secretary of r o Harris “Jungleman” McDonald, David Fogley, the Arnos Vale Hotel, Gabriele de Gaetano and all the other Trinbagonians and regatta-goers who made Compass’s Regatta 2009 possible — and lots of fun! Peakes, Tobago Water, Dynamite Yacht management, OnDeck, Budget Marine and many other local and international businesses in supporting the event. You might have had everything precisely the way you wanted it on the old one, but eventually you knew it was time for a change. So you get something you hope will perform even better. Then the shake- down cruise: “Dang! Who led the halyard this way?!? Why aren’t the sheet blocks over here? Where the heck are the extra snapshackles?” Frustrating at first, but then you work the bugs out and grow to love the new boat as you make it your own. Southern Caribbean Circuit — have been well and truly launched. Well done all! Ltd., Le Grand Courlan Resort, Sherma McDougall- Williams, Hugh Brown, Andrew Llanos & P k y d W h fi l S t L W H A o C R e v C w g y T o C d a J W d H Y e h d y e in fo P h e b ti g r fo “J P th c fo b s H w b n b ti m e T Yen Chong still run the Race Office. About the broad- run the Race Office. About Yen Chong still regatta the event, Nancy says, “This ened scope of been experience for somebody who’s has been a new combination of thedoing it for eleven years. The and kitesurf- yachts with the bumboats, windsurfers scale — but I’m hav- ers puts everything on a larger “distractions”, mosting a ball!” Where some saw Niki Borde of Regattafound the additions interesting. are a given, but wePromoters says, “The yacht races will bring a newhope that the kites and windsurfers people who might thenenergy and attract younger We saw that rela- become interested in yacht racing. yachties and kitesurferstionship blooming when the And holding thegot together at the beach games. park, is a naturalregatta at Pigeon Point, a national involved.” for getting more Tobagonians a different experience.” “Just being on the beach is base was always Previously, the regatta’s shore of miles down the the Crown Point Hotel, a couple there made coast. The more enclosed atmosphere the racers, but was for great camaraderie among hotel grounds — by definition — being on private somewhat exclusive. Of the move to Pigeon Point Heritage Park, a national park, Niki says, “We want to make sure Tobago Regatta doesn’t ever become like some of the ‘elitist’ events farther north — it’s not for millionaires only; everybody belongs. It’s not about champagne on air-condi- tioned boats; it’s about beer on the beach. And it’s more than just a yacht regatta; it’s for all wind lovers, young and old, visitors and locals.” Tourism and Transportation, Oswald Williams, endorses this spirit. “I am pleased at the renewed vigor shown for sailing in Tobago,” he said at the Carnival Regatta’s prizegiving, “and pleased at the widened scope of this event. We would like to see a greater level of local participation and see more of our young people embrace their maritime heritage.” The Tobago House of Assembly is now the “title” sponsor of the event, joining the Tourism Development Company of Trinidad & Tobago, bMobile, Carib, due to a conspiracy no doubt between the weather no doubt between the due to a conspiracy went to The circuit's first prize and the economy. 430, Beneteau Oceanis Jerome McQuilkin’s Wayward J/24, to Robbie Yearwood’s deserved second Hard FOR RENT High pressure cleaners 150/250bars Electrical tools Diverse hand tools Vacuum cleaner for water Scaffolding Guadeloupe F.W.I.

accept first prize in the Melges [email protected] (filters, impellers, belts) Marina Pointe-à-Pitre 97110 Drunken Monkey , Paul Amon, Trinidad & Tobago (10), Paul Amon, Trinidad & Tobago , Henderson 35, Paul Solomon, Trinidad & Tobago (8) Paul Solomon, Trinidad & , Henderson 35, E-mail: , Beneteau First Class 10, Ralph Johnson, Barbados (26) Class 10, Ralph Johnson, Barbados , Beneteau First , in Racer/Cruiser Class, crosses tacks with one of the , in Racer/Cruiser Class, crosses tacks with one of the , Farr 65, OnDeck Charters, UK (10), Farr 65, OnDeck Charters, , Bob Humphries, Graham Bond, UK (19) , Bob Humphries, Graham Bond, , Beneteau First 38, Rawle Barrow, Trinidad & Tobago (5), Beneteau First 38, Rawle Barrow, , Farr 65, Formula Events, UK (5), Farr 65, Formula Events, UK GOODS Genuine parts Yanmar & Tohatsu Basic spare parts Filtration FLEETGUARD Anodes,Shaft bearings Electric parts, batteries Primers and Antifouling International Various lubricants , Stephen Bushe, Trinidad & Tobago (14) , Stephen Bushe, Trinidad & , Robbie Yearwood, Grenada (23) , Robbie Yearwood, Grenada , Peter “Wipers” Hoad, Barbados (14) , Peter “Wipers” Hoad, Barbados , Frers 38, Phillipe Agostini, Trinidad & Tobago (10) , Frers 38, Phillipe Agostini, Trinidad , Jeffrey Chen, Trinidad & Tobago (22), Jeffrey Chen, Trinidad & Tobago , Frers 43, Peter Morris, Trinidad & Tobago (29) Morris, Trinidad & Tobago , Frers 43, Peter MARINE MECHANICS (ALL MAKES) - HAUL OUT , Adam Rostant, Trinidad & Tobago (24) , Adam Rostant, Trinidad & Tobago , Beneteau Oceanis 440, Paul Hatch, Trinidad & Tobago (15) , Beneteau Oceanis 440, Paul Wayward Drunken Monkey bMobile Enzyme Jaguar Petit Careme Carnival Spirit of Isis Spirit of Juno Synergy Mojo Ambushe Jabulani Die Hard Bruggadung II Beex Challenger IV

3) Cruising Class 1) 2) 3) Maxis 1) 2) 3) Melges 24 1) 2) 3) J/24 1) 2) 3) Tobago Carnival Regatta 2009 Winners Carnival Regatta Tobago Class Racer/Cruiser 1) 2)

Class from Neil Wilson of the Tobago House of Assembly With rip-roaring racing, this is definitely a not-to-miss regatta! With rip-roaring racing, this is definitely a not-to-miss regatta! Above: ‘Melgii’ Below: The crew of WILFRED DEDERER (2) DEDERER WILFRED Phone: +590 590 907 137 Fax: +590 590 908 651

24h BREAKDOWN SERVICE • SALES • REPAIRS • MAINTENANCE FRED MARINE , despite Ambushe Die Hard won her first and won her first Synergy . . And among the four J/24s, . And among LEAVE YOUR BOAT IN SKILLED HANDS LEAVE YOUR BOAT IN SKILLED both ending up with 14 points. both ending Compass SERVICES Mechanics and Electricity Boat Maintenance Engine diagnosis Breakdown service 24/7 Haulout and hull sand blasting Equipment for rent Technical shop Jabulani Continued from previous page Continued from The Other Craft The races for the open local sailing boats that But CSA judge and racer Jeffrey Chen notedBut CSA judge and racer On the subject of having some races’ coursesOn the subject of having some A sad note was struck when a guest crewmem- A sad note was By the way, only two boats finished the entire First, the date change. Jerome McQuilkin The Changes Why were such drastic changes made to the old Pigeon Point offers excellent conditions for The windsurfers and kiteboards enjoyed the In the Melges Class, In the Melges are called bumboats in Tobago and two-bows or double-enders in the Grenadines are a whole story in themselves — we’ll bring that to you in next month’s with a grin, “When it was billed as ‘The Friendliestwith a grin, “When it was billed were protests, butRegatta in the Caribbean’ there there were none.”this year, with a new motto, only made known by showing a number from theonly made known by showing prior to the start ofcommittee boat immediately skipper said, “I don’tthe race, one experienced to prepare prop- like it. It doesn’t give you time Thursday, a wearyerly”. And on the ultra-windy should have chosenone-design racer said, “They instead we were outthe shorter courses, but morning until after- there wet and cold from efforts of Captainnoon.” And despite the excellent it in place as well asEllis at the throttles, holding about the startpossible, nobody was very pleased as a better moor- boat dragging. (Remedies, such ing, are already being considered.) the heroic efforts of CPR-trained crew aboard and of CPR-trained crew aboard the heroic efforts ashore. EMTs who responded swiftly ber, Jim McLean, died of a heart attack aboard died of a heart attack ber, Jim McLean, named J/24 the coincidentally Southern Caribbean Circuit in its inaugural year, says, “A Southern Caribbean Circuit has been a long-held dream. The Southern Caribbean has something unique to offer.” Bringing the date forward, right after the annual Grenada Sailing Festival, not only made the Tobago event part of a circuit but was also intended to address the fact that by May, many visiting yachts are headed back to North America or Europe, or bound for hurricane season destinations. The date change didn’t work for a few racers, notably those who work in tourism or (ironically) yachting businesses, for whom February is the busy season. But for most it was fine. The possibility is being looked at of a feeder race from St. Lucia to the Grenadines to lead ARC participants into the SoCa Circuit next year. Tobago Regatta formula, and how did they pan out this first time around? Mainly, the changes were made to reverse the trend of dwindling numbers of entries — in its heyday this was one of the largest regattas in the area, and as recently as ten years ago there were 57 entries. kiteboarding — relatively flat water and lots of wind — and the kite guys not only enjoyed themselves but also put on a great “air show” for everyone else. (As one local boat sailor expressed it, “Watch man fly!”) big breezes. In the windsurfing races, Stefan Oest from Germany won Fun Race Class and Overall First Place. Masters Class winner was Skeene Howle and Veterans Class victor was Ulrich Seidl. The Ladies’ Class top place winner was Jackie Kempson. last races, but the rest were swept up by the rest were swept last races, but Drunken Monkey at least one race, with every boat won and — MARCH 2009 CARIBBEAN COMPASS PAGE 18 Abbie ued fromthepreviousdayreleasingaBlueMarlin. Blue Magic a Dice released, plusthebluemarlinlandedbyTrinidad’s 21 sailfish,ninebluemarlin,andeightwhitemarlin on theTuesdaymorning.Totalsforfirstdaywere George’s foraBiministartacrosstheharbourmouth the three-daytournament. dorado to42poundskeptanglersbusyallthrough weighing upto163pounds,wahoo56poundsand escaped andadditionalcatchesofyellowfintuna ed, asitdiedduringthefight.Manymorebillfish show 104billfishreleasedandonebluemarlinland- Captain AndrewLlanosof Germany andGrenadafishedaswell.Officialresults Barbados, Martinique,Jamaica,theUnitedKingdom, from Trinidad&Tobago.AnglersStLucia, 206 anglers,withmorethanhalftheanglerscoming Tournament (SIBT),heldfromJanuary20ththrough23rd. were releasedatthe40thSpiceIslandBillfish fishing event prize forFirstPlaceBoatatGrenada’spremier REGATTA The seconddaystartedwithadoublehook-upfor The boatsparadedoutthroughtheCarenage,St Grenada YachtClubwashostto45boatscarrying Gary Cliffordreports:Onehundredandfourbillfish 104 ReleasedatSpiceIslandBillfishTournament hadalongfightwith163-poundyellowfin —39billfishintotal. NEWS , buttheylostbothfish. Hard PlayII Grey Ghost receivesthe contin- Miss Pair tuna. Toshowthequalityoffishing, a totalof105billfishcaught. blue marlinreleasedandonelanded,for ment whichwere:69sailfish,14whitemarlinand21 released contributedtothefinalfiguresfortourna- Top Angler.The26sailfishandthreebluemarlin was setforaveryclosefightbothTopBoatand releases, includingtwoGrandSlams. white marlinand22sailfishreleasedforatotalof37 catch ratewasstillgoodwithninebluemarlin,six was verygreeninmostareasforthedaybut — definitelyamasteranglerinthemaking!Thewater added abluemarlinreleasetohissailfishofyesterday Junior anglerMatthewRoachfishingon Equity and Sailfishinoneday).Exactlytwominuteslater, completed aGrandSlam(BlueMarlin,WhiteMarlin excuse fortheseclassicstodustoffthesails,have petition, orhigh-speedboats,itissimplyagreat ing onthecourse.Butthisraceisnotaboutcom- the racingtrulylow-key,withjustfouryachtscompet- weather wasperfect,thewaterclearandblue, that didmakeanappearancewerestunning.The event, heldJanuary22ndthrough25th,theyachts and CaribBeerformakingthiscompetitionpossible. & NicholsonsPortLouisMarina,IslandWaterWorld and tothankalltheirsponsorsespeciallyCamper pating boatsandanglersforsupportingtheevent, The SIBTcommitteewouldliketothankallthepartici- Trinidad, Tobago,Barbados,St.LuciaandMartinique. Billfish Circuit,whichalsoincludestournamentsin Top GrenadianBoatwas The awardsceremonyandclosingdinnerwasheld Day Threewasanearlystartasusualandthestage Although therewasalowturnoutforthisyear’s St.Maarten-St.Martin Classic2009“Stunning” For moreinformationvisitwww.sibtgrenada.com. SIBT isthefirsttournamentofSouthernCaribbean achievedtheirGrandSlam—greataction! tournament) was back-to-back winnerofthis of theboats). experienced thefishingonone Hon. PeterDavid(whoalso Tourism andCivilAviation,the sponsors andtheMinisterof and attendedbyanglers, at theGrenadaYachtClub Andrew Llanosof Trinidad &Tobago,and Ryan Agarof Barbados third. ond, and Reel Viking of Trinidad&Tobago,with Legacy Angler wasMatthewRoachof Beaver, was JeanneAleongof T&T. TheTopFemaleAngler Edward Aboudof Barbados, andthirdwas Adrien Johnsonof also outofT&T.Secondwas The FirstPlaceBoat(and Joint FirstPlaceAnglerswere Crazy HorseAgain , Barbados,andthe T&T.TheTopJunior Legacy ofBarbadossec- Why Worry, De ReelViking Legacy Hard PlayII of Reel Finatic Legacy Hard PlayII . Ega

, De , ,

—Continuedonnextpage year’s StMaartenHeinekenRegatta.” number oftouriststhatwillstillvisitourislandduringthis hope theycancontinuetobenefitfromthelarge tion theyhaveshownoverthepastfewyears,andwe patrons intheboardwalkareaforgreatcoopera- sponsors. Wewanttothankthebusinessesand improve fortheisland,governmentandourmany and wecertainlyhopethefinancialconditions anticipate thisparticularchangebeingpermanent, health ofourisland’sregatta.Atthistime,wedonot haps temporary,canhelpprotectthelong-term everyone understandsthatthismove,althoughper- light ofthemanyuncertaintiesweface,andhope Heineken Regattaadds,“Thismoveisnecessaryin sic make atraditionalsailor’sheartsoar. course, getsomeattentionforthetypeofyachtsthat some funinthegorgeousCaribbeanwaters,andof second overall,while yacht day, andwontheregattaoverall.The12Metreclassic Around theWorldRace,whichscoredabulleteach in 1957forCol.Whitbread,sponsoroftheWhitbread reduced forthisoneyear. complex logisticsofmovingbasesooftenwillbe relief instressandfinances,owingtothefactthat unteers andsponsorsmaybenefitfromtemporary recession andtheincreasedcostsonisland. vessels visitingtheislandthisseason,asaresultof has alreadyobservedadropinthenumberofsmaller anticipate ahealthyeventinMarch,theYachtClub that theclubreduceitsexpenses.Althoughthey purchasing ofpromotionalmedia,makeitessential fees, aswellheavyexpensesalreadymadeinthe tion inthenumberofparticipatingboatsandentry project norabsorblosses.Thehighchanceofareduc- Club, andasanonprofitorganizationtheycannot the nonprofitorganization,SintMaartenYacht TheSintMaartenHeinekenRegattaisoperatedby remain thesame. Simpson Bayforthe2009edition. on theGreatBayPromenadewillbemovedto the Marigotwaterfrontwillremain,normalparty parties ontheSimpsonBayBeach.Whileparty date moreofthesailingcontrolcentersandregatta of theevent,organizershavedecidedtoconsoli- order toavoidanythreatthelong-termcontinuity the St.MaartenHeinekenRegattaOrganization.In wide recession,projectionsstronglypredictalossfor Heineken Regatta,andinconsiderationoftheworld- for theorganizationofupcoming29thSt.Maarten through 8th.Uponcarefulreviewofthefinancialcosts Maarten HeinekenRegatta,totakeplaceMarch5th change totheeventschedulefor2009St. settle forthirdandfourthrespectively. For moreinformationvisitwww.heinekenregatta.com. In theend,itwaslastyear’swinner Heather Tackling,theDirectorofSt.Maarten As asideeffect,someofthemanyYachtClubvol- It isimportanttonotethattheracecourseswill The StMaartenYachtClubhasannounceda Venue ChangeforSt.MaartenHeinekenRegatta For moreinformationvisitwww.ClassicRegatta.com.

65-foot (20-metre)woodenyachtbuiltinScotland Kate madeagoodshowingaswell,winning Infanta

and RainDancer LoneFox, hadto a clas- MARCH 2009 CARIBBEAN COMPASS PAGE 19 The reigning champion from Marseille in 2007 is Brad The reigning champion from The IOM class was formed in the late 1980s, in For more information visit www.iomclass.org. Association, under the direction of IOMICA, the con- Association, under the direction results can be fol- trolling body for the class. Daily where we will have lowed at www.sailbarbados.com, sailing. live video streaming of all the will be sailing to retain his Gibson from Australia, who from skippers title. Strong competition is expected Denmark, Norway, from the UK, France, Italy, Portugal, Africa, New Zealand and Spain, USA, Canada, South skippers also in the mix. Australia, with the local Bajan There will be five fleets of up to 20 boats, competing under the HMS system, where either four or six boats are promoted or demoted after an opening round of seeding races. It is theoretically possible for a boat to progress from E Fleet to A Fleet in the one race by being promoted from one heat to the next. Hopefully 25 to 30 races will be completed in the prevailing 12- to 18-knot breezes predicted for the regatta. order to provide a low-cost, uncomplicated, box rule concept, radio-control yacht. The rule was worked out by a group of yacht designers, which included big- boat lateral thinker John Spencer of New Zealand, and radio control guru Graham Bantock of the UK, who set out to promote a class where amateur designers/builders could compete with the profession- als. The concept seems to have worked, as it has the strongest worldwide representation of any radio-control yacht class. Basically, the rule restricts hulls to one metre in length, 420mm draft, minimum weight of four kilos, and having a #1 rig, with a main luff length of 1.6 metres, and either wooden or aluminium spars. The only areas where carbon fibre can be used (apart from some fittings) are in the fin and rudder; the hull must be timber or fibreglass. Only two function radios are allowed to control the sail winch and rudder servo. Three rigs (jib and mainsail), are allowed, #1 used in winds of zero to ten knots approximately, #2 in ten to 17 knots, and the #3 in winds 17 knots and up to “blow-the-boats-off-the-water” strength. During the 2005 Worlds held in Moloolaba, Australia, the first day was sailed in winds of 35 to 45 knots! The 2009 Caribbean 1500 Rally will be the 20th annu- 1500 Rally will be the The 2009 Caribbean is widely supported The Cruising Rally Association rallies and Ocean Sailing For full information on future Barbados Ready for Early From the Boatyard at Renata Goodridge reports: The Skippers’ Briefing will be held on Thursday, May This regatta is not only home to the Mount Gay hat For more information visit www.sailbarbados.com. Barbados to Host World Championships Renata Goodridge reports: The 2009 International wait for the next weather window to leave for the sec- weather window to leave wait for the next boats head point, smaller groups of ond leg. At that continue destinations and informally off for different as they go.” the radio call-ins and lon- event, making it the largest al running of this Americas. cruising event in The gest-running offshore Ralliers for a record entry of returning Black anticipates 1500 is activities. The 2009 Caribbean the anniversary November 2nd. slated to start marine, tourism, and by leading companies in the Davenport & financial industries. These include Hotel, Marina, and Company LLC, Nanny Cay Water Sailing, World Boatyard, West Marine, Blue Quantum Sail Design, Gill, Cruising Ltd., Switlik, ICOM, Yachting Center, Hydrovane, OCENS, Bluewater Towne Mortgage, Hampton’s Towne Bank and and Visitors Bureau, Hampton Roads Convention Almanac. Mount Gay Rum, and Reed’s Seminars visit www.carib1500.com. Mount Gay/Boatyard Regatta the Barbados Yacht Club one end of Carlisle Bay, to beach along the bay will at the other, the waters and spectators, family and once again be home to sailors, Gay/Boatyard friends participating in the Mount Regatta, May 14th through 17th. Normally the regatta runs two weeks later, at the end of May, so heads up to all those sailors from overseas who want not only the challenge of great coastal racing, but also the challenge of sailing to windward to reach Barbados! 14th at the Barbados Yacht Club, and racing will take place Friday through Sunday. There will be racing both in the bay and along the south coast of the island. Veterans of this regatta know the winds usually blow pretty hard, adding to the challenge of the courses. There will be racing and cruising classes, along with a J/24 one-design class. The Friday night festivities take place at the Barbados Yacht Club, with the Saturday night and Sunday Awards parties taking place at the Boatyard — all events to take part in. and the infamous rum, it is also the home of the Mount Gay skippers’ bags, full of event information and many other goodies which the sponsors Mount Gay Rum, the Boatyard, and the Barbados Yacht Club find. We hope to see you there! for Radio Boats One Meter World Championships are to be held from June 20th through 27th, with racing taking place in the beautiful Caribbean waters of Carlisle Bay, Barbados. Up to 76 skippers from all corners of the globe will compete to find the new World Champion. It will be the first time the IOM class has staged an event of this stature in this part of the world, and it was only made possible by the efforts of the Organizing Committee in Barbados — the Barbados Sailing see . . F D P G A P

