OR2W1 (Human) Recombinant Protein

Total Page：16

File Type：pdf, Size：1020Kb

OR2W1 (Human) Recombinant Entrez GeneID: 26692 Protein Gene Symbol: OR2W1 Catalog Number: H00026692-G01 Gene Alias: MGC119162, MGC119163, MGC119165, hs6M1-15 Regulation Status: For research use only (RUO) Gene Summary: Olfactory receptors interact with Product Description: Human OR2W1 full-length ORF odorant molecules in the nose, to initiate a neuronal (NP_112165.1) recombinant protein without tag. response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family Sequence: of G-protein-coupled receptors (GPCR) arising from MDQSNYSSLHGFILLGFSNHPKMEMILSGVVAIFYLITL single coding-exon genes. Olfactory receptors share a VGNTAIILASLLDSQLHTPMYFFLRNLSFLDLCFTTSIIP 7-transmembrane domain structure with many QMLVNLWGPDKTISYVGCIIQLYVYMWLGSVECLLLAV neurotransmitter and hormone receptors and are MSYDRFTAICKPLHYFVVMNPHLCLKMIIMIWSISLANS responsible for the recognition and G protein-mediated VVLCTLTLNLPTCGNNILDHFLCELPALVKIACVDTTTV transduction of odorant signals. The olfactory receptor EMSVFALGIIIVLTPLILILISYGYIAKAVLRTKSKASQRKA gene family is the largest in the genome. The MNTCGSHLTVVSMFYGTIIYMYLQPGNRASKDQGKFL nomenclature assigned to the olfactory receptor genes TLFYTVITPSLNPLIYTLRNKDMKDALKKLMRFHHKSTK and proteins for this organism is independent of other IKRNCKS organisms. [provided by RefSeq] Host: Wheat Germ (in vitro) Theoretical MW (kDa): 36.1 Applications: AP (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Form: Liquid Preparation Method: in vitro wheat germ expression system with proprietary liposome technology Purification: None Recommend Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Page 1/1 Powered by TCPDF (www.tcpdf.org).

Copy Link

Recommended publications

Genetic Variation Across the Human Olfactory Receptor Repertoire Alters Odor Perception
bioRxiv preprint doi: https://doi.org/10.1101/212431; this version posted November 1, 2017. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. Genetic variation across the human olfactory receptor repertoire alters odor perception Casey Trimmer1,*, Andreas Keller2, Nicolle R. Murphy1, Lindsey L. Snyder1, Jason R. Willer3, Maira Nagai4,5, Nicholas Katsanis3, Leslie B. Vosshall2,6,7, Hiroaki Matsunami4,8, and Joel D. Mainland1,9 1Monell Chemical Senses Center, Philadelphia, Pennsylvania, USA 2Laboratory of Neurogenetics and Behavior, The Rockefeller University, New York, New York, USA 3Center for Human Disease Modeling, Duke University Medical Center, Durham, North Carolina, USA 4Department of Molecular Genetics and Microbiology, Duke University Medical Center, Durham, North Carolina, USA 5Department of Biochemistry, University of Sao Paulo, Sao Paulo, Brazil 6Howard Hughes Medical Institute, New York, New York, USA 7Kavli Neural Systems Institute, New York, New York, USA 8Department of Neurobiology and Duke Institute for Brain Sciences, Duke University Medical Center, Durham, North Carolina, USA 9Department of Neuroscience, University of Pennsylvania School of Medicine, Philadelphia, Pennsylvania, USA *[email protected] ABSTRACT The human olfactory receptor repertoire is characterized by an abundance of genetic variation that affects receptor response, but the perceptual effects of this variation are unclear. To address this issue, we sequenced the OR repertoire in 332 individuals and examined the relationship between genetic variation and 276 olfactory phenotypes, including the perceived intensity and pleasantness of 68 odorants at two concentrations, detection thresholds of three odorants, and general olfactory acuity.