see ad on page 13 T N E M E see ad on page 12 E R ' E . B I A R A # Continued from previous page Continued from 2009 BVI Spring Regatta Welcomes Beach Cats Regatta Welcomes Beach 2009 BVI Spring in the With the economy being Linda Phillips reports: explained the initiative: Judy Petz, Regatta Director, LIME One Design course The beach cats race on the Festival is celebrat- The BVI Spring Regatta & Sailing For more information visit www.bvispringregatta.org. Upcoming Events Not To Miss! Planning your sailing itinerary? Make these iconic • Grenada Round-the-Island Race, March 13th • Bequia Easter Regatta, April 9th through 13th. • Antigua Classic Yacht Regatta, April 16th through Tortola-to-Bermuda Rally to Depart May 3rd The Atlantic Cup Rally will depart from Nanny Cay “Over the years, we have found it best to split the toilet and race enthusiasts wanting to compete as enthusiasts wanting to compete toilet and race organizing the BVI Spring Regatta much as possible, are that sailors Caribbean-wide committee expects BVI Spring for welcoming venues. going to be looking inclusive looked for ways to be Regatta has always cat sailors and this year beach rather than exclusive, for beach because all-night security should take note cats has been added. coming to BVI Spring “In looking at who has been increase in almost every Regatta, we have seen an the beach cats. Tomas fleet with the exception of Rico, suggested that Dadet, from PR Links in Puerto sure that their boats beach cat sailors want to make the parties in the are safe while they are enjoying or getting a good night’s Nanny Cay Regatta Village decided that hiring all- sleep. With that in mind, we on the beach was well night security for the boats we want the beach worth it. The bottom line is that event.” cat sailors to be part of our course is set closest to with the IC24s and Lasers. This spectating. This Nanny Cay’s shoreline for great umpires. course also hosts the on-the-water March 30th through April ing its 38th anniversary from with two events back- 5th. It is now a seven-day event to-back attracting an average of 150 yachts per year, with 80 percent of the competitors from overseas. Caribbean regattas a must: through 15th. A quintessential around-the-island race, and much more — — Races for yachts, local double-enders, J/24s, coconut Races for yachts, local double-enders, J/24s, coconut boats and crazy craft — 21st. See the grande dames of sail on parade — Marina, Tortola on May 3rd, and finish in Bermuda four Marina, Tortola on May 3rd, and finish in Bermuda four or five days later. The Atlantic Cup is the companion rally to November’s Caribbean 1500 and offers the opportunity for returning cruisers to enjoy the camaraderie, competition, and adventure of an 850-mile rally. Pre-start festivities and skippers’ briefings will begin on May 1st. return trip from the BVI to the States into two legs. In the spring, two short weather windows seem to be more frequent than a single longer one,” said Steve Black, founder and president of the Cruising Rally Association. “The Atlantic Cup is an organized rally from Tortola to Bermuda, complete with radio call schedules, professional weather routing, transponders, social events, and awards. The passage often takes advantage of the easterly tradewinds. And then, we ad on page 11 MARCH 2009 CARIBBEAN COMPASS PAGE 20

nautical milessouthwesttotheMánamoRiver’s wing withalittlehelpfromtheironhorse,aneasy55 yachts, weskirtedtheoilfieldsandsailedwing-and- Venezuela. Followingwaypointssharedbyprevious boat, Chaguaramas, Trinidad,aboardourliveaboardsail- Time OutintheMánamo It wasstilldarkasmyhusbandNeilsandIleft DESTINATIONS Baraka, boundfortheportofPedernales, by RuthLund Dom on rienced “rivertravelers”—Tom,Johness,Alexand season parties. from theend-of-yearboatyardworkfrenzyandfestive part oftheOrinocodelta,bothtimestakingabreak mouth. Thiswasoursecondforayintothisnorthern Rio Mánamo nestles alongsidetheforestonSouthAmerican Baraka, The previousyearwehadrendezvousedwithexpe- a SouthAfrican-builtferrocementketch, S/V Sparrow— whohadalreadyspenta couple aboardtheSwissketch down thePedernalesRiver. Mánamo River,acrossanarrow,butdeep, spent anidyllictimefollowingtheirleadupthe week, sowewerewelcomedenthusiasticallyand and otherfreshstufftofeedbothboatsforanother arrived loadedwithenoughChristmasham,turkey without afridgeonboard.Byarrangement,ourboat month exploringtheMánamo,somehowmanaging —Continuedonnextpage down thevastriver. the daycallingonradioandsearchingup lost touchwitheachotherandwespenttherestof unfortunate groundingwasthatthetwoboatstotally result of ed forhours,eventuallykedgingtheboatoff.The Aenea’s tom twice,butwereabletoreverseoff.However and waterlilieswithourhull.Laterwetouchedbot- where itled,dodgingbrancheswithourspreaders happy!” Iknewexactlywhathemeant. an uncharacteristicoutburstandsaid,“Ifeelso stressful influences,washeaven.Nielsturnedtomein totally relaxinginanenvironmentcutofffromall varied plantsandstrangelyshapedriverdolphin, lars forbutterflies,birdsandmonkeys,enjoyingthe Swatting theoddhorsefly,lookingthroughbinocu- the riveredgeisoftenmuchdeeperthanmiddle. enough tothebranchesoftalltreestouchthem,as up ordownstream. a people-packedcanoewithminimalfreeboard,flying occasional outboard(suppliedbyChavez,Ibelieve)on only reminderofChaguaramaswasthewhinean from theCaribbean’stourist-dominatedislands.The still relativelypristineandunspoiled,vastlydifferent “Heart ofDarkness”,thisamazingeco-destinationis tropical forestandbig,bigriver.IfnotexactlyConrad’s ment behindandenteringthemysteriousworldof into theMánamo,soonleavingallsignsofdevelop- netting hastilyerectedoverthecockpit. national mixofChristmastraditionsundermosquito together on in theirregister(nocharge),wespentChristmasEve Pedernales PoliceStationwheretheywroteourdetails in” intheafternoon,whichsimplymeantgoingto This yearourcongenialsailingcompanionswerethe We tookourfat Meandering slowlyalong,weweresometimesclose Next morningweeasedourwayovertidalshallows crew Baraka’s Baraka

was notsoluckyandendedupstrand- adventuresomedetourand Baraka enjoyingthecruisers’usualinter- downanarrowcañotosee Aenea . Having“cleared caño Aenea’s and MARCH 2009 CARIBBEAN COMPASS PAGE 21 in Trinidad. S/V Baraka Bartering with the shy, but friendly Warao people en Bartering with the shy, but we never felt threat- Throughout the entire journey, was bouncy, but could The trip back up to Trinidad River Trip Essentials • reliable depth sounder and VHF radio • mosquito nets, insect repellent, bat and fly swatter • river cruising notes with waypoints from other • canoe, kayak or rowing dinghy for silent • camera, binoculars and bird identification book • useful goods to barter (nothing requiring batteries) • sweets or snacks to give to the children • provisions, fuel and water for entire trip • good company of another yacht • ability to relax into slow mode Ruth Lund lives aboard macaws, toucans, parrots, hawks, herons, hoatzins, parrots, hawks, herons, macaws, toucans, looked like and small mud-waders that woodpeckers of the trip they rose in flight. A highlight confetti when sunsets where we spent two awesome was Ibis Island, scarlet ibises upon thousands of watching thousands the trees in their chosen spots, until fly in to roost red paint. were dripping with glowing looked as if they we put up our river was so broad that At one point the to the depth a short time, eyes glued spinnaker for we needed to drop it rapidly. sounder in case exchanged cloth, sewing route was a pleasure. We rigging rope and kits, T-shirts, toiletries, fishhooks, beadwork and a carved wire for a variety of baskets, navigate their long, narrow wooden paddle. How they and accurate direction, canoes with perfect balance and moving about without paddling, bailing, standing Most houses are con- tipping over, I do not know. for centuries — a wooden structed as they have been of leaves, furnished with pole platform with a roof storage baskets. But sleeping hammocks and hanging plastic tarpaulins were corrugated iron, bricks and been the previous year. more evident than they had generators, outboard There were also more electric engines and factory-made boats. aware that this uniqueened in any way, but were keenly increasing threat.natural environment is under a perfect “time out” not diminish what was essentially from our busy lives. yachts (copies are available in Trinidad from Boaters Enterprise or Members Only Taxi Service) nature watching At night, with little moon, the stars were truly mag- eventually found each other in the morning, hearing eventually found each other in the morning, hearing Ronaldo’s distinctive radio call “South Africa, South Africa — this is Switzerland”. We decided it would be wise to keep each other in sight from then on. nificent. During the day we saw howler monkeys, faulty VHF could not be heard and we kept Continued from previous page Baraka’s Shy but friendly, the Warao people navigate their long, narrow dugout canoes with perfect accuracy Shy but friendly, the Warao people navigate their long, — passing each other on different sides of the islands in passing each other on different sides of the islands in the middle of the river, divided by walls of tall foliage. After spending the night anchored separately, we MARCH 2009 CARIBBEAN COMPASS PAGE 22

along theopenroadsteadwerewellspreadforcruisingboats.Next,inbound of moorings—MoorSeacurefromTortola.Acouplehundredwell-plannedbuoys sight I’dseeninafewweeks:mooringfieldbuiltbynoneotherthanthemasters at times.Ourmid-morningsailthoughthisareawasnothingshortofperfect. really, althoughyoucouldseewhereanorthswellmakeitlittlehair-raising went. Whatabeautifulsailthroughthatareaofso-calleddanger.Notmuchtoit, night. Let’sheadforthebarn!AquickstudyofchartTheNarrowsandoffwe CASIMIR HOFFMANN DESTINATIONS QUIET CLEAN POWER Then camethegoodstuff.AsIsailedalongleeofislandtherewasbest Falling offandsettinganewcourseboundforNeviswastheonlyrealoptionthat G a long life in a bullet proof package. a longlife inabulletproof ina6literengineensures Generating 135hpat amodest2600rpm make theM135acost effectivemake choice withsignificantowner savings over alternative engines. pricing, Competitive engineandparts and exceptionally intervals low service fuelconsumption extended integral plate inthetoughest sealsgivingprotection oil cooler conditions. and specialcrankshaft temperatures for exceptionally reliable anddurable performance. Leak free operation is ensured by an heatexchange Highcapacity tubestacksensure equipmentwithcupro-nickel low component operating points ineithersingleortwininstallations. designed to permit awiderange ofoperating anglesandalsooffers easyaccess to allroutine servicing The M135isanexcellent repower choice. initsclass, packages Oneofthemostcompact ithasbeen new 'QUADRAM' combustion system andfullyclosedbreather system. costs.service It’s operator andenvironment friendlywithlow noiseandlow emissions achieved withthe This naturally aspirated engineboastspremium enginefeatures for reliability, minimaldown timeand kicked outofusgoingfromSt.BarthstoAntigua. schooner Leeward IslandsinJanuary.Itturnsouttobeagoodoption,asmy etting blownintoNeviscanbealltoocommonifyouaresailingthe Amanda andIfoundoutwhenweweregettingthebejesus by KevinGray Sabre M135 Sabre ORWHAT? IS ITHOT M65 M92B M115T M135 M225Ti M265Ti M300Ti M65 M92BM115TM135M225Ti M265Ti cruising alongthecoast schooner, Right: Theauthor’s be delightful or apitstop,Neviscan Left: Asaplannedstop NEVIS: a breeze.Iwasn’tunhappytostay. my passportandboatpapers.Anothervisittotheofficialswasinorder—it and madetheanchoragequitepleasant. out oftheeast.Anextralinebacktoavacantmooringbehindmetookroll wind howledthroughatupto35knotswithafewhighergusts,blowingrelentlessly — soclosebutyetfar.Only50milestotheeast,daysandawayas loved it. although Iwasnotabletohikebecauseofafootinjury.Everyhikerspokewithjust get upthere. ones intheBritishVirginIslandsandit’shardtoimaginehowthisproducedoesn’t are justincredible—andthelistgoesonon.Priceswillastoundyouafter duce someamazingcropsofgreenbeansandcarrots,aleafylettuce,tomatoesthat organic gardening,whichisaspin-offfromthetouristrestaurantshere.Theypro- ful veggiesyouwillseeonanyisland.Itturnsoutthatlocalfarmersareinto to firstimpressions. being welcomesomewhereasacruiser!Whattreatthisplaceis,whenitcomes lars fromyouaftersomeminorpaperworkandabigsmile.Oh,forthedaysof by thePortCaptain.He’sinalittleofficeatmaindockandwilltakefewdol- of minutesyouarestampedinforthetimerequest. was thelocalImmigrationOffice,whichisalsoPoliceStation,whereinamatter Charlestown isanOldCaribbeantreatofarchitectureandislandculture.Nextstop formal butverywelcoming. islands, soofficialsarestillgladtoseeyouandyourboat.TheCustomsguyswere ing boatsandthemoneytheybringin.Nevisisnotahub,likebigyachting clearance procedurewasapleasure,asthepeoplehereareveryappreciativeofvisit- As thewindwasnotgoingtoeaseanytimesoon,avisaextensionneededin For severaldaystheweatherwasstillnotinmyfavortocontinueonAntigua Themountainousinterioroftheisland,byallaccounts,iswellworthvisit, So nowcomesthereallygoodstuff:aWestIndianmarketfullofmostbeauti- Now aboutthosemoorings:theyareownedbythePortAuthorityandmanaged After that,itwastimetostrollthroughoneoftheWestIndies’prettiestlittletowns. Amanda ,

Call uson (284)4942830for adealernearyou. KEVIN GRAY KEVIN MARCH 2009 CARIBBEAN COMPASS PAGE 23

ALL PHOTOS: JOHN GIDEONSE on-site meeting please contact our Sales and Marketing Co-ordinator, Danny Donelan on-site meeting please contact our Sales and Marketing Co-ordinator, on +1(473) 435 7432 or email [email protected] Limited availability the advantages of slip ownership, please contact our International Sales Manager, the advantages of slip ownership, please contact our International Sales Manager, Anna Tabone, on +356 2248 0000 or email [email protected] Anna Tabone, Slips are available for sale or rental. For a private consultation to discuss To fully appreciate this rare opportunity, we highly recommend a visit. To arrange an we highly recommend a visit. To fully appreciate this rare opportunity, To Lingering in the the in Lingering Land of the Maya Land by Suzanne Longacre by Suzanne Longacre ALL ASHORE… No cruise to the Yucatan peninsula is complete without a trip inland to view the astounding Grand Pyramid No cruise to the Yucatan peninsula is complete without at Chichén Itzá

with Time-Life , the pre- Zeelander, Ruta Maya WEST INDIES we were cruising north we were cruising the Rio to Mexico from we Dulce and Belize,

—Continued on next page to share with his family and to share with his family and

The Mayans, Port Louis, Grenada of all sizes up to 90m available right now for sale or rental. powder-white beaches, rainforests, spice plantations and a calendar packed with rainforests, spice plantations and a calendar packed with beaches, powder-white regattas and festivals. Grenada is also the gateway to the Grenadines, one of the hotels, villas, restaurants and bars, plus some of the ﬁnest boutiques and shops in the region. ITALY | MALTA | TURKEY | | MALTA ITALY Now there’s another good reason to visit. There are 50 new fully serviced slips for yachtsNow there’s Nowhere extends a warmer can expect welcome than Port Louis, Grenada. Visitors Sitting alongside the marina, the forthcoming Port will include luxury Louis Maritime Village world’s most beautiful and unspoilt cruising areas. world’s

A warmawaits you and your yacht at Port welcome Louis WHEN We were shocked when the shipyard manager at shipyard manager at We were shocked when the We were previously unaware that, unlike in Mexico We were previously unaware While we had visited the ancient temple ruins at While we had visited the One of the first trips we took when our family came

Puerto Isla Mujeres, where we stored our boat on the we stored our boat on the Puerto Isla Mujeres, where told us that the local hard during hurricane season, nothing of their Mayan population learns virtually history or heritage in the mostly Catholic schools. As a small compensation, we gave him our City where the dominant Aztec civilization and its City where the dominant or assimilated dur- peoples were essentially destroyed the Mayan periods of civili- ing the Spanish Conquest, and declined a few hun- zation and prominence rose So the Mayans posed dred years before the Conquest. the Spanish. What this no threat or resistance to locals with whom cruisers translates into is that the Mayans. come in contact are usually Xunantinich in Belize, and Tulum in Guatemala many Xunantinich in Belize, and forward to learning more years ago, we were looking its descendants in the about this civilization and Roo and Yucatan. Mexican states of Quintana to visit over the holidays was to Xcaret, an excellent eco-archeological theme park 75 miles south of Cancun and reachable by ferry from Isla Mujeres. Xcaret allows visitors to experience and appreciate the local cultures and heritage through reenactments of sacred rituals, authentic architecture and sculptures, exhib- its, a Mayan Village and musical performances throughout the park, using primitive instruments from the ancient Mayan civilization copied from stelae, books and artifacts in museums. its two canoe hulls was sailing the its two canoe civilization. route of the Mayan Columbian trading affairs of the a major role in the life and Canoes played along with and the few that remain, ancient Maya, naviga- bear witness to the Mayans’ written accounts, in building and commercial prowess tional ingenuity and specialties indige- wealth by bartering produce nous to each region. video, friends, for which he was most grateful. The Mexican government is taking broad steps to make up for this historical deficiency, to the benefit of locals and foreign tourists alike. were conscious that our catamaran, were conscious MARCH 2009 CARIBBEAN COMPASS PAGE 24 Seeing thesacredritualofPapantlaFlyersatXcaretwasauthor’spersonalfavoriteexperience which sustain the beauty of the Yucatan Peninsula, which sustainthebeautyofYucatanPeninsula, forerunner ofthenow-secularbungeejumping. was thethrillingsacredritualofPapantlaFlyers,a Game —mygrandson’sfavorite.Mypersonalfavorite is breathtaking,especiallytherecreatedMayanBall Spanish Conquest,IndependencetomodernMexico.It the countryfromMayansandToltecsthrough world-famous FolkloricBalletpresentingthehistoryof performance ofMexicanfolklore,whichfeaturesthe extravaganza “XcaretAtNight”,acolorfulthree-hour — Visitors also see firsthand the ecological systems Visitors alsoseefirsthandtheecologicalsystems Don’t missbeingwelcomedbyMayanwarriorstothe Continued frompreviouspage snorkeling areeasilyaccessible.Thisisalaid-back with remnantsofruinsandsuperbsnorkeling. sanctuary andmigrationstopforamultitudeofbirds, miles northofIslaMujeres.Thisisanuninhabited phins. Fiverestaurantsofferbuffetsofdiversecuisine. done CoralReefAquarium,andevenbeachesdol- the newlydiscoveredRioParadisoanditstunnel,awell- parrots andhowlermonkeys.Thereisarafttripthrough walk forencounterswithjaguars,wildboar,pumas, can snorkel-float,andthejunglethroughwhichyou including theUndergroundRiverthroughwhichyou On IslaMujeres,swimmingwiththedolphinsand We alsoenjoyedaday’sboattourtoIslaContoy,14 swim in for centuriesinthisparchedland.Itispopularto one ofmanysinkholesthatservedaswaterreservoirs Arabs, computedafigureofprecisely365.2420days! numeration longbeforeEuropeanslearneditfromthe spans 365.2422days.TheMayans,whodiscoveredplace measuring techniqueshavetoldusthatthesolaryear humbling whenyourealizedthatourmoderntime- fected theMayancalendarasearly200BC.Thisis Mayans discoveredtheabstractconceptofzeroandper- constructed tocorrespondtheMayancalendar.The course thefamousBallCourt—largestinMexico. many jaguars,featheredserpents,warriorsandof influence, thelatterbeingmorewar-like,andfeaturing round observatoryandnunnerythelaterToltec differences betweentheearlier“pure”Mayanwithits even aftertheSpanishcame.Youcanseeclearly Well wasthesceneofhumansacrificeforcenturies, the Toltecsinvadedintenthcentury.TheSacred 432AD, andthelaterMayan-Tolteccity,combinedafter in theculturesofancientMaya,datingbackto traditional MéridaSaturdayNightMexicanFiesta. delicious Yucatan cuisine and also continental favorites. delicious Yucatancuisineandalsocontinentalfavorites. great shoppingandsuperbrestaurantsfeaturingboth galleries, majormedicalcenters,universities,libraries, quite cosmopolitanwiththeaters,manymuseums,art people watching.MéridaisaSpanishcolonialcity,yet stands featuringMexicanfood,streetperformersand Gran Plazafordancing,singing,outdoorcafés,mobile rotating betweentheupscalePaseodeMontejoand temperature isbracing. 9:00 General’s mansiononthemaindrag,Calle60),at downtown CasadelBalamhotel(anexquisiteformer fortable air-conditionedtourbuspickedusupatour one oftheNewSevenWondersWorld.Ourcom- most extensivelyrestoredsites,wasrecentlynamed there. Thisancientcity,oneofthebestknownand major MayansiteofChichénItzáonadaytripfrom Yucatan capitalofMérida,wedecidedtovisitthe Mayan ruinsalongthesouthernoceanroad. and theburgeoningRivieraMaya.Thereareeven development ofitsbigneighborsCancun,Cozumel which hasnotyetsuccumbedtothefive-starover- island withacharmingandsomewhatfunkytown, We stoppedata The pyramidisawesome,withitselementscarefully We hadanexcellenttourguideandwereimmersed Back in Mérida, we enjoyed the weekend festivities, Back inMérida,weenjoyedtheweekendfestivities, As itwasonlyanhourandahalfawayfromthe AM andreturnedusat5:30 cenotes , whichare“bottomless”.Thewater cenote enroutebacktoMérida— —Continued onnextpage PM , intimetoenjoythe MARCH 2009 CARIBBEAN COMPASS PAGE 25 , Zeelander cenotes Suzanne Longacre and Captain John Gideonse are Our liveaboard stay at Villa Vera Puerto Isla Mujeres Above: Isla Contoy is an uninhabited sanctuary and Above: Isla Contoy is an uninhabited of birds, with remnants migration stop for a multitude of ruins and superb snorkeling Left: One of many sinkholes that served as water reservoirs for centuries in this parched land. It is now popular to swim in these currently cruising the mid-Caribbean aboard a 39-foot Privilege catamaran. Marina has been enriched by our greater understand- ing of and deep respect for the Mayan civilization that thrived for centuries on this peninsula. We are glad that the Mayan contribution to the history of human development is being recognized now and interpreted for everyone to learn from. While Isla Mujeres is often just a way station for many cruisers traveling between Florida or the Gulf States and the Western Caribbean delights of Belize, the Rio Dulce and Panama, we are happy we lingered long enough to absorb some of the local history and culture. of the Cathedral of San Idelfonso — the oldest cathe- of San Idelfonso — the of the Cathedral the plaza continent — across dral on the American the plaza are On the opposite sides of from City Hall. Palace, the founder and the Governor’s the mansion of the history of 27 huge murals depicting which features well worth the visit. the Yucatan — . AM bus (four hours and US$20 round trip), we took Mérida was founded by Spanish Francisco de Montejo Before we left Mérida for Cancun via express deluxe in 1542. When the Spaniards arrived, Mérida was a in 1542. When the Spaniards arrived, Mérida was a large Mayan city known as T’ho, situated on what is now the Gran Plaza. The Spaniards dismantled all the pyramids and used the huge stones as the foundation ADO the free Historic District English-speaking guided walking tour, which leaves daily on weekdays from City Hall in the Gran Plaza at 9:30 that toured that toured Turibus Continued from previous page The best and most impressive museum is the The best and most impressive museum is the Our favorites were La Casa de Frida and Café Amorro, — Anthropology and History Museum, which is chock- full of Mayan artifacts from the ruin sites around the peninsula. The explanatory signs are in Spanish and English and extremely well presented. Although Mérida is a safe walking city, we took a double-deck- er “hop on and off” sightseeing both off the Gran Plaza. the entire city and its environs. MARCH 2009 CARIBBEAN COMPASS PAGE 26 Grenada to replaceabrokenbackstay. he madealeisurely17-daycrossingtoBarbados.PlansincludestopinGrenada tional routedownthecoastofSpaintoMadeira,thenCapeVerdesfromwhere before headingbackhome.It’shisfirsttriptotheCaribbean.Hetooktradi- of theMaryDeare in HammondInnes’still-engrossingbookandequallymemorable1959film, Autohelm asback-up. Halmatic, isequippedwithaHydrovaneself-steeringgear,thoughNeedhamalsohas after hesoldanotherNicholson? this oneofthefeatureshewaslookingforfollowinga15-yearhiatuswithoutboat tional equipmentandreplacingaPerkins4107enginewith44horsepowerBETA. it intobluewatercruisingcondition.Amongtheimprovementswereupgradingnaviga- well-known designingandbuildingcompany,CamperNicholson. established HalmaticcompanyintheUK1970fromdesignbyequally Solara tried Britishfirms. there arethosewhostillbelieveina1970sboatdesignedandbuiltbytested-and- designs fromavarietyofenterprisingbusinesspeopleonbothsidestheAtlantic, tional boat.TheNicholson38satisfiedmeinalltheseareas.” ketch rigthatIcouldhandlealoneandagoodseaboat—inshort,func- the cockpitarea.Also,Iwantedareasonablypricedboatwithgoodresalevalue, comfort, relaxinginportsandalsoatsea,withbothroomthemaincabin he waslookingfor Peter NeedhamsaysthattheoldfaithfulNicholson38designhasallfeatures Needham, whosehomeportisLymington,theoutofwhich The fiberglassclassichasacentrecockpitversionwithtraditionaldoghouse.Was Needham saidheboughttheNicholson38in1998and“didalotofwork”onittoget One ofthemisBritisherPeterNeedham.Herecentlysailedhis38-footketch, Despite thecomingonstreamofmanynew(somesay“improved”)cruisingboat The Needham answered,“BecauseIliveaboardevenintheUK,waslookingforsome appear in the AYC FALMOUTH JOLLY HARBOUR ST JOHN’S HODGES BAY Antigua YachtClub Jane’s YachtServices Falmouth HarbourMarina Cat ClubMarinaOffice Bailey’s Supermarket Antigua YachtServices Marina Office Epicurean Budget Marine Anjo Insurance QueenElizabethHighway Island MotorsGasStation, CustomerServicedesk Epicurean, WoodsMall, Colonna SunsailResort Ahoy, Boat fromthe1970s , toBarbadosaspartofaCaribbeancruise.Itwasmadebythelong- Solara A Good,Functional Caribbean Compass DIFFERENT BOATSFORFOLKS Compass bold (ex- PICK UP! ): Blue Mink , plannedtovisitsomeoftheEasternCaribbeanislandchain Readers!WheninAntigua,pickupyourfreemonthlycopyof atanyoftheselocations(advertisersinthisissue ), whichishullnumber54oftheover100madeby by NormanFaria ENGLISH HARBOUR DOCKYARD/ The Anchorage Sunsail ReceptionOffice Galley Bar Copper &LumberHotel Coffee Shop Antigua SlipwayChandlery Slipway Chandlery Skullduggery &SeaBreeze Lord Jim’sLocker Mongoose Last Lemming&Mad AYC MarinaOffice Seawitch

sailed Wreck NORMAN FARIA NORMAN

MARCH 2009 CARIBBEAN COMPASS PAGE 27 postponed to 2009 to postponed , Jan finally Hummel Hummel Jan holds the compass while Marcus looks like he wants to keep the flexible solar panel in his hands as a souvenir! f NORMAN FARIA dd b h , built in the German Democratic Republic in 1978, by Norman Faria by Norman F Hummel See how to subscribe at: h

in the island’s Carlisle Bay yacht anchorage on board the in the island’s Carlisle Bay DIFFERENT BOATS FOR DIFFERENT FOLKS BOATS FOR DIFFERENT DIFFERENT 12 issues US$29.95, 24 issues US$53.95 hd Join our growing list of on-line subscribers! www.caribbeancompass.com Linda and Roger Hutchinson S/V Sandcastle We enjoy your articlesWe always Dear Compass, A Hard Delivery Job Delivery A Hard — keep them coming! Hey fellows, drop us a line and let us know how the good ship Hey fellows, drop us a line and let us know how the Marcus, an insurance coordinator, said it was his first ocean cruise. He was Marcus, an insurance coordinator, said it was his “How is the delivery business going these days in Europe?” I asked. Jan: “There is “How is the delivery business going these days in Europe?” While in Barbados they were trying to get the 20-horsepower Volvo engines and While in Barbados they were trying to get the 20-horsepower What made things easier for them was a little roll-out solar panel. Swiss-made, it What made things easier for them was a little roll-out They had a rough trip. First the batteries went dead soon after leaving Gran They had a rough trip. First the batteries went dead Th Enter Jan Liehmann, an Austrian sailing school operator and part time delivery sailing school operator and part time delivery Enter Jan Liehmann, an Austrian When a German veterinarian, her husband and their three-year-old child arrived her husband and their three-year-old child arrived When a German veterinarian, reached Venezuela! seasick at first but “got used to it”. Did they contact the vet in Venezuela to tell them seasick at first but “got used to it”. Did they contact the troubles but they said they they are on their way? Jan: “Yep. We told them of the understood.” business. I do it mainly in winter when my school is closed. Mainly charter boats. business. I do it mainly in winter when my school is I go around to the bars and Aside from my contacts with the charter boat firms, yacht clubs asking a few questions.” still appears in good shape, despite a few rust streaks on the hull. still appears in good shape, despite a few rust streaks batteries looked at. The helped keep the GPS batteries up, for example. Jan cups his hand to his mouth, helped keep the GPS batteries up, for example. Jan publicity? It is really a useful leans over and whispers, “Can you give them a little product for boaters. Their website is www.offgridsystems.ch.” Canaria and the engine wouldn’t start for charging purposes. Then they met up with Canaria and the engine wouldn’t start for charging purposes. for three days and at one time a couple of gales, in one case making them heave-to gear worked “when it “doing 12 knots on a storm jib”. Their so-called self-steering off, at the tiller. They had felt like it”. They traded watches, six hours on, six hours off”. They ran short of food. to use a hand-held compass, as the main one was “way was hard. They had a long passage — 30 days — to Barbados. It said he first met the family in Gibraltar when he was on another delivery job. “I guess in Gibraltar when he was on another delivery job. “I guess said he first met the family thinking of having somebody take it across for them. at the time they were already my and took it over from them — and here I am with Anyhow, I went to the Canaries helping me as crew.” friend Marcus Semowoniuk skipper. He took over the boat in the Canaries and sailed it with a friend as crew to in the Canaries and sailed it with a friend as crew skipper. He took over the boat it with its owners in Venezuela. Speaking with Barbados on his way to reunite Compass in the Canary Islands from the Netherlands recently on board a small steel boat, they the Netherlands recently on board a small steel boat, they in the Canary Islands from buy a mile more!” They headed for the travel agent to were so seasick they said “Not the trip to Venezuela where she worked. But what about tickets to continue on the cutter? boat, a 3.8-metre German-built MARCH 2009 CARIBBEAN COMPASS PAGE 28 Date Other Port Name plete Level with 1beingthelowestand10highest. Please answerthefollowingquestionswithagradeof1to10, Number Number comment Number If ______www.caribbeancompass.com, whichyoucandownload,printoutandmailin. themselves canallbenefit.Weshareacopyhere. data fromwhichgovernments,thebusinesscommunityandultimatelyyachties marine tradesassociationsintheregion—hasdesignedasurveyformtotrycollect tomers” ofthatindustryareandwhattheirwantsare. impact theyachtingindustry—withoutmuchin-depthunderstandingofwho“cus- Number Date Size Yacht If Yachtsmen

Tel: +596(0)5967480Fax: 596 [email protected] Please fillouttheformandmailhardcopiesto: The CaribbeanMarineAssociation—theumbrellabodyfornationalrecreational All toooften,itseems,actionsaretakenbyboththepublicandprivatesectorwhich own bareboat Customs Immigration motor own sail skippered bareboat

of of one of

of details ports

vessel, vessel vessel

entry

departure entry

satisfaction

of of of of country __

What DoYachtspeopleReallyWant?

form on

crew other Caribbean previous

and __ __

visited

charter

______their

______feet

port skippered

for __

women

______

islands ______

Yachting

______each experience

of in

with visits

__ registry

this islands

Centre deCarenage97290LeMarin

island

cruising

charter,

still

service

to country

this

to or

and

visited visited.

visit home

the received where country

the ______

___ Caribbean on

level port

did this

from: ______

______

of you Caribbean MarineAssociation

trip Industry

service

and join

___ We’ll also post a copy on our website, We’ll alsopostacopyonourwebsite,

visiting the

they Antifouling Epoxy Batteries Marine Paints Plumbing Zinc Anodes IN MARTINIQUE MAINTENANCE BOAT FOR SPECIALIST THE

vessel?

have

our

received.

islands

Le Marin

Customer are

Please

invited

com- __ __

What The ______Comments

Would Would On

On wish On What On your help! designed tocollectdataforusebytheregionalyacht-tradescommunity.Thanks duct everytwoorthreeyearstogetknowourreadersbetter.TheCMAsurveyis rate of Other Local Marina Port e-mail Boat Name Marina Internet Car Provisioning Banking Marine Please notethatthisisnottheCaribbeanCompassReaders’Survey,whichwecon- We’ll forwardthemtotheCMA(yes,theyknowaboutthis!)

a a a a crime

following

scale scale scale scale the

is is

hire

you you Authority

name

restaurants the the

______(please

______

friendliness on engineering services security

St. Vincent&theGrenadines Bequia PO Box175BQ Compass PublishingLtd

so. access of of of of __ consider consider services ______

single single

Satisfaction

this

1 1 1 1 ______

information

__ to to to to

name)

island?

10 10 10 10

__ thing thing __ __

visiting visiting

(10 (10 (10 (10

services

bars ______

you you the

being being being being ___

______population any this

not least most

__ most highest) expensive) worst)

required. other island

liked liked

friendly)

what

Caribbean

about again? rate __ about

rate Only

your

your this

this

the Yes/No

complete Survey

satisfaction islands

island? value island? perception

for

the in

______

money the

personal

with

future?

this of

this

data

island

Yes/No

island

you ___

MARCH 2009 CARIBBEAN COMPASS PAGE 29

t A e L n E . U v t Z E n a N E c V

@ , e Z n U i r R a C

A m L u

d O a T R or two J boats to get our materi- n E a U x P

: ,

L I O Rambler A A U M - G and E

R -

U 4 4 G

8 & GUARAGUAO, PUERTO LA CRUZ, VENEZUELA LA & GUARAGUAO, PUERTO & 3 - Icap Leopard 5 A D 6 N 2

A ) R 1 I 8 : M 2

( R

E 8 N 5

R : L O E TEL: 58 (281) 265-3844 - E-MAIL : [email protected] : [email protected] 58 (281) 265-3844 - E-MAIL TEL: T C CORNER: MIRANDA CORNER: THE CRUISING SAILOR`S CHANDLERY SINCE 1990 THE CRUISING SAILOR`S CHANDLERY The Business of Caribbean Regatta Marketing The Business of the World Robbie Ferron, attended Sailing Association’s president, The Caribbean for by “Corinthian” oriented organizations has been dominated The sport of sailing but actual- about the “business of sailing” was advertised as being This conference been reading the sailing websites regularly, I had not While I, like many sailors, have means less and less opportunity to get a share of the For Caribbean regattas this It may also mean that our Caribbean regattas will want to select media channels regattas will want to select media channels It may also mean that our Caribbean marketing their forum and The organizers of this forum did an outstanding job at are still in the process of This is unfortunate, as the business models of these events Imray-Iolare Charts Want You… “We are very proud of …to help update their Caribbean charts. Don Street says, has been enlarged to “Recently, the marina at Palmas del Mar, Puerto Rico, on the above mari- “For the last six months I have been trying to obtain information find “Charts” To keep your Imray-Iolaire charts up to date go to www.imray.com, AMERON ABC 3 TIN FREE SELF POLISHING ANTIFOULING PAINT AMERON

Yacht Racing Forum Conference in Monaco in December 2008. We share some in December 2008. We Forum Conference in Monaco Yacht Racing subsequent report to the CSA: excerpts of his been slowly changing as entrepreneurial the last few years this has many years. In parts of the role, particularly in those have started to play a major organizations events) pres- extreme or celebrity nature of the activity (generally sport where the sell exposure to sponsors…. for sports marketers to ents an opportunity of sports marketing”. This marketing activity is ly it was more about the “business time and it is going to contribute to the sport in many going to be around a long skew the market for exposure and will have a conse- ways, but it is also going to quence for Caribbean regattas. which this news is driven by management companies been aware of the extent to to It has become clear to me that sailing news is going and entrepreneurial interests. about celebrity events and about events that con- be more about extreme sailing, that will address a wider audience. We already knew tain an emotive component and the nature of the more competitive media market that normal sailing is boring is going to be more severely penalized than before, is such that boring material are creating events and managing stories that are because there are parties that material more radically than ever before. going to elbow out the normal able to produce extreme material. We need ding- publicity pie — unless we are dong battles between al in the headlines. image-rich product that we have, and where we that better suit the recreational, the extreme sports. have to compete less with of players in the sailing got together in one location the most outstanding line-up that has attained a high level world. They are closely related to a motor sport forum the sports-marketing side of influence. Following this model, they will inevitably follow going to be. They are likely to of sailing, which is where the best financial returns are Cowes Week, Caribbean give less attention to the large participation regattas like regattas and Block Island. This “business of the sport” development and would be well served by conferences. conference that would [of Caribbean regattas] would be well served by a separate the sports-marketing focus move this activity forward, but its nature is different from trend will, however, of the Monaco conference. The recognition of this marketing focus on high-potential make it easier for Caribbean regattas to more quickly media that better suit its “product”. and up-to-date charts the fact that the Imray-Iolaire charts are the most accurate to keep them accurate available to the yachtsman today. However, it is difficult expanded, and harbors and up-to-date as new marinas are built, existing marinas and channels dredged. in Road Town, Tortola, has accommodate mega-yachts; The Moorings expansion Island has built a marina altered the shoreline on the north side of the harbor; Scrub mega-yachts and also some supposedly big enough to accommodate a couple of out the mouth of the smaller ones and Port St Louis Marina in Grenada has dredged docks for smaller yachts. lagoon and has berths for mega-yachts, and planning me on obtaining accurate nas with absolutely no success. Any help sailors can give Contact me at information on the above marinas would be greatly appreciated. [email protected].” to all Imray-Iolaire charts then “Imray-Iolaire Caribbean” and you will find corrections also apply to BA, NOAA, to Caribbean and Atlantic islands. Those corrections would of the Caribbean. French ShelpOM, and the Nautical Publication charts Continued from page 11 …Business Briefs Continued from No matter how frantically the boat needs to depart, Horta should be more than a No matter how frantically the boat needs to depart, Horta people at Mid Atlantic Another priority while in Horta is contacting the helpful For more information see ad on page 44. The Newest Pizzeria in the Grenadines Island. Maurizio, the Ciao Pizza is the new Italian gourmet cuisine spot in Union For more information see ad on page 37. Sailing Week in Antigua will never be the same! Make plans to be in Antigua from same! Make plans to be in Antigua will never be the Sailing Week in see ad on page 8. For more information Services Mid Atlantic Yacht the volcanic Mid Atlantic Ridge, rising from reports: For centuries the Duncan Sweet mid-April to late August with the greatest mix of elegant Horta’s marina is busy from cruisers you’ll ever see. Some stay just long enough to take on fuel, some stay for a cruisers you’ll ever see. Some stay just long enough to week or two, and others are still there. hills brimming with wild- stop for stores, a tipple and repair work. The vibrant green on donkeys, spectacular flowers, countless small cow pastures tended by old men slow pace of life all beg to pastoral vistas, the small villages of stone houses and the be enjoyed. of services in the Azores for Yacht Services. They have been offering a broad range things done. The friendly staff 17 years and serve as a valuable resource for getting assist with EU-VAT payments will hold mail, parcels and parts for your arrival. They will 10,000 liters. The technical and importations or arrange bunkered fuel for more than engine and generator diffi- side of Mid Atlantic will repair electronics, rigging failures, guides/almanacs, deck culties and stocks many commonly needed parts, charts, to providing friendly equipment and supplies. The crew of Mid Atlantic is dedicated and crew. and efficient services tailored to the needs of both vessel and Grenada. He’s now famous Italian chef, has presided at restaurants in Bequia Pizza, located right in front of back in the kitchen preparing delightful dishes at Ciao the main wharf in Mulzac Square, Union Island. April 24th until May 3rd for competitive racing, non-stop after-race parties and the non-stop after-race parties May 3rd for competitive racing, April 24th until — Sweet Cry Festival Antigua. climax of it all Europe. A major- rigorous passages to seafarers a refuge during seabed, has offered fresh food, Horta, Faial, for rest, fuel, crossing to Europe call at ity of the vessels the inevitable visit to Peter’s Café Sport. Sailing from the repairs, crew changes and and Bermuda, having been at sea for 12 to 30 days, Caribbean, the US East Coast of a gale or two, found all the leaks in the deck, run out passage makers have had and need to have that “bloody autopilot fixed.” fresh bread and chocolate, Baltic traders, singlehanders, French cats and family motoryachts, ocean maxis, — The beautiful Azores islands are a traditional haven on the west-to-east transatlantic The beautiful Azores islands are a traditional haven on are there to welcome you passage. The helpful folks at Mid Atlantic Yacht Services MARCH 2009 CARIBBEAN COMPASS PAGE 30

● ● ● ● ● ● [email protected] •www.frangipanibequia.com TYRREL BAYYACHTHAULOUT

the frangipani New environmentallyfriendlyhaulout Chandlery Mini -Marina Do ityourselforlabouravailable Water 50-ton hoist,18ftbeam,8ftdraft hotel,bar&restaurant,bequia Our stock,quality,price,know-howandfishingexperienceisunsurpassed YOUR #1CHOICEINFISHINGGEAR Mustad Hooks FISHING &DIVINGGEAR Penn &Diawa Anglers Lures Rods &Reels TACKLE SHOP P.O. Box 1BQ,Bequia, St.Vincent &theGrenadines, W.I. Tel: (784)458-3255•Fax: (784)458-3824 TEL: (784)458-3420FAX:458-3797 LULLEY‘S Wire, Floats,Nets,Twines,Ropes EMAIL: [email protected] Visit usforallyourneeds DUTY FREE Foul WeatherGear Rigged &Unrigged Donʼt missourThursdayBBQ&Jumpup Spectacular views •Qualityaccommodation Fine dining•Excellentselectionofwines Fresh Bait Leaders SERVING FISHERMENAND Warm &friendlyatmosphere FRONT STREET VHF:[email protected] Tel/Fax: 473.443.8175 WEST INDIES YACHTSPEOPLE BEQUIA SINCE 1950 CARRIACOU Collectable Knives