[Show full text]
Cellular and Molecular Signatures in the Disease Tissue of Early
Cellular and Molecular Signatures in the Disease Tissue of Early Rheumatoid Arthritis Stratify Clinical Response to csDMARD-Therapy and Predict Radiographic Progression Frances Humby1,* Myles Lewis1,* Nandhini Ramamoorthi2, Jason Hackney3, Michael Barnes1, Michele Bombardieri1, Francesca Setiadi2, Stephen Kelly1, Fabiola Bene1, Maria di Cicco1, Sudeh Riahi1, Vidalba Rocher-Ros1, Nora Ng1, Ilias Lazorou1, Rebecca E. Hands1, Desiree van der Heijde4, Robert Landewé5, Annette van der Helm-van Mil4, Alberto Cauli6, Iain B. McInnes7, Christopher D. Buckley8, Ernest Choy9, Peter Taylor10, Michael J. Townsend2 & Costantino Pitzalis1 1Centre for Experimental Medicine and Rheumatology, William Harvey Research Institute, Barts and The London School of Medicine and Dentistry, Queen Mary University of London, Charterhouse Square, London EC1M 6BQ, UK. Departments of 2Biomarker Discovery OMNI, 3Bioinformatics and Computational Biology, Genentech Research and Early Development, South San Francisco, California 94080 USA 4Department of Rheumatology, Leiden University Medical Center, The Netherlands 5Department of Clinical Immunology & Rheumatology, Amsterdam Rheumatology & Immunology Center, Amsterdam, The Netherlands 6Rheumatology Unit, Department of Medical Sciences, Policlinico of the University of Cagliari, Cagliari, Italy 7Institute of Infection, Immunity and Inflammation, University of Glasgow, Glasgow G12 8TA, UK 8Rheumatology Research Group, Institute of Inflammation and Ageing (IIA), University of Birmingham, Birmingham B15 2WB, UK 9Institute of
[Show full text]
Sean Raspet – Molecules
1. Commercial name: Fructaplex© IUPAC Name: 2-(3,3-dimethylcyclohexyl)-2,5,5-trimethyl-1,3-dioxane SMILES: CC1(C)CCCC(C1)C2(C)OCC(C)(C)CO2 Molecular weight: 240.39 g/mol Volume (cubic Angstroems): 258.88 Atoms number (non-hydrogen): 17 miLogP: 4.43 Structure: Biological Properties: Predicted Druglikenessi: GPCR ligand -0.23 Ion channel modulator -0.03 Kinase inhibitor -0.6 Nuclear receptor ligand 0.15 Protease inhibitor -0.28 Enzyme inhibitor 0.15 Commercial name: Fructaplex© IUPAC Name: 2-(3,3-dimethylcyclohexyl)-2,5,5-trimethyl-1,3-dioxane SMILES: CC1(C)CCCC(C1)C2(C)OCC(C)(C)CO2 Predicted Olfactory Receptor Activityii: OR2L13 83.715% OR1G1 82.761% OR10J5 80.569% OR2W1 78.180% OR7A2 77.696% 2. Commercial name: Sylvoxime© IUPAC Name: N-[4-(1-ethoxyethenyl)-3,3,5,5tetramethylcyclohexylidene]hydroxylamine SMILES: CCOC(=C)C1C(C)(C)CC(CC1(C)C)=NO Molecular weight: 239.36 Volume (cubic Angstroems): 252.83 Atoms number (non-hydrogen): 17 miLogP: 4.33 Structure: Biological Properties: Predicted Druglikeness: GPCR ligand -0.6 Ion channel modulator -0.41 Kinase inhibitor -0.93 Nuclear receptor ligand -0.17 Protease inhibitor -0.39 Enzyme inhibitor 0.01 Commercial name: Sylvoxime© IUPAC Name: N-[4-(1-ethoxyethenyl)-3,3,5,5tetramethylcyclohexylidene]hydroxylamine SMILES: CCOC(=C)C1C(C)(C)CC(CC1(C)C)=NO Predicted Olfactory Receptor Activity: OR52D1 71.900% OR1G1 70.394% 0R52I2 70.392% OR52I1 70.390% OR2Y1 70.378% 3. Commercial name: Hyperflor© IUPAC Name: 2-benzyl-1,3-dioxan-5-one SMILES: O=C1COC(CC2=CC=CC=C2)OC1 Molecular weight: 192.21 g/mol Volume
[Show full text]
Screening of Ancestral Polymorphisms for Immune Response Genes
Screening of Ancestral Polymorphisms for Immune Response Genes vorgelegt von Diplom-Ingenieur Sven M. Dillenburger aus Berlin von der Fakultät III - Prozesswissenschaften der Technischen Universität Berlin zur Erlangung des akademischen Grades Doktor der Ingenieurwissenschaften - Dr.-Ing. - genehmigte Dissertation Promotionsauschuss: Vorsitzender: Prof. Dr. rer. nat. R. Lauster Berichter: Prof. Dipl-Ing. Dr. U. Stahl Berichter: Dr. T. D. Taylor Tag der wissenschaftlichen Aussprache: 20. Dezember 2007 Berlin 2008 D 83 1 Abbreviations and Glossary Allele Allele is used for two or more alternative forms of a gene resulting in different gene products and thus different phenotypes. An organism is homozygous for a gene if the alleles are identical, and heterozygous if they are different. Adenine (A) A purine base (nitrogenous base) and constituent of nucleotides and as such one member of the base pair A-T (adenine-thymine) in DNA and A-U (adenine-uracil) in RNA. Annotation The process of attaching biological information to DNA sequences. It consists of two procedures: 1. identifying elements in a genome, and 2. attaching biological information (ORFs and their localization, gene structure, coding regions, location of regulatory motifs, etc) to these elements. Automatic annotation tools (e.g. Ensembl) try to perform every step of this by computer analysis, as opposed to manual annotation, which involves human expertise. Alignment The process of lining up two or more sequences to achieve maximal levels of identity (and conservation, in the case of amino acid sequences) for the purpose of assessing the degree of similarity and the presence of homology. 2 BAC clone Bacterial artificial chromosome vector which carries a genomic DNA insert.