Courtesy Flags & DivingGear Snorkeling in Norway.Shewas67yearsold.Petertellsherstory: pectedly, afterashortspellofillness,onJanuary15th,2009,inhospital as farfromtheseapossibleonthatsmallisland.Marianndiedunex- 1996. TheylivedasneighboursandgoodfriendsontopofMountPleasant, cargo. MariannandPetersplitupbothmovedashoreonBequiain vage theiryachtandspent12yearsintheregioncharteringrunning a reefandsankoffUnionIslandintheGrenadines.Theymanagedtosal- Palmborg A Tribute to Leaving toFindParadiseandaNewLife: Oslo fjord. important workthemenweredoing.Shetoldmeshehatedsailing. way”. Shewantedtonavigate,hauluptheanchorandpullropes,all galley orsenttolookafterthekidsdownbelow.Shedidn’twant“stayoutof an’s roleandpositioninsociety.Shedidnotatallenjoybeingbanishedtothe out fordaringchallenges.Shewasquiteunconventionalwhenitcametoawom- hated everyminute.Mariannwasatoughandactivewoman,alwaysonthelook- other couples,andonthefewoccasionsshehaddonesomecruising, not forher.Herhusbandatthetimeowneda45-footketchtogetherwiththree around theworld,sherespondedbytellingmethatsmallboatsandsailingwere foot pramonatiny,tranquillake.WhenItoldherofmydreamstosomedaysail were bothworkingonaboat-relatedrehabilitationprojectforkids. en ketch Peter “Fixman”Rorenin1973andtogethertheybuiltthegaff-riggedwood- years, keepingyoungpeopleoffthestreetsandawayfromdrugs.Shemet Social Studiesandchildcare.SheranayouthactivityclubinOsloformany citizen, marriedandgavebirthtotwoboys.Mariannwaseducatedin 1941. At20yearsold,shemovedtoNorwayandbecameaNorwegian find paradise—orsomesunkentreasure!” “I wanttogowithyouaroundtheworld!Let’sgetthatboatbuilt!Maybewemight single-handed. Whenproudlytakingthelinestomarinadock,sheexclaimed, voyage inopenwater,Mariannhadtonavigateandsailthe20-hourpassagehome seasick andwasconfinedtoperhapsdieinthetinyforwardcabin.Onherfirst restaurant inSkagenservedthebestpickled-herringbreakfastworld. waters. Itendedupasa160-milevoyagetoDenmarkandback,onlybecause and outtoseaonwhatwasoriginallysupposedbeashorttripinsecluded —Continued a badideaatthetime. up, althoughalittlehouseandgardenwith apicketfenceandhorsedidn’tseem blown outandabrokencrankshaft,Mariann’s captainfinallythrewinthetowel. on next page revolution. Ononeoccasion,as Caribbean bureaucracy,denguefever,financial difficultiesandaSouthAmerican get herupandgoingagain!” ing whatsoever.Itwasthensheyelledatme,“Comeon,Skip,snapoutofit;let’s shock anddisbelief,notcapableatthatmomenttomusterupanypositivethink- write homeabout.” of themastdisappearundersurfacewere,“Wow,thisissurelysomethingto down. Sheshednotearsandshowedgrief.Herfirstwordsafterseeingthetop and herhomewithallbelongingswenttothebottomofsea,17fathoms more thansheeverexpected—orperhapsreallyneeded. adventure andchallenges.Thiswasherchance.Shesoongotthem,butmuch Paradise andanewlife.CourseonceagainsetforSkagen.” become askilledshipwright,riggerandsailmaker. handled powertoolsandwoodworkasaprofessional.Withinthreeyearsshehad 17-strand Liverpoolwiresplice,Mariannboughtabookonthesubject.Shesoon When wefounditimpossibletofindatraditionalriggerwhocoulddoone-inch, In spiteofthat,shedidacceptmyinvitationtogoforashorteveningsailonthe Mariann wasacountrygirl,hernauticalexperienceslimitedtorowingseven- I firstmetmymateandex-soulmateMarianninOslo,Norway,whenwe In 1984MariannandPeterarrivedintheWestIndies,where Mariann “WhyKnot”PalmborgwasborninSwedenSeptember11th, The 50-footColinArcherketch On thewayhome,encounteringsomebigseas,Mariann’scaptaingotviolently A strongnorthernbreezesentusandthe18-footdaysailerflyingdownfjord She hadtokickhimbackintoaction.Mariann wouldnothavehercaptaingiving Misfortunes and challenges abound. Bliss was tarnished by hurricanes, tsunamis, Misfortunes andchallengesabound.Bliss wastarnishedbyhurricanes,tsunamis, After swimmingashoreIwassittingonthebeachstaringouttoseainastateof Shipwrecked intheCaribbean12monthsintohermaidenvoyage,dream Mariann wasalwaystryingtomoveboundaries,allherlifeuntilthenlongingfor Mariann’s firstentryin

Mariann MMariann

Fredag

P withtheintentionofsailingaroundword. a r i r a b i Fredag’s a l u Fredag m by PeterRoren n Fredag t logreads:“Fridaythe13th.Leavingtofind e n drifted towards Central America with all sails driftedtowardsCentralAmericawithallsails b

hasalotofrunningandstandingrigging.

t o o r

g place tobe Fredag Mariann aboard, just aparty,with charity auctionor Whether fora wasthefun Fredag hit MARCH 2009 CARIBBEAN COMPASS PAGE 31 S Penn Reels Penn Parts Penn Service and repair A

S V Wir sprechen Deutsch i h C ibb ”

E hhhhh N REPRESENTATIVE i needs N I A A stainless steel I D C ous parlons Français U snorkeling and fishing gear.

N ADINES AADINES Q E NN frames at competitive prices & The ONLY Duty Free Chandlery in Bequia SAILS & CANVAS

BBEQUIA E SS fasteners, rope, Spectra, pumps, hoses, complete diving,SS fasteners, rope, Spectra, pumps, Phone: 784 458 3360 [email protected] Electronics, marine electronics, 12 & 24 volts, inverters, lights, Electronics, marine electronics, Come in and see us Some people call us the “most interesting shop in the Caribbean.”Some people call us the “most interestingSlllh“i spring, or a ladder? Come to us andLooking for a table hinge, a hatch line with a lure just right for theWant to catch fish? Get a simple hand all: suits, tanks, belts, masks, fins andDiving or snorkeling? We have it Petite Martinique We moved to former Salty Dog - next to Porthole We moved to former Salty sockets, navigation, charts, guides, marine hardware, blocks, cleats,sockets, navigation, charts, guides, S Hablamos Español 16-18 feet of water alongside CUSTOM-MADE Wander around. You will find things you have been seeking for ages. WeWander around. You will find things well as necessary accessories and spares. offer a wide range of hardware as get the right screws with it one time. and reel to help you win the next fish- speed of your boat, or go for a rod our expertise with you becauseing tournament. We take pride in sharing we want YOU to succeed. lenses for the masks. snorkels. We even have prescription R Suitable for Large Power Yachts Unobstructed dock in calm water Cheapest prices in the Grenadines LLS & CANVAS The best fuel dock in the Grenadines for: G II GRE for all your Contact: Glenn Clement or Reynold Belmar. including AA Tel/Fax: (473) 443-9110email: [email protected] FUEL • OIL • WATER • ICE Icom VHF Garmin GPS Accessories Leatherman BIMINI & DODGER Easily approached from Carriacou, Union I., Palm I., & PSV B & C FUELS ENTERPRISE SS

Located opposite G.Y.E. (northern side of Admiralty Bay) Tel (784) 457-3507 / 457-3527 (evenings) Ch16/68 e-mail: [email protected] VHF . , Fredag the slums of

Friendship Rose Having kept a dog and a cat aboard Mariann’s love of pets expanded into a canine welfare project on Bequia , she was an inspiration Fredag Continued from previous page Continued from A yacht dips below our horizon on her journey and we A yacht dips below our horizon on her journey and we can no longer see or contact her: we are deeply saddened. At the same time the yacht appears on somebody else’s horizon, and people rejoice at her arrival on different shores. Her final words to me were, “Thanks, thanks for finding the way to Bequia, my Her final words to me were, “Thanks, thanks for finding Mariann was a true sailor, a great companion and the best and bravest first Mariann was a true sailor, a great companion and And then of course there were all the dogs that were rescued, given good homes And then of course there were all the dogs that were rescued, Closely connected to the sea as she was, she wished her friends in Bequia to Closely connected to the sea as she was, she wished Mariann had just recently received her Norwegian pension, and had big plans Mariann had just recently She gave with all her might — doing her best to give something back to a commu- She gave with all her might To the many young women who crewed on the Bequia became Mariann’s paradise. As close as you can get — good enough to close as you can get — good Mariann’s paradise. As Bequia became with the Big Smile” a The people on the island found the “Why Knot Lady There was no paradise, no sunken treasure to be found. But Mariann had found to be found. But Mariann paradise, no sunken treasure There was no captain. Now you go home to Bequia and say thanks and goodbye to all my won- captain. Now you go home to Bequia and say thanks the whole bunch out to sea derful friends who have given me so much — and take on my final passage.” mate a captain could ever wish for. Just before Christmas, we said a final goodbye mate a captain could ever wish for. Just before Christmas, soon be up. to each other in Barbados. She knew then her time would and loving care. and a significant role model. hold her memorial service aboard the venerable Bequia schooner hold her memorial service aboard the venerable Bequia for the future. Sadly, an intense short period of illness cut short those dreams. short period of illness cut short those dreams. for the future. Sadly, an intense to hardship and determination to get well, were no Her fighting spirit, immunity Up to her final hours she showed incredible brav- match for the creeping cancer. her many visitors laugh. She would spend several ery and did her best to make to her island. “I’ll be back,” she would tell her hours on the phone connected in body, but for sure in soul.” She died with her two Bequia friends. “Maybe not with a lot of people praying for “she” on Bequia. sons by her bedside — and nity that had initially shown her so much acceptance and later so much approval. nity that had initially shown move ashore. Bequia was the place to be. Here was a site where she could do her Here was a site where she Bequia was the place to be. move ashore. (Why Knot) and throw her energy into her many marlinspike-style ropework the Easter Regatta, the Christmas gløgg-party for favorite charities and projects: Day Celebrations, The Sunshine School for Scandinavian sailors, Women’s the Mozart Under the Coconut Tree concerts and her Children with Special Needs, Happy Puppies. recent animal-welfare project, and generous woman remarkable and somewhat unusual expat settler, a caring working hard to integrate into the community. Calcutta or Tierra del Fuego by Cape Horn, where she once was bound. del Fuego by Cape Horn, Calcutta or Tierra no tears, sad tedious She wanted the ceremony to be in a sort of Hindu manner: land and sea; a ceremony sermons or grief, but a final gathering of friends from its people who gave so much to give thanks for a great life, thanks to an island and meaningful. and made those 25 years on Bequia her finest and most something more important; she had built up immunity to hardship and had devel- up immunity to hardship important; she had built something more is something discovered that paradise motivation to survive. She oped a strong matter where you are — in you, so it doesn’t really you have inside — MARCH 2009 CARIBBEAN COMPASS PAGE 32

Caribbean Compass2009 Word SearchPuzzlebyPaulineDolinski

Tel: (758)4520299 Word SearchPuzzlesolutiononpage39 Lubricants &Oils Bilge Pumps Marine Hoses Electric Wire Anchors &Fenders Chain &Rope

Johnson Hardware Ltd. FOR YOUR MARINEHARDWARE, ANDMORE Fax:(758)4520311 Fishing Gear Snorkeling Equipment Flares &LifeJackets VHF Radios Stainless Fittings Stainless Fasteners e-mail:[email protected] 36) Pierheadpainter 35) 31Downprojectingfromthe1Across 34) Hawse_____areinthe1Across 33) Sailor 32) Notmagnetic,asincompasscourse 29) Therearesevenofthese 28) Thiscanbestemorsternonawoodenboat 27) Whataslooporcutterhas(2words) 25) Thefore____isinthe1Across 23) Usethistoclimboutoffo’c’sle 21) Secure 18) _____ofeight:piratecash 17) Equipment 15) Ironrodsalongwhichtravelersshift 14) Hook 12) Woodenframestofasten14Acrosscables 10) Towardthebow 9) Slanted,asvertical31downcanbe 8) Rope 7) Securethe8Acrossonthis 6) “Down__the1Across”:heavierin21Down 4) Thiscanbeport,mastheador1Across 1) Forwardpartofvessel ACROSS 31) Woodenworkingpole 30) Some1Acrosspulpitsincorporateone 26) Gunsplacedin1Across 24) Anapartmentbuilding’s“Admiral” 22) “Shiverme______!” 21) 10Across+19Down 20) Wovenropeunder35Across 19) Bitter___ 16) Thesecanbehandorgrab 13) Athwartshipmastsupports 11) Notaft 7) Metalrodefor14Across 6) ‘TwoYears______theMast’ 5) Woodentriangulardead-eyefor1Acrossstays 4) Heelover 3) “…anda____tosteerher6Across” 2) 11Downpartofship 1) Broad,bluff1Across DOWN ‘BOW’ Crossword Solutiononpage33 Houseware &Cookware Hand &PowerTools Sanding Paper&Discs Epoxy Resins Paint Brushes Antifouling Paint MARCH 2009 CARIBBEAN COMPASS PAGE 33

d s n t la e The Sea Dog IIslands o PPoets bela-toon The last sea buoy now is nearing heading The ship comes to her compass The pilot calls the pilot boat Of the soundest found afloat can be As maneuverable as a vessel the ship’s lee She lays her shoulder against leaps aboard The pilot steadies and then shore The pilot boat lunges off toward — C.A. Miles

[email protected] The pilot stands on the bridge’s wing The pilot stands on the bridge’s sing The ship’s whistle once does a well-trained eye With intimate knowledge and there lies He scans the channel for what of tons Escorting the ships of thousands continuous run Through the harbor on their Tugboats flanking either side behind Frothing the harbor channel He is the shepherd of the ships Especially when the channel rips His enemies are the current and wind And ballast if the ship is not trim He is a master of his trade For this expertise he is paid With engines dead the rate increases Until the open water he reaches PILOT

parlumps marooned

7) CHAIN 11) FORE 13) SHROUDS 16) RAILS 19) END 20) NETTING 21) FRONT 22) TIMBERS 24) DOORMAN 26) CHASERS 30) SEAT 31) SPAR (22 Jun - 23 Jul) LEO (24 Jul - 23 Aug) 27) ONE MAST 28) POST 29) SEAS 32) TRUE 33) SEAMAN 34) PIPES 35) BOWSPRIT 36) ARTIST DOWN 1) BOLD 2) HEAD 3) STAR 4) LEAN 5) HEART 6) BEFORE LIBRA (24 Sep - 23 Oct) PISCES (20 Feb - 20 Mar) ARIES (21 Mar - 20 Apr) VIRGO (24 Aug - 23 Sep) GEMINI (22 May - 21 Jun) TAURUS (21 Apr - 21 May) SCORPIO (24 Oct - 22 Nov) AQUARIUS (21 Jan - 19 Feb) CANCER CAPRICORN (22 Dec - 20 Jan) SAGITTARIUS (23 Nov - 21 Dec) MARCH 2009 Any communications problems you’ve been dealing with The creative inspiration that sailed into your sphere late Any creative frustrations hanging on from last month Chart a new business course this month and you’ll sail Your love life is still in irons, but let your sense of humor Creativity should be your spinnaker in the first half of Don’t get chained to the dock of business worries or Time to let your love life drift for a while, and concen- Keep an eye on your bearings. Productive ideas getting Although your love life might be at anchor, your creativ- Although your love life will be in irons and slowly mak- Although your love life will be The first two weeks will be a beat upwind with rough will evaporate by the third week. Take a break and concentrate on the cruising life’s little pleasures. last month will be in full force until the 20th, so take advantage of this aspect to finish up any boat projects left undone. will slip over the horizon after the 15th. Use your sense of humor to dilute any lingering negativity. through any doldrums in your love life. take the helm and you’ll soon be making hull speed. the month. Any problems with communications should clear up after the 15th. misunderstandings. Take a break to pursue new horizons for a few weeks and concentrate on the positive aspects of your life. trate on creative areas of boating life. underway in the first two weeks might shift 180 degrees into misunderstandings during the last two. ity will be inspired to get underway in the last two weeks. Bend on all the sails to make the most of this aspect. ing leeway this month, don’t fight it — things will reverse ing leeway this month, don’t fight course next month. seas and fluky winds. It will seem that all of your conver- sations end as arguments. Adjust the traveler and turn off the radio; you’ll reach port eventually. Crossword Solution ACROSS 1) BOW 4) LIGHT 6) BY 7) CLEAT 8) LINE 9) RAKED 10) FORWARD 12) BITTS 14) ANCHOR 15) HORSES 17) GEAR 18) PIECES 21) FAST 23) LADDER 25) DECK MARCH 2009 CARIBBEAN COMPASS PAGE 34

ELAINE OLLIVIERRE 2008 © Peter PelicanFliesSouth were deepinsidethebayandbusywiththeirnets,Peterhobbledoutfromrocks in fact,pelicanseatonlysmall,unwantedfish.So,afterwaitinguntilthefishermen everywhere becausefishermenthinkthatpelicansaretheirworstcompetitors.But well-aimed stonesorevenshootthemiftheypossessagun…andit’sthesame from fishermenbecauseifthenetsdon’tcatchanddrownthem,menwillhurl were twofishingboatsheapedhighwithnets.Noweverypelicanknowstokeepaway looked about.Buthopediedasquicklyitwasborn,becauserowingintotheinlet then heclosedhiseyesandwenttosleep. hideaway amongstsomelargerocksontheedgeofabayfewmilesfurtheron,and Even thefemalesjoinedinattack,shriekingcursesandinsults. expected welcome,theypeckedviolentlyathim,strikingwiththeirheavywings. of asuddenbunchaggressivelocalpelicansflewintothebay.Instead He wasdivingforhisdinnerandswallowingdozensofsmall,silveryscadswhenall surely tofast. thought aboutit,thebetterhelikedideasoincreasedhisspeedfromlei- soulmate thereandtheycouldcontinuethejourneytogether.ThemorePeter Hispaniola first.Yes,soundedveryexoticandperhapshewouldfindhis He wassouthwardboundcertainly,butheplayedwiththeideaofflyingeastto very excitedasheflewsouth.Well,hadn’tdecidedtoflydirectlysouthrightaway. conserve energy,wasmorethancapableofflyingwhereverhewantedto,so fries, stickybunsandotherfoodsgoodforneithermannorbeastbird. always rewardedbytheonlookerswhogavethemlargepiecesofhamburgers,French fish tobehadtheycaughtabillful.Butbyputtingonshow,Peter’sfriendswere with onegiantgulp.Ofcourse,pelicansdidn’tusuallyfeedthisway.Whentherewere water drainfromthegreatbag,theytosseddelicacyintoairandswallowedit cans surfacedwithafishhelddelicatelyattheendoftheirbills.Then,afterletting down intothewater.Itsurprisedanddelightedtourists,especiallywhenpeli- into theairand,foldingtheirwingstosidesofbodies,divedatdazzlingspeed threw atthem.Whenthepickingswerelean,theyflewfromtopsofpilingshigh life ofthedockneartown,wheretheysnatchedathandoutsthattourists bag ofanextendablethroatwasaribbedblackthatmatchedhiswebbedfeet. eyes ringedincrimsonandawhitearrowpointingdowntohisdarkchest.Hisgreat body andwings,alovelychestnutneck,gold-yellowcaponhishead,brightyellow kind, Peterwasaveryhandsomefellow.Hehaddarkbrown,glossyfeathersoverhis girl likehim,abrave,adventurousspiritwhowouldflytotheendsofearth. the girlswhowantedtomakehimsettledownandraiseafamily.No,Peter after day.Hewastiredofthechatterhisfriends.Andmostall,heall could thrusthimintotheair. out ofthecalmwatersbay,hiswebbedfeetpedalinguntilpowerfulwings The firstsunraysbroughtlightandnewhopePeterstretchedhiswings With aheavyheart,Peterflewofftofindshelterforthenight.Hefoundsafe Peter toucheddownforthenightinasmalldesertedinletonsoutherncoast. Peter, withhiswingspanofsevenfeetandlongnecktuckedintochestto Unlike proudPeter,someofhisfriendshadmovedoutthebaytoenjoyeasy Peter wasaBrownPelicanandhehadlivedallhislifeinJamaica.Likeof The truthofthematterwasthatPeterhadgrowntireddoingsamethingsday “I’m southwardboundandImightnevercomeback!”Petershoutedasheroseup some orderandconsistencytothe naming ofanimals.Atpresent,the assigning namestoanimals.TheCommission wasfoundedin1895tobring International CodeofZoologicalNomenclature. TheCodedescribestherulesfor Commission onZoologicalNomenclature (ICZN) time, whochooseswhichonehasthe righttonameit? animal? Ifaneworganismisfoundby twodifferentscientistsatthesame Who makestherulesthattellyouhow tonameanewlyfoundplantor know whatitis. local nameofthatorganismmightbe,scientistsallovertheworldwillalways given toidentifyallthelivingorganismsonearthsothat,nomatterwhat DOLLY’S DEEP Assigning correctnamestoanimalsisthe responsibilityofthe So, whodecideswhatthescientificnameofanyorganismshouldbe? For somemonthsnow,wehavelookedatscientificnames.Thesearenames

a n d H e SECRETS m l by ElaineOllivierre l y o !

h M o

PROUDLY SPONSOREDBYPETITST.VINCENTRESORT

n by LeeKessell

s h

e D

a y . , whichpublishesthe CRUISING KIDS’CORNER International issue of might find. were increasingtoo,asifdeterminedtokeepPeterawayfromtheonlysanctuaryhe and glancingoffhiswideback.Lightningboltsaccompaniedbycracklingreports tingled deepinsidePeter’schest. brown landandwithitcameaterriblecrackofthunderthatshudderedtheair down lowtotheseaagain.Abrilliantflashoflightningstruckclose rose intheairtolookforland.Andyes,there,wasabrownlineacrosshorizon. hours. Heflewon,butastheskybegantodarkenwithyetmoresullenclouds,Peter conserved hisenergy,becauseheknewwouldneedallstrengthinthecoming heard withanechoingrumble. bolts struckthewater.Theywereasyetfaroffonsea’shorizon,butnow cloud streaksgraduallypulledtogetherintolow,heavy,purplemassesandlightning directly intoahurricaneandhe’dbetterlandsomewherefastfindshelter. deep insidearockycave.Evenso,Peter’snaturalinstincttoldhimthathewasflying that asafledgling,hismotherandfathermovedhimnestmatestosafenook hearing asapelican. briefly, butitwastoofarawayforthesoundtoreach,evenabirdwithsuchkeen against anoverallbrassyglare.Many,manymilesaway,astreakoflightningglinted sively hotandstill,whenhelookedup,sawstreaksofdullgreyclouds so PuertoRicoitwouldbe,beforecontinuingsouth. haul rightacrosstheCaribbeanSeatoSouthAmerica?No,Venezuelawastoofar, fully, outofrange. Ugh, Petershiveredatthethought.Butbeforemancouldreload,hewas,thank- him andhewoulddieaslowlonelydeathbecomecarrionforthevultures. entered hisbody,whichwasfortunate,becauseleadpelletswouldfesterandpoison all aroundPeterandsomeofthemnickedhistailshoulderfeathers.Butnone along thewater’sedgewithashotgun.Hestopped,tookaimandfired.Pelletsflew much speedashecouldtogetoutofrangeandbacksea,amancametramping using himastargetpractice.Worsewasyettocome,becausePeterputon was abunchofboys,eachonearmedwithanairgunorslingshot,andallwere followed byasharpCRACK! the endofalongandpeacefulbay,thanhefeltsizzlemetalwhizpasthisear, look forhissoulmate.Henosoonerturnedintowardsafriendly-lookingvillageat villages andgreenvalleysrunningdowntothesapphiresea. waves sohewouldn’tbeseen.ThispartofHispaniolaseemedprosperous,withfine Republic wasanybetter,sohecontinuedonhisflighteast,keepinglowoverthe ancient birdsintheentireworld. care becausehisbellywasfullandheknewthatpelicansareamongstthemost net andthewaterhastodrainawaybeforehecanswallowhisfish.ButPeterdidn’t belly can”.Theydidn’tknowthathisbillholdsmorebecauseisjustabigfish once airborneheflewouttoseacatchhisbreakfast. and ploppedclumsilyintothewater.Hepaddledfuriouslyinanefforttotakeoff ters of never seenbefore! in 1975.Sonowyou’llknowwheretolookifyouthinkyou’vefoundsomething have theirowncode:theInternationalCodeofNomenclatureBacteria,begun the InternationalCodeofNomenclatureforCultivatedPlants.Evenbacteria are regulatedusingtheInternationalCodeofBotanicalNomenclatureaswell plants? particularly endangeredandtakemeasurestohelppreserveourenvironment. activity, soitisvitalthatscientistscanaccuratelyidentifywhichspeciesare under threatfromtheeffectsofglobalwarming,climatechangeandhuman allow newspeciestobeaddedastheyarediscovered. lished his anniversary oftheofficialstartscientificnaming,whenCarlLinnaeuspub- Zoobank’s officiallaunchingwasonJanuary1st,2008.Thisthe250th liminary registerof1.6millionnameswasmadeavailableinAugust2006but to publishthisontheWorld-WideWeb.ThisprojectiscalledZoobank.Apre- taken tomakearegisterofallthenamesspeciesalreadyknownand should be. the namesbeforeICZNmakesafinaldecisiononwhatnewname year andeachoneispublicizedinthe Zoological Nomenclature and fromthesaleofitspublications,inparticular,quarterly the NaturalHistoryMuseuminLondon. Commission has28membersfrom20countriesanditsSecretariatishousedat Find outifPetersurvivestocontinuehisquestfortheperfectmateinnextmonth’s Would hemakeit? The raindropswereclosertogetherandfasterPeterfeltthempeltinghishead The firstbigraindropsbegantofall,widelyspaced,butheavy,soPeterdipped Peter wasflyinglowovertheseatopickupliftfromaircurrentsandthis The channelwasawidegapbetweentheselargeislandsandasPeterflewon,the It hadbeenalongtimesincehurricanehitJamaica,butPeterremembered As Peterfleweastward,hefeltachangeintheweather.Theairhadgrownoppres- What todonow,Peterwondered.ShouldheflyonPuertoRicoortakethelong Peter knewinstantlyhewasbeingfiredat,andsureenough,thereonthebeach So Peterroseupintotheairtoseewherehecouldmakeasuccessfullandingand Never oneforgivingup,PeterwasdeterminedtoseeifthecoastofDominican Peter hadoftenheardcheekychildrenlaughingthat“hisbillholdsmorethanhis Answer onpage39. How manywordsoffourlettersbeginning withM,canyoumakefromthelet- WORD PUZZLE So far,we’vetalkedaboutzoologicalclassificationofanimals. Why isscientificnamingsoimportant? With thedevelopmentofcomputersandInternet,ICZNhasunder- The ICZNisanon-profitorganizationthatobtainsitsfundsfromdonations NOMENCLATURE CaribbeanCompass. Plant nomenclaturebeganofficiallyonMay1 Systema Natura . Thousandsofnewanimalsarediscoveredevery ? in1758.Zoobank’swebsite(www.zoobank.org)will Bulletin Thebiodiversityofourplanetis sothatzoologistscandiscuss st , 1753andthenames What about Bulletin of MARCH 2009 CARIBBEAN COMPASS PAGE 35 — our Scud , my husband, Peter, and Scud by Tina Dreffin THIS CRUISING LIFE THIS CRUISING

Next time I decide to wallow in shallows with soapy spikes, I’ll don a facemask to In addition, stingrays are fascinating creatures. On This is NOT recommended behavior. Petting or feeding rays encourages human The ray nuzzled my palm, caressing my fingers with soft, velvety lips — like those Ever so slowly I placed my open palm beneath the head of the ray, offering it as a “Don’t move! Mind the tail!” shouted the conchman, and then tossed me more Clutching the guts by the foot, I shoved them underwater at the eager stingray. It Clutching the guts by the foot, I shoved them underwater Hungry, the stingray cruised the beach for leftover conch bits; I gazed in wonder. Hungry, the stingray cruised the beach for leftover conch

The curvy beach on Anguilla seemed like the perfect spot for a luxurious saltwater seemed like the perfect spot for a luxurious saltwater The curvy beach on Anguilla the islander behind me on the beach. (I thought, “Mind your feet, lady!” shouted Dancing with a Stingray with Dancing ‘I felt something soft and slimy glide between my legs… a stingray!’ ‘I felt something soft and slimy glide between my legs… maintain a sharp lookout for lovely sea creatures of the deep — just in case adventure comes drifting my way when I least expect it. I see them often. In quiet anchorages, we hear them as they catapult from water into mid-air, landing with a thunderous thump. We dash on deck to watch the show, feeling lucky with their repeated performance. When snorkeling, we see them feeding on mollusks and crustaceans in shallows: we know they are near when broken conch shell shards litter the ocean floor or when a cloud of whirling sands emerge before us, making navigation through swirling sands difficult. We give them a wide berth, not wanting to disturb them, and then turn to admire their fluttering ballet as they glide through still waters. Swimming alongside a pair of leopard rays is a mystical experience. Once, as a young girl, while snorkeling for the first time, I was astonished to gaze below me and discover a multitude of eyes blinking back at me from the ocean floor: a school of rays at rest, blanketed in sand for protection against predators. approach. The long, whip-like tail of a stingray can inflict severe wounds — stingrays are, in fact, the most common cause of severe fish stings. The barbed spines at the base of the tail contain poisonous glands, utilized as a defense mechanism against predators. of a sweet-natured mare. A pleasant tingling sensation arose, and rushed up my forearm. I simply smiled. After poking around for more, the ray swirled around to retreat, whipping a bulbous tail across my trembling feet. I froze, not wanting to startle it with any sudden movement. token for my life. Nice kitty; please go home to mommy, I cooed in pleading tones. My Buddhist nature screamed trouble: I don’t believe in harassing or taming sealife. This is nuts! conch guts. “Hold it under the snout!” The red tourists, oohed and ahhed, snapping digital photos in rapid succession. slithered slowly towards me, and then stopped at my entangled legs to feed on my slithered slowly towards me, and then stopped at my a ventral mouth, the head proffered entrée-of-the-day. As they were vacuumed from from beneath giant wing-like bobbed up and down, and swirling sands billowed out ray partially slithered onto my pectoral fins. Then something weird happened — the lap, looking for more. What do I do! What do I do? Newspaper titles blasted in my numb brain of: “Yachtswoman Dies in Shallows from Sea Creature” or “Sea Monster Zaps Woman”. Satiated, but wanting more, the stingray torpedoed into a rhumb line for the conch Satiated, but wanting more, the stingray torpedoed into I quickly gathered my wits and pile behind me. “Watch out!” the conchman shouted. conch shells. Extricating my tried to stand, but my bikini bottom had snagged in the have. “Catch!” the conchman suit would’ve taken only a second, but seconds I didn’t roll of the shoulder, pitching shouted again, then launched himself into an Olympian misty slime spinning off like conch entrails at me. Gooey guts flew through the air, do next. “Feed it to him,” he raindrops. I caught the wet mass, not sure of what to hissed. SAY WHAT? bath. An islander stood at one end, doing something unusual with large shells. I one end, doing something unusual with large shells. bath. An islander stood at end for my reverie. My rain dance on sauntered towards the opposite him so fast?”) Shoving aside a bubbly spike of bangs, “How did I drift down towards to see him yanking out the fleshy snail from a queen I squinted with one open eye I sunburned tourists, who had clustered around. conch for a gaggle of lobster-red, felt cry came from one of the women. Suddenly, I became alarmed when a stifled eye, between my legs. Clawing at the soap in my other something soft and slimy glide when I peered down to see a large grey shape undulate I got the shock of my life I lost my balance, and tum- between my feet: a large stingray! What the heck? Then from the conchman. Ouch! bled backwards into a pile of holed conch shells, litter 44-foot catamaran — missed the universal signal somehow, so with shampoo and the universal signal somehow, so with shampoo 44-foot catamaran — missed the plunge. Myriad fuzzy colors enveloped my mask-less liquid Quell in hand, I took myself go for a long period, relaxing in the prettiest vision underwater, and I let with the business at hand, I finned into the shallows waters on earth. Getting on wide for balance against the slight surf, proceeded and, standing with legs splayed an “in the groove” now, I twisted mid-length curls into to shampoo my hair. Feeling them into tall spikes, and then gnarly dreadlocks, while impressive lather, shaping barreling out “Zippity-doo-dah”. MARCH 2009 CARIBBEAN COMPASS PAGE 36 you candoforyourself.Enjoy. richer forpeoplegoingtoseaandtellingtheirtruths. many toemulatehimandwriteunaffectedlyaboutwhat become seagypsies,and,asthesayinggoes,“livedream”,buthasalsoinspired serious partofourjob.(We’relazy;wedon’twanttowriteeverythingourselves!) hat isofftoyou,Sally!”Well,shucks,Fatty,weseeencouragingmarinewritersasa Erdle… whohasdonemoretoencouragemarinewritersthananypersonalive.My write anoteaboutwritingwithoutmentioning[ site’s “Influences”page:“Itwouldberemissofmeasalong-termCaribbeanwriterto ary contractualobligationselsewhere(ahem),hedidgenerouslywriteonhisweb- author wannabes,hewritessoengaginglyandwellthatactuallymakesa(modest) feels asacruiser,fromthesublimetoridiculous.And,unlikemostcruising ference. Thedifferenceisthathewritesaboutnearlyeverythingdoes,seesand sort ofmarried-guy,modest-boat,Boomer-vintage,cruisingEveryman—withadif- turer oranoff-the-milkrunvoyagingpioneer(althoughstuffhappens),butmorea writer intheEnglishlanguagetoday.He’snotnecessarilyaboldhigh-seasadven- Goodlander. Self-published.Paperback,220pages,B&Wphotos.ISBN1440447241. BOOK REVIEWBYSALLYERDLE the reader. less whole—frompeople,placesandeventstoinnerthoughtsasafriendlygift the headandheartofcruisinglifetogetherinhisstories,presentsseam- more thanovercomesthesmatteringoftechnicalflaws.Fattyisabletobringboth in littleglitchessuchastyposandpunctuationmistakes,butnomatter,thecontent ous “borrowed”WiFilinks.Sometimesthe“homemade”natureofprojectshows [email protected] www.barefootyachts This bookisavailableatwww.fattygoodlander.comandAmazon.com. Thanking Fattyforhisinfluencebybuyingthisbookisalsosomethingverynice We returnthefavorbynotingthatFattyhasnotonlyinspiredcountlesspeopleto Gary Goodlander,theself-styled“Cap’nFatty”,isperhapsbest-knowncruising Even thoughTheFatOnedoesn’twritefor Cap’n Fatty’sCruisingWorldYarns Since 1984 BAREBOATCHARTERS-FULLY CREWEDCHARTERS-ASASAILINGSCHOOL GET

Tel.1-784-456-9526 /93349144Fax.1-784-456-9238 POBox39, BlueLagoon,StVincent,WestIndies eil etl •Soes •AirTravel •HotelReservations •Moorings •Boutique •BookExchange •SurftechSurf Shop •Diesel&Propane •Restaurant &Bar •Wi-Fi/InternetCafé •Showers •Laundry • On-siteAccommodation • QuiksilverSurfWear •RefrigerationWork • IslandTours •FibreglassRepairs • Ice&Water •RaymarineElectronics • VehicleRentals • Mechanical&ElectricalRepairs • DoyleSailLoft&CanvasShop , byCap’nFattyGoodlander,©2008GaryM. Barefoot Yacht Centre &Marine Charters Caribbean Compass FAT Caribbean Compass they sure) at (no punintended,I’m being Editor-at-Large living doingit. uploaded usingvari- at anchor,andthen done eitheratseaor ics andlayoutwere All thewriting,graph- ond circumnavigation. Card 38-foot sloop, created aboardtheir — whynot?” a book.Sowefigured more thanenoughfor tled toseewehad best —andwerestar- out andculledthe and Iprintedthem years. MywifeCarolyn accumulated overthe great storiesIhad realized howmany Fatty, “andsuddenly decade now,”says magazine almosta been writingforthe muse, Carolyn.“I’ve laptop —oftenhis to putfingertips ever elseinspireshim navigations andwhat- about histwocircum- magazine, writing One ofFatty’sgigsis The entirebookwas owingtoexclusion- live.Theworldis , duringtheirsec- Cruising World editor]Sally Wild

“You’ve gottohavethisbook(anditssisterpublication pensable ascharts,wordwentaroundtheCaribbeancruisingcommunity: book willbeyour checks inarestaurant,fromhiringrepairmentotranslatingweatherreport,this wrap-around covermakeitdurableandconvenienttouse. cartoons arehelpful.Thebook’scompactsize,spiralbindingandwater-resistant you cruise. Latin America,soyoucanlearnthewordsthatareactuallyusedincountries racy bySpanish-speakingboaters,mechanicsandmarineworkersfromSpainto rectly andbeunderstood.Thevocabularyhasbeenextensivelyreviewedforaccu- do youknowhowtosaywingnutorfuelshut-offvalveinSpanish? a boontothosewhoarefluentinSpanishbutlacktechnicalboatingvocabulary— at readerswhodon’tknowanySpanish.However, speaking countries(exceptsomeofthereallynaughtywords).Thebookistargeted guide. ItcoversallthelanguageandvocabularynecessarytocruiseinSpanish- yachtsman’s Spanish-Englishphrasebook,nauticaldictionaryandconversation ed edition. sioning, internetuseandbanking)toKathy,whichshehasincludedinthisexpand- Cruisers usingthefirsteditionthensuggestedtenusefulnewtopics(suchasprovi- you getthatfor32bucks?) promises: Spanishforcruisers.Itwillmakeyousmarterandhappier.(Howoftendo your nativelanguage,don’tsetsailwithoutthisbook.Itdeliversexactlywhatit Mujeres, Cuba,theDominicanRepublic,PuertoRicoorMiami?UnlessSpanishis 0-9675905-2-3. US$31.95. Company. Softcover,ringbound,368pages,B&Wphotosandillustrations.ISBN978- Speaking Destinations www.spanishforcruisers.com. throughout theCaribbean,andatWestMarineinPuertoRico.Alsoavailablethrough From holdingradioconversationsaboutemergenciesatseatoaskingforseparate Over 300diagrams,photosandillustrationssupportthetext.Evencutelittle Every wordandphraseisaccompaniedbyitspronunciation,soyoucansayitcor- Kathy, acruiserherself,hascompiledcomprehensive,practicalandunique Kathy Parsons’firsteditionof Are youheadedbyboattoVenezuela,Colombia,Panama,theRioDulce,Isla Spanish forCruisers:TheBoater’sCompleteLanguageGuideSpanish- This bookisavailableatBudgetMarineandIslandWaterWorldchandleries Speak Spanish— Like aCruiser! amigo bueno , secondedition,byKathyParsons.AventurasPublishing whencruisinginSpanish-speakingcountries. Spanish forCruisers Spanish forCruisers immediatelybecameasindis- French forCruisers .com willalsobe )!” MARCH 2009 CARIBBEAN COMPASS PAGE 37

2 ! 5 A !

T ! 5

N Z 3

A N 7 R Z E 2 U I P 5

A ) O T P

4 S 8

E W 7 R ( Closed Tuesday

PIZZA take away! - : O Maurizio MEDAGLIA l

NNOW OPEN !!! e A I TTel: (784) 527 35 52 A %%' % ') *'%% %'* + $* *'%') % R I E specialities, pasta and fresh ﬁ specialities, pasta and fresh Z Mulzac Square • Union Island Mulzac Square • Union CIAO PIZZA CCIAO Z You can also enjoy his other delightful You can also enjoy his other Come and enjoy the best Italian pizza, Come and enjoy the best I Open from 11am to 2 pm – 5pm to 10pm Open from 11am to 2 pm ! " #$%& ' (%% made with love by the famous Italian chef, made with love by the famous ' )% " & % ' PPIZZERIA - RESTAURANT Located in front of the main wharf of Clifton Located in front of the main to be an Manchineel , by John Ballem, is a “Castle Street There are spells, apparitions, curses, and an attempt- apparitions, curses, and There are spells, and the estate over- There is tension between Robert a book written nearly a These and other charms of Manchineel The mystery that is solved by its wealthy pilot/hero, Of course anyone connected with modern Mustique It’s all a bit corny but it appears that Ballem spent The book’s one cheap shot is an all-too-simplistic Beyond a few quibbles I found enjoyable read, if for no reason other than the fun it pokes at the affectations of the very, very wealthy, while it serves up a dark dish of murder and kidnap- ping, set in the Grenadines with a voodoo backbeat. sumed with rage and jealousy, but Millicent’s grandfa- and jealousy, but Millicent’s sumed with rage fun begins. voodoo priest, and the ther is a powerful for its knowl- but this book shines not ed exorcism, details arts, but for its everyday edge of the darker of slavery. The descrip- about life during the last days sun, rain, and moon, are tions of the country, the are many of the customs rendered in minute detail, as white Jamaicans in the and habits of both black and early 19th century. is lower in status, seer at the start, as the bookkeeper the tables are turned. but once Robert beds Annie of his class and a Robert Rutherford is a creature the “N” word, a realistic decent man, but he still uses departure from “political correctness”. A few of the descriptions century ago await the reader. of the attraction in my run long, but they are all part in the era of Somerset view, for this was written Maugham written about Maugham. In fact, had come up with a better Jamaica, he could not have female was one of his book. The evil plotting colonial he wrote to de Lisser, “I favorite characters, and are full of life and charac- enjoyed your books; they ter… They are also, a trait not too common in modern fiction, extremely readable.” Mystery” or genre book. It was made known to me by a friend in Norway, of all places, and is still available on Amazon.com. Its author has written at least ten novels, and though extremely competently written, one gets the impression that he cranked this one out with a wicked sense of humour. Skye McLeod, to me was secondary to the delicious and sardonic satire of its setting. Manchineel Island is obviously modeled on our own exclusive playground of the rich and famous in the Grenadines, Mustique. Old island hands can immediately recognize some real-life characters who shaped that island’s development. There is Princess Helen, a selfish lush with eyes for young men, and Lord Fraser, the eccentric head of the Manchineel Company, with his pet cheetah and chim- panzee. The portraits are none too flattering, but they help shake off the counter-myths that the island has carefully cultivated since the departure of the two indi- viduals on whom these characters are modeled. would find the idea of voodoo ceremonies performed on their island ridiculous. But voodoo is only the back- ground for the dark crimes uncovered in the plot by “Skye pilot”, who, for fun, beds a divorced wife from a powerful political family very much like the Kennedys. more than one holiday on Mustique and had a pretty good knowledge of its residents’ foibles. His observa- tions about locals are in turn humorous (his house servant is named “Overfine”), sympathetic, and cyni- cally witty. characterization of the island’s playboy/bar owner, Nick, who, to tell the truth, could have been fleshed out in a far more interesting manner had the author cared to go beyond stereotype.