[Show full text]
Clinical, Molecular, and Immune Analysis of Dabrafenib-Trametinib
Supplementary Online Content Chen G, McQuade JL, Panka DJ, et al. Clinical, molecular and immune analysis of dabrafenib-trametinib combination treatment for metastatic melanoma that progressed during BRAF inhibitor monotherapy: a phase 2 clinical trial. JAMA Oncology. Published online April 28, 2016. doi:10.1001/jamaoncol.2016.0509. eMethods. eReferences. eTable 1. Clinical efficacy eTable 2. Adverse events eTable 3. Correlation of baseline patient characteristics with treatment outcomes eTable 4. Patient responses and baseline IHC results eFigure 1. Kaplan-Meier analysis of overall survival eFigure 2. Correlation between IHC and RNAseq results eFigure 3. pPRAS40 expression and PFS eFigure 4. Baseline and treatment-induced changes in immune infiltrates eFigure 5. PD-L1 expression eTable 5. Nonsynonymous mutations detected by WES in baseline tumors This supplementary material has been provided by the authors to give readers additional information about their work. © 2016 American Medical Association. All rights reserved. Downloaded From: https://jamanetwork.com/ on 09/30/2021 eMethods Whole exome sequencing Whole exome capture libraries for both tumor and normal samples were constructed using 100ng genomic DNA input and following the protocol as described by Fisher et al.,3 with the following adapter modification: Illumina paired end adapters were replaced with palindromic forked adapters with unique 8 base index sequences embedded within the adapter. In-solution hybrid selection was performed using the Illumina Rapid Capture Exome enrichment kit with 38Mb target territory (29Mb baited). The targeted region includes 98.3% of the intervals in the Refseq exome database. Dual-indexed libraries were pooled into groups of up to 96 samples prior to hybridization.
[Show full text]
Download File
Genetic regulation of pulmonary progenitor cell differentiation Maria R. Stupnikov Submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Graduate School of Arts and Sciences COLUMBIA UNIVERSITY 2019 © 2019 Maria R. Stupnikov All rights reserved ABSTRACT Genetic regulation of pulmonary progenitor cell differentiation Maria R. Stupnikov The respiratory system represents a major interface between the body and the external environment. Its design includes a tree-like network of conducting tubules (airways) that carries air to millions of alveoli, where gas exchange occurs. The conducting airways are characterized by their great diversity in epithelial cell types with multiple populations of secretory, multiciliated, and neuroendocrine cells. How these different cell types arise and how these populations are balanced are questions still not well understood. Aberrant patterns of airway epithelial differentiation have been described in various human pulmonary diseases, chronic bronchitis, asthma, neuroendocrine hyperplasia of infancy, and others. The goal of this thesis is to investigate mechanisms of regulation of airway epithelial cell fate in the developing lung epithelium. More specifically, these studies focus on Notch signaling and address a long unresolved issue whether the different Notch ligands (Jagged and Delta) have distinct roles in the epithelial differentiation program of the extrapulmonary and intrapulmonary airways. Moreover, these studies investigate the ontogeny of the bHLH transcription factor Ascl1 and identify its targets in the developing airways as potential regulators of neuroepithelial body (NEB) size and maturation. My studies provide evidence that the Notch ligand families Jag and Dll are required for the specification and formation of different cell lineages in the developing airway epithelia.