. Mr. de The White ema , by Herbert G. de Caribbean Compass the The Gleaner of eve BOOK REVIEW BY BOB BERLINGHOF BOOK REVIEW the on (first reviewed in , by John Ballem, Dundurn Press, pub- , by John Ballem, Dundurn 1831 is

date

The White Witch of Rosehall The better story, to my surprise, was The better story, to my surprise, The drumbeats of obeah, also known as voodoo, are The drumbeats of obeah, also Manchineel Over the course of the book Robert discovers the Complicating the picture is a beautiful and spirited The date is 1831, on the eve of the emancipation of

Witch of Rosehall Voodoo Beat Voodoo Dig That That Dig these island tales. the common thread of both ago by the editor of the in May 2000), written 80 years well-known Jamaican newspaper, lished 2000. 318 pages. ISBN- 0-88882-217-0 lished 2000. 318 pages. ISBN- Lisser, Macmillan Education. First published in 1929. Lisser, Macmillan Education. 261 pages. ISBN 13: 978-1-4050-8592-2 true nature of Annie, seeing a cruel and sadistic side he never imagined when he swore his love for her. His sympathies switch over to Millicent. Annie is con- mulatto, Millicent, who falls for Robert and becomes mulatto, Millicent, who falls for Robert and becomes his “housekeeper” or mistress. Robert starts drinking rum and within a week he has changed considerably. all colonial British slaves, and there is unrest in the all colonial British slaves, and there is unrest in the air. Into this cauldron tumbles young Robert Rutherford, age 26. He immediately falls for his come- ly boss, Annie Palmer, the widowed owner of Rosehall Estate. Her last three husbands have died at Rosehall, an impressive number for a 31-year-old, but Robert nonetheless is bewitched by her beauty, sensuality, and frankness. She doesn’t give a fig about what others think, and takes Robert to her bed on his second night of employment. Lisser weaves a tale of a young gentleman just off the Lisser weaves a tale of a young agreed to accept the lowly boat from England who has Jamaican estate so that he position of bookkeeper at a from the ground up. It is can learn the sugar business his intention to one day take over an estate in Barbados belonging to his father, an estate that nei- ther of them has ever visited. MARCH 2009 CARIBBEAN COMPASS PAGE 38 some ofthebeston you willenjoycocktailsmostdelightful,thestaffwelcomingandmeals, cobblestone buildingwhereyoumayfindBasil’sRestaurant andBar. Airconditioned, BASIL’S BAR: Visitors toStVincent areinvitedto: 10, 2010. Breakfast service beginsat8:00 10, 2010.Breakfastservice Basil’s BarishomeandoriginatoroftheMustiqueBluesFestival, January27-February fasts. NowequippedwithWIFIyoucanenjoysunsetcocktailsandcatchupontheweb. offering thefreshestseafood,steaksandpastasfordinner. Terrific lunchesandbreak- tion. Recently renovated,thenewfaceofBasil’sBarinMustiqueisallthatandmore World’s Ten BestBarsin1987byNewsweekmagazineandtodaylivesuptothattradi- BASIL’S BARANDRESTAURANT: Visitors toMustiqueareinvitedto: Shipping iseasilyand a magnificentcollectionoffurnitureandhomeaccessoriesfromAsia. India -contemporarypiecesandfabulouslighting.AcrossForever has ACROSS FOREVER: sauces andgourmetjams.Importedcigars.F Great GeneralStore-stocked withfineFrench wines,cheesesfromEurope, BASIL’S GREAT GENERAL STORE: of T-shirts totake home.Basil’sBoutiquealsoofferssilverandgemstonejewelry. joy. Elegantislandeveningand playful daywear. For women,menandchildren,pluslots BASIL’S BOUTIQUE Wednesday nightJumpupandBBQ.Call784-488-8350orVHF68. Dinner at7:30untillate.CometoBasil’sforCocktailsanytimeandplanattendthe

Mustique Visit Basil’sinMustiqueorSt.Vincent www.basilsbar.com [email protected]

InStVincent -neartheportofKingstownisan18thcentury WE SHIPAROUNDTHEWORLD! the island. Basil’s Bar efficiently arranged. Fabrics asbrighttheseaandlightair... perfectforisland Imagine,decoratingyourhomewithAntiquesfromBaliand Call 784-457-2713 Basil’s Bar in Mustique was named one of the Basil’s BarinMustiquewasnamedoneofthe AM Call 784-488-8407 There is nothing general about Basil’s There isnothinggeneralaboutBasil’s ine foodsinP , Lunch is served 11:00 , Lunchisserved aradise. Call 784-488-8407 AM -6 PM , of avocadois of theavocadoisaboutaquarteroil. vide vitaminA,thiamine,andriboflavin.Secondtotheoliveinoilcontent,fruit 236 calories,butisalsorichinvitaminsK,B-6,C,andcopper.Avocadospro- blood pressure,andfolatetolowertheriskofheartattacks.Onecupavocadohas for theheart.Itcontainsoleicacid,whichhelpslowercholesterol,potassiumto perate andtropicalclimates. century bygraftingbranches.Nowavocadosaregrownthroughouttheworldintem- word derived fromtheSpanish with long,egg-shapedleavesandgreenish‘petal-less’flowers.Thewordavocadois South Americafortenthousandyears.TheSpanishexplorersrediscoveredthetree test byshakingtoseeiftheseedisloose—thiscanbruiseinsideoffruit. Test forripenessbyverygentlysqueezingthefruit—itshouldgiveslightly.Don’t grow todoublethatsize.Theyellowish-greenfleshgrowsaroundasinglelargeseed. green, purple,orblackskin.Avocadosusuallyweighonetotwopounds,butcan Caribbean marketshaveavocados—oftencalledpearseitherroundoroval,with wich withsaltandabitoffreshlygratedblackpepperispersonalfavoritemine. plant potwithsoftsoilandkeepitmoist. sprouts roots.Transplanttheseedwhen therootsareabouttwoincheslongtoa toothpicks soonlythebottomhalfof seedissubmerged.Watchasthe purple avocadosaremyfavorite.Inaglass orcupofwater,suspendtheseedby couple istosproutyourowntreefrom aseed.Selectseedfromspecifictree; of 20feet,sotheyneedamplespace.Anice projectforayoungpersonornewlywed in bakingdishandbakefor15minutesuntillightlybrowned. heat gently,thenaddremainingingredients.Mixthoroughlyandfillavocados.Place ingredients andtopwithremainingdicedavocado.Serves6. dente nuts, andhalfoftheavocado.Tosssopiecesavocadoareevenlycoated. soup andserve.Servesfour. tic wraptopreventdarkening.Chillandserveasadiporspread. per sauce—itshouldhavesome“zing”.Placeinabowlandcovercloselywithplas- in theavocados.Mixwellwithremainingingredients.Don’tbeshyhotpep- used asaspreadordip. Avocados areusedinsalads,sandwiches,andsoups.Themostcommonuse Avocado isaverynutritionaltreefruit.Althoughhighincalories,avocadogood The treeisamemberofthelaurelfamily,andhasbeengrowinginCentral A firm,ripesliceofavocado—aloneorwithfriedegg,fish,chickeninasand- Avocado treesareusuallyboughtatnurseries. Theygrowto60feetwithaspread For theGardener Preheat ovento450°F.Pourthesherryinasaucepan,addpoultryorseafoodand salt andpeppertotaste 1 teaspoonmincedonion 1/2 Cupmayonnaise 1 Tablespoongratedlemonrind 1 Tablespoonlemonjuice 1 pimento,chopped 1 1/2Cupstoastedalmondslivers 1 1/2Cupsdicedcelery 2 Cupsdicedcookedturkey,chicken,shrimporfish 1/4 Cupsherry 3 firmripeavocados,cutinhalfandseeded Baked StuffedAvocados Cook thefettuccineforthreeminutesoraccordingtopackagedirections In alargebowlcombineoliveoil,vinegar,basil,chives,sun-driedtomatoes,wal- hot peppersauceandsalttotaste 1/4 Cupdicedsweetpepper 1 pounddriedfettuccinenoodles 1 wholeavocado,peeled,seededanddiced 2 Tablespoonswalnuts,chopped 1/2 Cupsun-driedtomatoes,chopped 2 Tablespoonschoppedchives, 1/2 Cupfreshbasil,chopped 1/4 Cupwinevinegar 2 Tablespoonsoliveoil Fettuccine withWalnutsandAvocados Mix allingredientsexcepttheoystersinablender.Addtomix,chill 2 dozennice-sized,well-cleanedfreshoysters salt andpeppertotaste 1/2 teaspoonWorcestershire(“English”)sauce 2 Cupschickenbroth 1/2 bunchchadonbene(islandcilantro) juice fromonelemonandlime 2 ripeavocados,peeledandseeded Chilled AvocadoOysterSoup Blend tofuwithafork,orinfoodprocessorblender,untilsmooth.Thenmash hot peppersauceandsalttotaste 1 TablespoonWorcestershire(“English”)sauce 1 Tablespoonlemonjuice 1 cloveofgarlic,finelychopped 1/2 mediumonion,finelychopped 1/2 Cuptofu 2 ripeavocados,peeledandseeded Hot ScorpionGuacamole THE AVOCADO! . Drainandcombinewithoil-and-vinegarmixturewhilepastaishot.Tossall ahuacatl I ADVOCATE SERVING ATSEABYSHIRLEYHALL guacamole . Avocadoshavebeencultivatedsincethebeginningoftwentieth , wherethesoftfruitisblendedwithvariousseasoningsand aguacate, andoriginallyitcamefromtheMexicanAztec al MARCH 2009 CARIBBEAN COMPASS PAGE 39 The Carenage: Monday - Thursday 8 am to 5:30 pm Friday until 8:45 pm Saturday until 1:00 pm Tel: (473) 440-2588 Grand Anse: Monday - Thursday 9 am to 5:30 pm Friday & Saturday until 7:00 pm Tel: (473) 444-4573 BEQUIA Tel: (784) 458 3041 Sunday from 6pm Tel: (784) 457 3443 Great Harbour View Snacks, Fajita & more Dining Inside & Outside Flying Fish, Philly Steak, e-mail: [email protected] Great Sandwich Menu, Burgers now located @ former Timberhouse Dinner Menu: Steaks and Seafood Live Music on Weekends Full Cable TV • Sportsbar Bequia, Port Elizabeth, Admiralty Bay New Location at Gingerbread Café New Location at Gingerbread Hubbard’s JONAS BROWNE & HUBBARD (G’da.) Ltd. Stock Up on the widest selection and the best prices in Grenada at our two conveniently located supermarkets. Whether it’s canned goods, dairy products, meat, fresh vegetables or fruits, toiletries, household goods, or a fine selection of liquor and wine, The Food Fair has it all and a lot more. Restaurant Bequia & Bar, THE SALTY DOG Open Monday - Saturday from 10am and meal mean meat meet mere moan moat mole more mote mule mute i i l Here are 20 words. mace male malt mane mare marl mart mate If you find more, make sure you check the correct spelling in the dictionary!! DOLLY’S ANSWERS Instant oats cannot be used as you would rolled oats be used as you would Instant oats cannot both sweet and savory, There is a plethora of recipes, oatmeal other than Here are some ways to enjoy Sandwiches Toasted Oatmeal and Honey 2 Tablespoons (30 ml) oatmeal 4 slices brown bread 2 Tablespoons (30 ml) butter 3 Tablespoons (45 ml) honey On a baking sheet, Preheat oven to 350°F (177°C). Pineapple Mango Fruit Crisp Use almost any combination of fruit for this delicious 1 Cup (250 ml) flour 1 Cup (250 ml) rolled oats 1 Cup (250 ml) brown sugar 1/2 Cup (125 ml) butter 1 teaspoon (5 ml) ground cinnamon 1/2 teaspoon (2 ml) grated nutmeg 3 Cups (750 ml) chopped pineapple 1 Cup (250 ml) chopped mango 2 Tablespoons (30 ml) butter for top Mix together flour, oats and half the brown sugar in Combine cinnamon, nutmeg and the remaining In a large buttered glass baking pan, spread a quar- Serve it hot or cold, alone or with ice cream. Serves ers the transformation is to rolled oats. These are These are is to rolled oats. ers the transformation and rolled again into quick-cooking further processed rolled oats. has been oats. The instant variety or quick-cooking can become the softer product often precooked and or cakes. when used in muffins lumpy or mushy resemble the coarse unrolled oats that Scotch oats are are great or cracked wheat. These texture of couscous cooking than cereal but require longer in a breakfast (finely ground groats) in oatmeal. When using oat flour is needed to help baked goods, additional leavening the product rise. Oatmeal in meat loaf, oat- that use oats or oatmeal. and oatmeal cookies meal and brown rice with spices, grain. galore incorporate this versatile is fantastic in itself. traditional porridge, which in oven about 10 minutes spread oatmeal and bake with butter and honey. until pale brown. Spread bread over honey. Top with Sprinkle cooled, toasted oatmeal toasted in advance, this is buttered bread. If oats are a quick delicious breakfast underway. and fruit crisp. a large bowl. Cut the half-cup of butter into mixture using a knife or pastry blender. brown sugar in a separate bowl and mix with fruit. Mix a quarter of the crumb mixture with the fruit mixture. ter of the crumb mixture and pat into a base. Add fruit mixture on top and spread evenly. Cover with remaining crumb mixture and pat down lightly. Dot with butter and bake for about 30 minutes at 350°F (177°C). six to eight.

Dictionary of the English Language

Oatmeal or porridge was not a popular English dish. Oatmeal or porridge was not a popular English dish. Once oats have been cleaned, toasted, hulled and I have never been to Scotland but I’m determined to I have never been to Scotland but I’m determined to She passed away quietly in her 98th year, after say- “I prefer them even to oatmeal,” Mum said recently. It was grocery day for my Mum. At 96 she continued Samuel Johnson’s cleaned once again, they become oat groats. These can be cooked and served as a cereal or used as you would rice. When steamed and flatted by heavy roll- go. Mum was born in Aberdeen and traveled with her go. Mum was born in Aberdeen and traveled with her mother and sisters to Canada in 1910. Although Mum didn’t remember much of the journey, she did recall having breakfast in Montreal before boarding a train heading for the west coast. My father would often say that my mother and her siblings were encouraged off the ship only by sprinkling oatmeal down the gangplank. He affectionately referred to her as an oatmeal savage. in 1755 defined oats as a grain that in England was generally given to horses and in Scotland supports the people. It can be easily understood why the Scots are such a hardy breed as oats are by far the most nutritious of the cereal grains. Kept in a watertight bin, oatmeal is the ideal grain to have on board. Keep it tightly sealed. ing she no longer wanted to eat. At Mum’s funeral we ing she no longer wanted to eat. At Mum’s funeral we had a kilted piper play the hymn Amazing Grace. My mother truly was amazing. Now this was a shock. My mum, of Scottish heritage, Now this was a shock. My mum, of Scottish heritage, saying she preferred a commercial cereal to oatmeal! Shame. Her dogged determination to live forever was a fine example of Celtic mind over matter. SAVAGES to live on her own and go through several hundreds of dollars of groceries monthly. Mum’s eyesight was not good so she relied on me to take her shopping, usually about once every three weeks. She would hold onto the grocery cart while I slowly pushed it down the aisles, calling out the products located there. She never failed to amaze me by trying most of the “new foods” that come on the market. I’ve never eaten multi- grain Cheerios but Mum knew them well. JOIN THE JOIN THE OATMEAL by Ross Mavis MARCH 2009 CARIBBEAN COMPASS PAGE 40 YAMAHA GRENADA W.I. TRUE BLUE,ST.GEORGE’S, McIntyre Bros.Ltd. TOURS &CRUISES-CARJEEPRENTAL hammocks+more wooden-ware jewelry, rare exoticarts+crafts young streetst.george's 48 years,44withLloyds,andmyclaims I havebeenintheinsurancebusiness email: [email protected] or e-mail:[email protected] PHONE: (473)4443944/1555 just stepsfromthecarenage Iolaire Enterprises(353)28-33927 settlement recordcannotbebeat. [email protected] tel: (473)440-2310 unique giftsforyourboat, “I’ll domybesttominimizeyourincrease!” Outboard Engines2HP-250HP Thereisgoodinsurance,therecheap your insuranceisuntilyouhaveaclaim. Rather, thehonestbrokercanonlysay, No longercanbrokerstalkoflowrates. Duty-Free EnginesforYachts insurance,butthereisnogoodcheap The insurancebusinesshaschanged. insurance. Youneverknowhowgood FAX: (473)4442899 Parts -RepairsService www.street-iolaire.com Then,iftheclaimisdenied Insurance home +friends or unsatisfactorilysettled, Fax DMStreet Marine it istoolate. grenada Dear Dear Lorensu Sue Simons fresh longer. Dry thetowelsoutsideaftereveryuseandthey’llstay cloth —ittakesupabout80percentofthemoisture. on bath-towelusebyfirstdryingyourselfwithawash- sheets andtowels.Dryeverythingonboard.Cutdown find alaundromat—notalwayseasytowash board. Ifyoudon’thaveamachineonboard,tryto anyone mentionedlaundry.Doallthesmallstuffon will cometosomething. having alionfishfishingtournament.Hopefullythis talk showtohighlighttheproblem,acallersuggested that lionfishishisfavouriteeatingfish.Onarecent iment withcookingthefish.ChefChrisnowdeclares has alsopersuadedatopchef,ChrisMalpas,toexper- can bequicklymadeharmlesswithablowtorch!He active incatchingallhecan.Apparentlythespines a greatjobofraisingawareness,aswellbeingvery officer attheBermudaAquarium,ChrisFlook,isdoing home) isalsodealingwiththisproblem.Thefisheries the lionfisharticlewithinterestasBermuda(our weather, butagoodanchoragewillshow consistently by differentboats,andthatthesewillchange withthe for theanchorage. minimum weightsnoted.Thiswillgivethe ratingfigure is dividedbythedifferencebetween maximum and mum weightsarenoted.Themeanvalue oftheweight observed forafewminutes.Themaximum andmini- line. Theweightisplacedonthescalesand thereading the beamofboat,ataboutfore-and-aftcenter- 10kg. Thescalesandweightareplacedmidwayoutto kitchen scalesforthe100gorfishing need tobeappropriatetheweightused—asetof glass ofwater)to10kg(adivingweightbelt).Thescales The weightcouldbeanywherebetween100g(asmall All thatisneededafixedweightandpairofscales. equipment neededshouldbeavailableonmostyachts. for theratings. rough. Perhapssomewherealistcouldbeestablished very shelteredandalownumberbeingexposed mined ratingtoananchorage,withahighbeing Anchorage RatingSystemEquation: January issueof S/Y WhitePrincess Mike Dorsett sion onthistopicwithMr.Hughes. revisit Grenada.Iwouldalsolookforwardtoadiscus- first hauloutinthreeyears,andafterthatwewill Carlisle Bay,Barbados,andSalineMayreau. swell workingitswayintotheanchorage—suchasat over 30.Scoresbelow10areusuallytheresultofa Trinidad, aretheonlyonessofarvisitedthatscore anchorages. TyrellBay,Carriacou,andChaguaramas, a higherratingforthatanchorage. ment canbemadeafterithasbeendone,resultingin If thespringingtechniqueissuccessful,measure- is wellknownandIhaveusedthisonmanyoccasions. able. Hisdescribedtechniqueforspringingtheanchor is intentional.Arollyanchorageusuallyuncomfort- would penalizearollyanchorageistrue.Howeverthis the measuringequipmentatmid-beamofyacht ing thismatter.Kevin’sstatementthattheplacementof to KevinHughes’letterintheFebruaryissueconcern- rating systemintheJanuaryissue.Iwouldliketoreply FFORUM RREADERS' We gottheJanuary I alsoreadthearticlesonbudgeting.don’tthink It isinevitablethatdifferentresultswill be obtained R =((Max+Min)/2)/(Max-Min) The methodofdeterminationisverysimple,andthe “I devisedthisratingsystemtogiveaneasilydeter- Editor’s note:Forthoseofyouwhomissedthe At themomentweareinTrinidad,preparingforour I nowhaveseveralmoreratingsforCaribbean Thank youforpublishingmyletteronananchorage O E Compass Compass R A U D , , M E Compass R Compass S , here’sMike’sProvisional '

in Martinique.Iread —Continuedonnextpage grandmother andmymother. also madefromgreenbananas). more familiarcuccoosmadefromcornmeal. (Theyare Caribbean BreadfruitCuccoo!Peoplemay knowthe didn’t havespacetoincludeareceipt for traditional fruit. Ilikedthemenus.Shirley,however, probably Breadfruit” byShirleyHall)wasgood.What aversatile goes on,asshewouldlikeit. she hadpassedawayinhernativeNorway.Butlife on theirColinArcherketch, seemed suchabeautifulcouplewhenIfirstmetthem island home.Iwassorrywhentheysplitup— was atrueambassadorforheradoptedCaribbean partner Peteralwaysgavemeawarmwelcome.She 1980s andgoodpartofthe1990s,Mariannher years. DuringmyalmostannualvisittoBequiainthe Mariann “WhyKnot”PalmborgwhomIknewformany Dear and answeringFAQs.LookforitatCustomsoffices. lished abrochureexplainingthebasicsofsystem Customs LawEnforcementCouncil,haverecentlypub- this wewelcome. opinions orsuggestionstothisongoingdiscussion— ters, proandcon,addnewusefulinformation, ing painsduringitsroll-out.Butwedoaskthatlet- seems heretostayandtherewillinevitablybeteeth- We’re notclosingthesubject,becauseeSeaClear about eSeaClear,bothcriticizingitandpraisingit. Ti Kanot Chris Doyle for thosewhoarenotusingtheadvanceinternetfeature. eSeaClear systeminthisway,itcanalsosaveform-filling is betterthannone.) then thePortAuthoritydidsame,butoneinthree and wantedmetofillintheiralmostidenticalform, he printedacopyforImmigrationwhothenignoredit hey, itwasdone!Noformformetofillin.(Ofcourse we tookonecrewmemberoff,heprinteditoutand, clear in,hejustbroughtupmyformonhiscomputer, I gavehimontoeSeaClear.Sonow,whenwantedto meantime hehadenteredallthedataonfirstform nice guy)recognizedme,andtoldmethatinthe When Iwenttoclearin,theCustomsofficer(avery month later,IagainforgottodoitwitheSeaClear. hand whenIarrived.Whencamebackalmosta eSeaClear system)soIfilledintheusualformby done anadvanceentry(Iforgottheywerepartofthe to eSeaClear.OnapreviousvisitNevis,Ihadnot than Trinidad’s.TheyreallyneedeSeaClear! make asmallcomplaint:Antigua’spaperworkisworse Dear right nexttoamodernflat-screencomputer. system, astheyhad“nocomputers”—whilestanding I arrivedtheCustomsmansaidtheycouldnotuse Bequia, asthesystemsaystheyareon-line,andwhen There wasoneonthedesk.Ithendidaclearanceinto said theyhadn’tbeentrainedandhad“nocomputers”. in witheSeaClearonreturningaweek’stime.He another CustomsofficerinRodneyBayifIcouldcheck Yacht TigerFrightener Larry Jeram-Croft a sweatyofficefillinginthesameoldstuffbyhand. of carbonpaperreappearandonceagainIhavetositin I cometoleave,however,theoldpaperformandreams have paidmyfees,agreatsavingintimeandeffort.When He printsoutaform,stampsitandgivestomeonceI destination andgivetheniceCustomsmananumber. aged forarrivalnotification. and heagreedthatthesystemisonlycurrentlyenvis- ly CustomsofficerinRodneyBayMarina,St.Lucia, does notcoverdeparture.SoIpoppeduptothefriend- Doyle alsomentionedinhisletterthatitcurrently Customs” —thekeywordherebeing“out”.Chris says it“doesnotreplaceclearinginandoutof so itislookinggood. modern-day computerliterateswillhavenoproblem, for a“beta”system:notparticularlyintuitive,butmost tions, IthoughtwouldgiveeSeaClearatry.Notbad what iseffectivelythesameformwithminorvaria- various scruffyofficesaroundtheCaribbean,fillingin ance form,andhavingbeenfedupwithsittingin the Februaryissueonnewon-lineCustomsclear- Dear boats), couldbefactoredin.” commercial activity(suchasjetskisandfastspeed- other factorsthataffecttheanchorage,likeunwelcome higher valuesthanapoorlyshelteredanchorage.Also I stillrememberthedeliciouscuccoos frommy The articleonthebreadfruit(“The Bountiful It wassadtoreadintheFebruaryissuedeathof By theway,folksbehindeSeaClear,Caribbean Editor’s note:We’vebeenreceivingalotofletters So thebottomlineis,ifCustomsofficersuse Talking ofwhich,Idiscoveredyetanotheradvantage I haverecentlyarrivedinAntigua,andwouldliketo PS. Incontinuanceofmyinvestigations,Iasked Only intheCaribbean… So hereweare:Ifillintheformonline,arriveatmy I notedthatonthehomepagelastlineoftext Having readyourarticleandChrisDoyle’sletterin Compass Compass Compass , , , Fredag —andalsothat MARCH 2009 CARIBBEAN COMPASS PAGE 41 LTD INE DISTRIBUTOR R P.O. Box 17, Kingstown opposite Howard’s Marine PAIE E-mail: [email protected] Located CALLIAQUA, St. Vincent AMAHA MA Y TEL: (784) 457 1806 FAX: (784) 456 1364 KMRN ENGINES (DUTY FREE PRICES) SPARES SERVICE MARINE EQUIPMENT . and AM Compass and assumed AM and 7:00 PM and in addition to the above, he AM Readers, , Kjell reported (statement #2) the inci- , Kjell reported (statement Kjell entered the Pirate’s Retreat Restaurant AM PM Compass On realizing that he was robbed, he went up on deck On realizing that he was robbed, At 11:15 In statement #1 given to the police, Kjell states that #1 given to the police, Kjell In statement Statement #4 is his letter above. I sympathize with the victims of crime of any kind, • There has never been an action of violence perpe- • We have a generous amount of helpers (boat- • There is a functioning Boat Boy Association with • The occurrence of only a handful of illegal incidents Wallilabou Bay is on the cusp of a new transforma- Finally, I wish to declare that no other incident was I’ve now read all I can quietly tolerate on the topic of Suppose lightning strikes your boat one day, holes it So you see, when you decided that you don’t need At 2:00 robbed of the following: one Olympus MU1030 camera following: one Olympus MU1030 robbed of the phone (value one gold Nokia cell (value EC$1500), cell phone (value US$280), EC$1500), one silver Nokia EC$700, and US$100. a white surfboard paddling and saw a Rastafarian on chase in his dinghy and hastily from his boat. He gave Some mention was made had an altercation with him. a result of a description of this in statement #3. As person was questioned by given in this statement, one lack of evidence. the police and released for Please note that three of the four statements are that three of the four statements Please note himself. actual signature of Kjell affixed with the between 11:50 he was boarded lost 500 Swedish kronas and a five mega-pixel Digicel lost 500 Swedish kronas and a five mega-pixel Digicel cell phone. anywhere, and particularly here in Wallilabou where we have made stringent efforts to create a safe and secure environment for the visiting public. In my 18 years at Wallilabou, there have existed certain inalien- able truths: trated against any visitor in this bay. boys), the numbers of which are sometimes intimi- dating and the actions of which can be construed as over-zealous. trained personnel carrying proper identification badges. is recorded in the bay each year. tion. New security lighting is soon to be installed by the Ministry of National Security, there has been a recent increase in police patrols, and a new permanent coast guard boat is to be introduced next month for Wallilabou Bay. These measures will transform our bay into one of the safest in the entire Caribbean. reported that night, but as we continue to be vigilant in our efforts, we must be mindful of the ubiquitous nature of crime and its adherence to no boundaries and in so doing strengthen our resolve to create a crime-free Wallilabou. Stephen Russell Director, Wallilabou Bay Resort Ltd. St. Vincent Dear cruising without yacht insurance. Apparently one does not need comprehension of basic math skills to be a cruiser. Obviously we need to explore the other side of the proverbial coin for a moment. and sinks it resulting in a total loss. Without insurance, you alone will pay the price for your decision, and that is how it should be. But life isn’t always so simple is it? Let’s say, for example, that one day in a crowded harbor my boat strikes yours and you sustain $20,000 in damage. My insurance will pay for your repairs. However, if under identical circumstances you were to cause the same damage to my boat, I’m screwed. You don’t have insurance to cover the damage. Nor do you have an extra $20,000 lying around to pay for it out of your pocket. (If you did, you would have used ten percent of that to buy yacht insurance.) I would have to file a claim with my insurance company to repair my damage, which would eventually result in an increase of my premiums. insurance, that you are willing to take the financial risk to save yourself a few bucks, you also made the decision to risk my cruising kitty, yet I see no savings. I really don’t appreciate having you make decisions that affect my finances, as I’m sure you would not appreciate my neglect costing you! —Continued on next page dent to me at Wallilabou Anchorage. He stated that he dent to me at Wallilabou Anchorage. at 6:00 heard footsteps on his yacht and proceeded to personally lodge statement #3 in the and proceeded to personally lodge statement #3 in the visitor’s log. He recorded that the robbery happened specifically at 6:25 that it was his passenger, Bengt. However, on seeing that it was his passenger, he realized that someone Bengt exit from his cabin, ran up on deck and else was on his boat. He quickly blue boat rowing away from noticed a man in a red and sanctuary of an adjacent his yacht and who sought the Kjell was particularly yacht to affect his escape. and mentioned that it had descriptive of the small boat around the area of the a generous amount of netting oarlocks. Along with the list of stolen items mentioned above, a passenger’s laptop was also mentioned, as well as Swedish money and euros. Kjell felt that the only reason his own laptop survived was because he had put it under his pillow. third statement was written by Kjell himself in the was written by Kjell himself third statement a restaurant of the Pirates Retreat, “Visitors Book” The fourth is northern end of the bay. located at the to the above letter written enshrined in , and Treviljor at Wallilabou AM . , S/Y Treviljor on the morning of the February 1st , AM Compass Caribbean Compass Continued from previous page Continued from Based on our investigations, we were able to draw Our normal course of action in such a situation is to Thank you for the opportunity to respond to the I now feel violated and lock the hatches at night, So anyway, keep your hatches locked if you stay The daytime security guard on land said we were In Bengt’s cabin, his camera and wallet were removed Thankfully they left the two credit cards and the two Good thing we did. When we went to bed we cleared the cockpit and all We had a nice evening and ate the grilled yellowfin I had heard all about the bay’s reputation and had I had heard all about the bay’s reputation and had As we sailed down the coast on the 1st of February, on the 1st of February, As we sailed down the coast I’m Captain Kjell of the Swedish yacht I’m Captain Kjell of the Swedish Peel one ripe breadfruit. Cut in slices (about five or breadfruit. Cut in slices (about Peel one ripe I don’t have any recipe but I am sure your readers recipe but I am sure your I don’t have any from four statements given by Captain Kjell. The first was given to Cpl. Daize of the Barrouallie Police Station at 7:00 work closely with the local constabulary in thoroughly investigating all claims and allegations and to find the perpetrators responsible. In Captain Kjell’s case, the challenge assumed greater urgency after he indicated his intentions of painting Wallilabou Bay with a brush of rancorous malignancy. situation involving Captain Kjell and the incident aboard his yacht, even in Bequia, which is a sad story after 20 trouble- free winters sailing in the Caribbean. Captain Kjell Yacht Treviljor Editor’s note: We asked Steve Russell of Wallilabou Anchorage, which provides yacht services in the bay, for his commentary on the situation, which follows. Dear there. Ours was the second boarding in two weeks, and the German yacht beside us had a visit the same night but nothing was taken, probably because nothing was accessible. lucky we stayed asleep, for a burglar that eager probably wouldn’t stop with a theft if he were challenged. with a few hundred EC dollars and some US dollars. We were lucky that the 1,000 pictures taken during the voyage were now on my computer, which was under a pillow on the other settee instead of in the bag where it was usually kept and which the thief removed. laptop computers that give me access to my bank laptop computers that give me access to my bank accounts. (The perp also missed my Swedish phone, which is open to all calls worldwide, so who knows what this could have cost me.) deck areas of all valuables and took everything down deck areas of all valuables and took everything down below. During the night, between 0400 and 0630, somebody came aboard and removed two Nokia camera-telephones, my US phone, and my local Digicel phone from a place 30 centimetres in front of my head! They also lifted two pairs of trousers from the hooks 15 centimetres over my head and emptied all the pockets, sorting out the various currencies and only taking EC money, leaving my trousers nicely laid out on the sofa in the saloon! tuna we caught earlier while trolling. We went to bed tuna we caught earlier while trolling. We went to bed late after taking all the photos off my friend Bengt’s digital Olympus mu1030 camera, which you can take down to ten metres under water. been there in the early 1990s, when you had heaps been there in the early 1990s, when you had heaps of boatboys hanging all over your topsides and half- way into your cockpit. But this time I told everybody that only the guy who took our line would take care of all my business, and most of the others dropped off easily. we were charmed by the seven-knot rowing strong- we were charmed by the more than a nautical mile man who cheerfully met us the very fine anchorage in off the coast. He told us of our plans to go to rolly Wallilabou. So we changed for a quiet night in lee- Young Island Cut and opted my friend would leave for ward-side waters, before the airport and the long flight back to Sweden the day after. I just want to warn the sailing community of the pos- I just want to warn the sailing in Wallilabou, St. Vincent, sible hazards of anchoring bay”. now apparently a real “pirates’ six), taking out core. Boil in salted water until soft. core. Boil in salted water six), taking out of bread dough. After Mash slices until consistency or three tablespoons of old- placing on a plate, put two we only have it once in a style butter on top (after all, (and a chopped hard-boiled while). Serve with salt fish Great! egg, if desired). Serves two. Norman Faria Barbados Hi will send in some (also for the cornmeal and banana (also for the cornmeal will send in some that old-time best were “lathered” in variants). The saltfish! I tins and best served with salty butter from good for you. salt these days is not guess too much for what’s is try to make it. Anyhow, Now again I worth, here goes: — Anchorage, in which written notes were taken. The and duly signed by the Captain himself. A quantity of lost items was also recorded in the “Stolen Property Register” and bears the I.D. number 27. The second report was made to me at 11:15 MARCH 2009 CARIBBEAN COMPASS PAGE 42 use thisemailaddress: If youwouldlikemoreinformationaboutthisjoborsendyourCVtous,please Anyone withaninterestiswelcometoapply. have apositivedispositiontolifethiscouldbeyourDREAMjob. This isaFUNjobwithgreatearningpotential.Ifyouarewillingtoworkhardand We offer fulltrainingonsiteintheCaribbean. Dive master/instructorforeithertheCaptainand/orChefisaplus. Chef/Hostess withabasicunderstandingofcooking. licence. Requirements: CaptainwithaSkipper’s between CaptainandChefthemoresuccessfulyourcharterswillbe. The natureofthejobissuchthatbetterunderstandingandteamwork We prefercouplesthataremarried ORhavebeenlivingtogetherforatleastayear. We arelookingforcrew, mainlyteamsintheformofaCaptainandChef/Hostess. P.O. Box851,St.Vincent&theGrenadines, Tel: (784)458-7270Fax:457-9917 Tel. StVincent +7844573407Tel. StMaarten+5995510550 or bymailto:BequiaMarina,P.O.Box 194BQ,PortElizabeth, email: [email protected] E-mail: [email protected] CREW VACANCIES! operating TERM CHARTERS, allinclusive,7days. We arethefastestgrowingchartercompany, six destinationsintheCaribbean. TradeWinds CruiseCluboperate afleetofcatamaransacross WALLILABOU ANCHORAGE WALLILABOU BAYHOTEL [email protected] West Indies. Bequia, StVincent &theGrenadines (range limitedbythehills) VHFCh16&68 ... CARIBEE BATIK-BOUTIQUE CREDIT CARDSACCEPTED WATER, ICE,SHOWERS BAR ANDRESTAURANT MOORING FACILITIES TOURS ARRANGED HAPPY HOUR5-6 PORT OFENTRY

It’s justnotworththerisk!Isleepwell and LarryEllisondon’tgo“selfinsured”. That’s whyevenPaulAllen,TigerWoods to makeyourboatlesslifemiserable. and untilyoupay,thesenatorisgoing decided togowithoutyachtinsurance, exposure” youhaveacceptedwhen a merepittance.That’sthe“financial those premiumdollarsyousavedseem multiply thenumbersbyten,making death involved,youcouldprobably worse? Ofcourse.Hadtherebeena States Senator$100,000.Couldlifebe from amaritimecourttopayUnited You’re leftboatlessandhaveorders him tenpercentofamillion,$100,000. over bythisclod,areorderedtopay $90,000; andyou,whowerealmostrun percent ofyour$100,000dreamboat, that hewillbeorderedtopayyou90 cent responsible.Whatthatmeansis because oftheRulesyouaretenper- responsible fortheincident,but cigar-chomping skipperis90percent could easilybedeterminedthatthe — you atleast you didn’t,MaritimeLawwilllikelyfind all times,inanycircumstances,and Road requireyoutoavoidacollisionat fault. ButbecausetheRulesof declared totallosses. from thedamageandbotharelater board side.Bothboatssinkonthespot alone maneuver,andyouhithisstar- path. Youhavenotimetoreact,let turns infrontofyou,crossingyour tain getscigarsmokeinhiseyesand you getrealclose,themega-yachtcap- to-port likeyoushould,butjustwhen politician. You’relineduptopassport- ing a$1,000,000yachtownedbyUS demarcation lineandyou’reapproach- busy harborentrance,justoutsidethe let’s explorethat.Let’ssayyouareina right? You’re“selfinsured”Well, to dokeepyourcruisingdreamalive, charts. Fairtides! nadir tosoonafteritsrising,thetiderunswestward.Timesgivenarelocal. moon’s settingtojustafteritsnadir,thetiderunseastward;andfrom moon reachesitszenith(seeTIMEbelow)andthenrunswestward.Fromjustafterthe to theeastsoonaftermoonrise,continuesrununtilaboutanhour calculate thetides. of themeridianpassage(orzenith)moonforthisandnextmonth,willhelpyou author ofStreet’sGuidesandcompilerImray-Iolairecharts,whichshowsthetime your passagefasterandmorecomfortable.Thetablebelow,courtesyDonStreet, Obviously thisincidentislargelyhis But you’regoingtodowhatyouhave Continued frompreviouspage For moreinformation,see“TidesandCurrents”onthebackofallImrayIolaire Note: themaximumtideis3or4daysafternewandfullmoons. Water, Donexplains,generallytriestoruntowardthemoon.Thetidestartsrunning Crossing thechannelsbetweenCaribbeanislandswithafavorabletidewillmake 20 0722 19 0632 18 0542 17 0450 16 0359 15 0310 14 0221 13 0134 12 0047 11 0008 10 0000 9 2314 (full) 8 2220 7 2126 6 2028 5 1927 4 1825 3 1724 2 1626 1 1532 DATE TIME March MERIDIAN PASSAGE

partially responsible.It OF THEMOON MARCH &APRIL2009 9 0000 8 2325 7 2239 (full) 6 2152 5 2104 4 2014 3 1920 2 1822 1 1721 DATE TIME April 31 1620 30 1519 1327 29 1421 28 27 1237 26 1151 (new) 25 1106 24 1032 23 1939 22 1855 21 0809 ity andfairplay. from printatyourrequest. however, yournamemaybewithheld We donotpublishanonymousletters; results complaints.(Kudosareokay!) er complaintsorindividualregatta clarification isrequired. can contactyou(preferablybye-mail)if or shoresideaddress,andawaywe Dear Tom Hankins Responsibly submitted, are lawyers. my familymemberssellinsuranceor math andcommonsense. not doittoprotectyourself?It’ssimple other boatscurrentlyunderway,why kitty, andthatofthethousands insure yourboattoprotectmycruising 15-minute consultation.Soifyouwon’t he passesyoua$100invoicefor general, agreewiththesestatementsas sult amaritimelawyerwhowould,in and commissions.You’llhavetocon- agent, heonlyunderstandspremiums cover boththesesituations. at nightknowingthatmypolicywill St. Vincent&theGrenadines Bequia Box 175BQ Readers’ Forum Compass PublishingLtd. or [email protected] Send yourlettersto: Letters maybeeditedforlength,clar- We donotpublishindividualconsum- Please includeyourname,boatname We wanttohearfromYOU! For therecord,neitherInoranyof You don’tbelieveit?Don’taskan Compass 30 1715 29 1616 28 1513 27 1410 26 1308 25 1210 24 1117 23 1028 (new) 22 0942 21 0859 20 0816 19 0732 18 0648 17 0602 16 0514 15 0424 14 0332 13 0241 12 0150 11 0100 10 0012 Readers, MARCH 2009 CARIBBEAN COMPASS PAGE 43 € € € € € € € € € E L Martinique 245 000 2 * 27 Cv Yanmar - Good condition A S MONOHULL CATAMARANS

R New Yanmar 100hp PROVEN WORLD CRUISER O CSY 44, WALKOVER, 1978 GREAT OPPORTUNITY AT US$90,000 FFOR SALE St Martin 199 000 US$ LYING IN BEQUIA TEL: (784) 458-3255 E-mail: [email protected] Islands Spirit 37 - 2001 - US Flag Perfect Condition Attractive Price Amel Mango Amel Super Maramu 2001 Superb Alubat Ovni 435 2006 Oceanis 411 1998 (Superb) 1979 Lagoon 380 2004 Guadeloupe Nautitech 395 1999 Athena 38 1996 320 000 Guadeloupe Martinique Guadeloupe 109 000 269 000 120 000 St Martin St Martin 165 000 Venezuela 169 000 140 000 US $ Amel 54 2005 VAT Paid Amel 54 2005 VAT Paid Lagoon 500 2006 Tahiti 699 000 Martinique 600 000 We look forward to seeing you in April. For more information visit www.sailingweek.com. We may be missing some of the frills this year but we will still be providing all We may be missing some of the frills this year but we Now one of the premier sailing regattas in the world, Antigua Sailing Week wel- Now one of the premier sailing regattas in the world, We will strive in every way to maintain the high standards of racing that we have We will strive in every way to maintain the high standards The organizing committee will ensure that the racing on the water is not compro- The organizing committee will Neil Forrester of the Antigua Hotels and Tourist Association, Chairman of Antigua Hotels and Tourist Association, Chairman of Antigua Neil Forrester of the Antigua Action at Antigua Sailing Week is always intense, and 2009 will be no different the thrills! comes participants from all corners of the globe each year competing for the chance comes participants from all corners of the globe each year racing in some of the best to win this prestigious event. Five challenging days of famous Antiguan hospitality sailing conditions in the world combined with the make this a regatta not to miss. been known for. We have contracted this year with GWM Race Management who been known for. We have contracted this year with GWM regatta. Fortunately, over will be coming over to manage the on-water side of the and is able to continue in the years, Sailing Week has built up its own resources adverse circumstances such as these. mised in any way by this turn of events. This is a pivotal year for ASW as we are of events. This is a pivotal year for ASW as we are mised in any way by this turn also the Antigua Mini Ocean Series, so this year sees introducing a new format and no vision for the event for the coming years. We will the introduction of the new if the balance of the sponsorship does not material- doubt be financially challenged do budgets accordingly. However, on a positive side, we ize, but we can adjust our in the form of Corum Watches who have become our have a new Gold Sponsor official timekeeper and this will help offset any shortfall. Sailing Week, reports: Following the news that our title sponsor, Sir Allen Stanford, the news that our title sponsor, Sir Allen Stanford, Sailing Week, reports: Following by the Securities and Exchange Commission (SEC), has been charged in the USA the participants and all those planning to attend this we would like to reassure all that the 42nd running of the regatta will be going year’s Antigua Sailing Week through May 2nd. ahead as planned, April 26th as Planned is Going Ahead Ahead is Going Antigua Sailing Week ’09 Week Sailing Antigua MARCH 2009 CARIBBEAN COMPASS PAGE 44

FINISHINGF PRODUCTS PT-9900-144 HORTA /FAIAL, AZORES Noelina &LennoxTaylorwelcomeyou!

PORTHOLE RESTAURANT &BAR Incl. Pilots,Rigging Chandlery, Charts, ★ TEAK TE TEL +351292391616FAX +351292391656 A friendlyatmospherewhereyoucansitandmeetpeople. INISHING PRODUC C YACHT SERVICES & ShorelineMini-Market caribwoods@vinc [email protected] Comeandfindusamongstthetrees! Phone:1(784)457-3000 Phone:1(784)457-3000 C PLEASE RESERVE! Monday toSaturday Candelight Dinners MID ATLANTIC Providing all vital services to Providing allvitalservices A www.midatlanticyachtservices.com Bequia,St.VincentBe a EU-VAT (14%)importation MARINE PLYMA Duty free fuel(+10.000lt) Duty free Admiralty Bay,Bequia K Caribbean CompassMarketPlace r Trans-Atlantic Yachts! Tel: i in Lower Bay, Bequia

b & [email protected] q R b uia, St.Vincen (

HARDWOODH e 784 IN a

ARDWOOD n ) We servebreakfast, E 458-3758 lunch anddinner W Phone (784)458-3458 PL W y surf.com o H CH68 VHF o Y t

T S

Market Place, contact your island agent Market Place,contactyourisland agent Piper MarineStore Stocked withlotsofmarinehardware, filters, (see list on page 4) or contact Tom at (see listonpage4)orcontactTom at To advertise in Caribbean Compass To advertiseinCaribbeanCompass (784) 4573856Cell: (784)4952272 nuts &bolts,impellers, bilgepumps, Bequia -Port Elizabeth [email protected] Services offered: Rigging, Lifelines Located downstairs AllickSails varnish &muchmore. (784) 457 3409 (784) 4573409 continuedonnextpage Clearance Information • Fishing •LightEngineandBoatRepairCustoms/Immigration Restaurants •Taxi&TourOperatorsWhaleWatchingSport SIM TopUp•LaundryWiFiInternetBeachBarNearby Disposal •SecurityTelephone&FaxMobilePhoneRental/ • LPGas(propane)refillsShowers&Toilets(WC)Garbage Marine /SeaChoiceProductsMercury/Yanmar (Unleaded /Diesel)•IceYachtChandleryagents-Budget • Bakery(Sukie’sBreadCompany)WateratdockFuel • YachtMooringAnchorageGroceryStore&Provisioning CARRIACOU REALESTATE Property ManagementonCarriacou Tel: (473)4438182Fax: 4438290 e-mail: [email protected] We alsohandleVilla Rentals& or contactCarolyn Alexanderat For fulldetailsseeourwebsite: Land andhousesforsale www.islandvillas.com Down IslandLtd Visa /MasterCardaccepted Roseau &Portsmouth UNIQUE INDOMINICA The Dockmaster Tel:767-275-2851VHF:16 Tel: 767-448-2705Fax:767-448-7701 home ofthe [email protected] www.dominicamarinecenter.com Dominica MarineCenter and yourcenterfor: Dominica Yacht isthe Club MARCH 2009 CARIBBEAN COMPASS PAGE 45 n o o t g a a e L

r t e F e u D r l P

E B T s

R ' A s C n ' and deliver door to door and deliver t e D N CIRExpress CIRExpress COURIER SERVICES COURIER SERVICES St. Maarten/ St. Martin, collect Martin, Maarten/ St. St. n I W m e S s E c t L B n A h i M Int. 001-3057042314 Int. U c Packages Pick – up call: Packages Pick – up call: S V N

a Fax: 1 (784) 456-2658 O . # YYachtsmen's retreat E-mail: [email protected] E-mail: t S

+ (599) 553-3850 / + (590) 690-222473 n Tel: 1 (784) 456-8528 / 493-3076 [email protected] www.canashbeachapartments.com iin St. Vincent's Blue Lagoon continued on next page I L S P E H C H A N D R Didier and Maria [email protected] Saturday by appointment tel/fax: (596) 596 74 88 32 located at Carenantilles dockyard LE MARIN/MARTINIQUE e-mail: [email protected] Tel: (0) 596 71 41 61 Fax: (0) 596 71 77 I I Open Monday to Friday 8-12am 2-6pm Open Monday to Friday 8-12am 2-6pm R N Sails & Canvas (repairs & fabrication) G G G Le Marin, Martinique Voiles Assistance Shipchandler, Artimer Phone: +(596) 596 74 8033 Cell: (596) 696 27 66 05 www.caraibe-greement.fr [email protected] LE MARIN, MARTINIQUE • GRENADA All the & Safety Open 7/7 Supplies, Chandlery Equipment for your Boat F D P E T R A C D N I W

S Tel/Fax (473) 439-4495 Caribbean Compass Market Place Market Compass Caribbean G [email protected] A [email protected] Nick Williams, Manager Nick Williams, L Tel: (473) 536-1560/435-7887 (473) Tel: F

Engineering, fabrication and Port de Plaisance 97290, Le Marin welding. Fabrication and repair of

Grenada Marine • Spice Island Marine Grenada Marine • Spice TechNick Ltd. TechNick stainless steel and aluminium items. S.I.M.S. Boatyard, True Blue, Grenada Blue, Grenada S.I.M.S. Boatyard, True Tel: +596 74 87 55 Fax: +596 74 85 39 MARTINIQUE SAILMAKING, RIGGING, ELECTRONICS SAILMAKING, email: [email protected] MARCH 2009 CARIBBEAN COMPASS PAGE 46 Caribbean CompassMarketPlace [email protected] or contactyourlocalislandagent MARKET PLACEAD YOUR THIS COULDBE Book itnow:

Tel: +44(0)1489550565Mob:+44(0)7515736466 1 OrwellCrescent,FarehamHants,PO144JRUK AAtlantic P: 599-544-5310F:599-544-3299 We guaranteetobeatanywrittenquote. please contact Atlantic Yacht Deliveries. Marine Distributors Marine Distributors t For deliveriesbacktoUKandEurope [email protected] l www.IslandWaterWorld.com a Email [email protected] www.atlanticyachtdeliveries.co.uk n St Thomas, StMaarten, t St Lucia,Grenada i c

YYacht a c h t

DDeliveries e l i v e r i e s MARCH 2009 CARIBBEAN COMPASS PAGE 47

seeking a Graphic WANTED looking for 2 employ- Grenada MP CLASSIFIED ADS US 50¢ per word – include name, address and numbers in count. Line drawings/ photos accompanying classifieds are US$10. Pre-paid by the 15th of the month. No replies. SUPERVISOR SEE WWW. SHELTERBAYMARINA.COM with experience in marine repairs (sail and power) as well as waterfront and Travelift operations. Fluent English and some Spanish required. Must be willing to live on site or nearby. Contact [email protected] New BVI Publishing Company & Web Designer. Degree and experience in areas such as book layout, magazine design, web and video editing is required. Interest in water sports, travel, arts and crafts a plus. Email applica- tion and resume to: dread- [email protected] or/and [email protected]. TORTOLA - ARAGORNS STUDIO ees.Welder/Workshop manager and shop assistant required at our busy Art Studio in Trellis Bay, BVI.Ideal candidates are a couple with artistic inclination living on their own boat and looking for shore side employment in a US$ economy. Still interested to hear from a lone welder! Info contact Aragorn Tel (284) 495-1849 E-mail [email protected] tigrain, banana bread, herbstigrain, banana To& flax, butter crescents. (784) 457- place order Tel E-mail 3527/433-3008 [email protected] FREE Orders are delivered HURRICANE SPENDING THE SEASON IN PLC VENEZUELA? Bahia Redonda Marina, Slip to rent,$15 per day inc water, electricity,cable TV. Hauling out? I have a beautiful four bedroomed apartment,overlooking the pool fully equiped, internet, cable tv, huge terrace. Great rates for cruisers. E-mail [email protected]

, elec- Santa Barbara Resorts Savon De Mer Curaçao Sea Services 11 Ship's Carpenter Sling's Upholstery 24 Soper's Hole Marina MP Spice Island Marine Caribbean Superwind Germany Trinidad Tortola Carriacou Martinique SVG Air MP SVG Tourism Grenada Technick Grenada 16 MP MP Tikal Arts & Crafts 35 Trade Winds Cruising 27 Bequia Grenada St. Vincent St. Vincent 5 40 42 37 MP = Market Place pages 44 to 46 Transcaraibes Guadeloupe MP Transcaraibes Guadeloupe Turbuence Alternative Energy , Safe-Private- Vemasca Venezuela 29 20 Turbulence Sails Turbulence Sails MP Tyrrel Bay Yacht Haulout MP Carriacou Vemasca Venezuela Voiles Assistance Grenada Volvo Martinique Grenada 30 Wallace & Co Wallilabou Anchorage 27 Martinique WIND Martinique MP WIND Martinique Vincent St. Xanadu Marine MP 42 Bequia Venezuela 31 29 16 by 32 feet, sol- RENTALS & Cakes made fresh SERVICES Serious buyers only. Sale by Serious buyers only. 456 0866 owner. Call (784) E-mail after 6pm. [email protected] BEQUIA - PROFESSIONAL BEQUIA - PROFESSIONAL UNISEX HAIR SERVICE JSM Beauty Salon, Villa and Yacht visits accepted. Contact Jill for an appointment. Tel (784) 457-3600 E-mail: [email protected] ST. VINCENT NAIL SALON BELLEVUE, CARRIACOU, BELLEVUE, CARRIACOU, GRENADA. idly built with hardwood and baked enamel tin roof. Fence, plus gate, plus latrine and a 400-gallon water tank with gutter system in place. Southern panoramic view with a breeze, 5-10 minutes walk to secluded black sand beach. Tel (902) 648- 0165 or go to http: //www.carriacou.net/ listings/WoodenHouseBelmont/ MT. PLEASANT, BEQUIA Beautiful views only US$4.00/Sq.Ft. Tel: (784) 532-9224 Sapphire Resort Marina- St. Thomas Convenient. Long & Short Term Rentals 65 ft Max. $1,200.00 monthly. Adjacent Apartments also available. E-mail: [email protected] Tel: 787-366-3536 Sapphire Village St. Thomas Studios and 1 Bedroom Apartments. Short & Long Term Rates. Starting @ $1,100.00 month. Boat Slips also Available. See photos at www.vrbo.com #106617 Tel: 787-366-3536 or Email:[email protected] Upstairs Gourmet Food, between Sunsail & Young Island cut, Manicure, Pedicure, Various nail services. Call 526-5742 (Sabrina) VHF 68 PUERTO LA CRUZ, VENZ. INSURANCE SURVEYS, trical problems and yacht deliveries. Tel Cris Robinson (58) 416-3824187 E-mail [email protected] BEQUIA HOMEMADE BREADS every day! Wholewheat, mul- Azores MP

E-mail Volvo Volvo Services e-mail Carriacou for VINDÖ 35, , Lower Bay, Bells , Lower Bay, Bells at http://doylecarib- MISC. FOR SALE GRPro-Clean Martinique MP Grenada Marine Grenadines Sails GRPro-Clean Martinique Iolaire Enterprises Island Water World Grenada Johnson Hardware Bequia Jones Maritime UK 21/40 KNJ Marine Sint Maarten 48/MP 26 KP Marine St. Lucia Lagoon Marina 31 Le Ship Lulley's Tackle St. Croix 33 32 Maranne's Ice Cream Marc One Marine MP Trinidad Marina Zar-Par St. Maarten 41 Bequia McIntyre Bros. Ltd St. Vincent Mid Atlantic Yacht 35 Bequia Navimca Venezuela MP Trinidad 41 Navtech Trinidad 39 Martinique Grenada Tortola Northern Lights Generators 15 Dominican Rep. Old Fort Estates 30 MP MP Perkins Engines 40 Petit St. Vincent 21 Piper Marine Porthole Restaurant Bequia Power Boats Tortola Renaissance Marina PSV Bequia Salty Dog Sports Bar MP Aruba Bequia Bequia 22 MP Trinidad 34 MP 25 39 MP PROPERTY FOR SALE MASTERVOLT REAL SINE WAVE INVERTER/CHARGER COMBI New in Original Box. 24 VDC naar 240 AC /50Hz , 4000 Watt real sine wave charger 240 AC 50/60Hz naar 120 Amp 24 VDC laad- stroom. Price US$3500 [email protected] SAILS AND CANVAS EXCEPTIONALLY SPECIAL DEALS bean.com/specials.htm CARRIACOU, ONE ACRE LOTS and multi acre tracts. Great views overlooking Southern Grenadines and Tyrrel Bay www.caribtrace.com BEQUIA Point, House and Land. VITECH 49 TS SPORT CRUISER Must Sell.Offers Accepted. Engines need work. On dry dock at Ottley Hall Phone 784 488 8414 E-mail: [email protected] SELDEN RIG deck stepped, boom, spreaders, lights, winches (has been changed for upgrade) 4000 US o.b.o ask for details 758 4528531 e-mail [email protected] LOOKING FOR HOT SPOT TO DO FROZEN DRINK BUSINESS! Have eight frozen Daiquiri machines, one soft ice cream machine, long beer cooler, chest freezer, refrig- erator and microwave to make FAST drink/food sales! Make me an offer I can't refuse! Tel (340) 998-7728 or E-mail montanacommu- [email protected]! Any island, anywhere! ENGINES FOR SALE 60hp or 20hp; Perkins 75hp w/ turbo-charger. Good working condition. New and used Volvo parts.Call Lawrence in Trinidad (868) 730-4036 E-mail [email protected] COMMERCIAL SINGER SEWING MACHINE with hand crank in walnut case. Perfect for sewing sails onboard. Asking U$250 Tel (473) 443-6221 [email protected] Built Must sell, CLASSIFIEDS Trinidad 10 sailing boat, ADVERTISERS INDEX power boat in excel- HARRIS 40 FT TRIMARAN Fully equipped, great live aboard US$ 35,000. ONO E-Mail [email protected] 42' POST SPORTSFISH Tel (246) 258-1052/230-3515 E-mail [email protected] ‘SOFIA’ FRENCH BUILT CORNOU CLASSIC, 37’ 47’ CLASSIC GAFF RIG 1999 MAINSHIP 430 TRAWLER EXPRESS lent condition, fully equipped for extended cruising and living aboard. Fiberglass hull. Length 43'. Height 21’. 2x 350 HP Cat- erpillar engines, 1,200 engine hours. US $200,000. Contact: Jan (473) 456 1919 E-mail [email protected] 2x671 Detroit Diesel Engines Gen. Set, MANY extras. US$85,000, OBO Barbados, mahogany and oak with GRP outer hull and full keel, Yanmar 3GM engine, sails in reasonable condition, part restoration but bit more work to do, US$ 12,500, lying Rodney Bay, St Lucia – E-mail [email protected] 2000 using Brazil hardwoods, 25 tons, Mercedes 120hp diesel, Located Trinidad. Duncan, Tel (868) 361-3640

cutter- CIRExpress St. Maarten MP Maarten 11 Ciao Pizza CIRExpress St. Clipper Ship Cooper Marine Curaçao Marine Diesel Outfitters Diginav Martinique Discovery Marigot Union Isand Dockwise Yacht Transport Martinique USA Martinique Curaçao 37 Dockyard Electric St. Maarten Dominica Marine Center 18 MP St.Lucia Dopco Travel Dominica 43 10 Down Island Real Estate 11 Carriacou Doyle Offshore Sails Trinidad 42 28 MP Doyle's Guides 6 MP Echo Marine - Jotun Special MP Tortola 3/MP Electropics Trinidad MP Grenada Electropics Trinidad Electropics Trinidad Errol Flynn Marina USA 26 Falmouth Harbour Marina Antigua Fernando's Hideaway Food Fair Jamaica Fortress Marine Bequia Frangipani Hotel 7 31 Fred Marine 9 Gourmet Foods Grenada Around Island MP St. Kitts Grenada Bequia Grenada St. Vincent 14 Guadeloupe 12 30 39 17 38 with eve- com www. , Morning Tide - US$31,750. atable w/15hp Yama- caribbeancompass. rything. A/C, generator, new bimini, hull just painted. Owner relocating. For inventory email [email protected] Patrick Tel (473) 406-8888 GREAT LITTLE 25' GREAT LITTLE 25' WEEKENDER '77 F.G. w/8H.P. Yanmar I.B., rigged in 05, lying in Grenada $13 K USD, Tel: (473) 440 -7525 Catalina sloop 38 ft 36' BRUCE ROBERTS rigged cruising sailboat, 1987. great roomy custom liveaboard. wood/epoxy composite. Yanmar 24hp diesel. recent batteries, new Airx wind generator, solar panel, and refrigeration. 9ft AB inﬂ ha. US$18,500. located Vir- gin Islands. Tel (608)334-8553. Email: [email protected] OYSTER 45' 1996. BEQUIA Visit oysteryachtrainbowspirit.com to see details on this lovely yacht.Price US340,000 Tel (784) 532 1690 $46,500 Bargain. 1-360-317-5015 E-mail [email protected] www.mackayeharborinn.com S&S 34 Excellent Condition – good inventory. Tel: (868) 704-1358 bottom, 6hp Yamaha, 6hp Yamaha, bottom, canvas, good cockpit range/ good sails, new updated, oven, rigging new engine runs great, Many hoses, mounts. cruising spares, tools and the BVI "stuff". We cruise to April 2. area Feb. 11 well. Everything works Petite Martinique 31 Trinidad MP Ber- Two Two fiberglass, gc, new BOATS FOR SALE Barefoot Yacht Charters Barrow Sails & Canvas St. Vincent Basil’s Bar Trinidad Benhanzin Entertainment 36 Antigua Bequia Sailing Club Bichik Services MP Bogles Round House Budget Marine Bequia 8 BVI Yacht Sales Carriacou Camper & Nicholsons Mustique Canash Beach Apts Martinique Captain Gourmet 13 37 Grenada Caraibe Greement 38 Sint Maarten 2/MP MP Tortola St. Vincent Caraibe Greement Caribbean Yachts 23 Carene Shop MP Union Island Martinique Caribbean Marine Electrical 43 Martinique 37 Caribbean Propellers Ltd. Trinidad Guadeloupe 19 Caribbean Woods MP Carriacou Silver Diving 43 Carriacou Martinique MP Bequia 28 MP MP A&C Yacht Brokers Admiral Yacht Insurance UK Anjo Insurance Antigua Classic Regatta Martinique Art & Design Antigua Art Fabrik MP Atlantic Yacht Deliveries B & C Fuel Dock UK Antigua 41 11 Antigua 35 Grenada MP MP MP ADVERTISER LOCATION PG# ADVERTISER LOCATION PG# ADVERTISER LOCATION PG# ADVERTISER LOCATION PG# heads, two staterooms, heads, two staterooms, davits, solar panels 150wt. Carib 11' hard- BENETEAU 37, 1987. 31' (9.35M) MURIA 1992 muda sloop. Popular So. Africa design by Oswald Beckmeyer, built by Z-Craft in Durban, S.A. Yanmar 2GM20, Zetus manual wind- lass, many extras for cruising. Berthed at Grenada Yacht Club. Contact Selwyn Tel (473) 435-4174 PUMA 32 1978 Engine 2006 Sole Mini 32 Auto/wind pilot, GPS, VHF. Ready to go US$25,000 E-mail: [email protected] engine, very well equipped, excellent live aboard and cruiser. Price reduced from US$199,000 to US$169,000 ONO for a fast sale. Lying St Lucia. For more info and pictures please e-mail [email protected] or phone +596696907429. URGENT SALE - VENUS 46, 1984 KETCH 1975 German Frers 39ft, 1975 German Frers 39ft, 2 sets racing sails,US 57.000 1981 Cape Dory 30, US 39.000, St.Lucia duty paid 2000 Catana 471, 4 cabin, 460.000 Euros 1987 Irwin 44 US 105.000 1992 Dehler 37 CWS, 90.000 Euros 1981 CT 54 US 195.000 E-mail Yachtsales@dsl-yachting.com Tel (758) 452 8531 BOATS FOR SALE IN TRINIDAD Tel (868) 739-6449 www.crackajacksailing.net Published by Compass Publishing Limited, St. Vincent & the Grenadines, and printed by Trinidad Publishing Company Limited