[Show full text]
A Competitive Binding Model Predicts Nonlinear Responses of Olfactory Receptors to Complex Mixtures Vijay Singha,B, Nicolle R
A competitive binding model predicts nonlinear responses of olfactory receptors to complex mixtures Vijay Singha,b, Nicolle R. Murphyc, Vijay Balasubramaniana,b,1,2, and Joel D. Mainlandc,d,2 aComputational Neuroscience Initiative, University of Pennsylvania, Philadelphia, PA, 19104, USA; bDepartment of Physics, University of Pennsylvania, Philadelphia, PA, 19104, USA; cMonell Chemical Senses Center, Philadelphia, PA, 19104, USA; dDepartment of Neuroscience, University of Pennsylvania, Philadelphia, PA, 19104, USA In color vision, the quantitative rules for mixing lights to make a tar- namely competition between molecules for the binding site, can get color are well understood. By contrast, the rules for mixing odor- successfully predict the responses of many mammalian odor ants to make a target odor remain elusive. A solution to this prob- receptors to complex molecular mixtures. Previously, Rospars lem in vision relied on characterizing receptor responses to differ- et al. (2008) (9) found that responses of olfactory receptor ent wavelengths of light and subsequently relating these responses neurons to some simple binary mixtures were largely consis- to perception. In olfaction, experimentally measuring receptor re- tent with a similar model, and could display both hyper- and sponses to a representative set of complex mixtures is intractable hypo-additivity. Related results for binary mixtures have also due to the vast number of possibilities. To meet this challenge, we been reported for neurons in the accessory olfactory system develop a biophysical model that predicts mammalian receptor re- (10), and in the antennal lobes of Drosophila (11) and locust sponses to complex mixtures using responses to single odorants. (12). Cruz and Lowe (2013) (13) subsequently developed a The dominant nonlinearity in our model is competitive binding (CB): biophysically motivated version of this model and applied it only one odorant molecule can attach to a receptor binding site at to glomerular imaging.
[Show full text]
Shared Genetics of Asthma and Mental Health Disorders: a Large-Scale Genome- Wide Cross-Trait Analysis
ORIGINAL ARTICLE ASTHMA Shared genetics of asthma and mental health disorders: a large-scale genome- wide cross-trait analysis Zhaozhong Zhu1,2,3, Xi Zhu4, Cong-Lin Liu5, Huwenbo Shi1, Sipeng Shen3, Yunqi Yang1, Kohei Hasegawa2, Carlos A. Camargo Jr 1,2 and Liming Liang1,6 Affiliations: 1Program in Genetic Epidemiology and Statistical Genetics, Dept of Epidemiology, Harvard T.H. Chan School of Public Health, Boston, MA, USA. 2Dept of Emergency Medicine, Massachusetts General Hospital, Harvard Medical School, Boston, MA, USA. 3Dept of Environmental Health, Harvard T.H. Chan School of Public Health, Boston, MA, USA. 4Dept of Critical Care Medicine, Peking University Third Hospital, Beijing, China. 5Dept of Medicine, Brigham and Women’s Hospital and Harvard Medical School, Boston, MA, USA. 6Dept of Biostatistics, Harvard T.H. Chan School of Public Health, Boston, MA, USA. Correspondence: Zhaozhong Zhu, Depts of Epidemiology and Environmental Health, Harvard T.H. Chan School of Public Health and Dept of Emergency Medicine, Massachusetts General Hospital, Harvard Medical School, 665 Huntington Avenue, Building 1, 1406C, Boston, MA 02115, USA. E-mail: [email protected] @ERSpublications This study discovered shared genetic components between asthma and ADHD, anxiety and depression. The shared pathways and potential causal effects from mental disorders to asthma highlight a healthcare focus among patients with these disorders. http://bit.ly/2MsALoa Cite this article as: Zhu Z, Zhu X, Liu C-L, et al. Shared genetics of asthma and mental health disorders: a large-scale genome-wide cross-trait analysis. Eur Respir J 2019; 54: 1901507 [https://doi.org/10.1183/ 13993003.01507-2019].
[Show full text]
Influence of Gene Modification in Biological Behaviors and Responses of Mouse Lung Telocytes to Inflammation
Song et al. J Transl Med (2019) 17:158 https://doi.org/10.1186/s12967-019-1870-y Journal of Translational Medicine RESEARCH Open Access Infuence of gene modifcation in biological behaviors and responses of mouse lung telocytes to infammation Dongli Song1†, Menglin Xu1†, Ruixue Qi1†, Ruihua Ma1, Yile Zhou1, Duojiao Wu1,2*, Hao Fang3,4* and Xiangdong Wang1,2* Abstract Background: Telocytes play key roles in maintenance of organ/tissue function and prevention of organ injury. However, there are great challenges to investigate telocytes functions using primary telocytes, due to the difculties of isolation, identifcation, and stability. The present study aims at constructing continuous cell strain of mouse lung telocyte cell line with stable characters by gene modifcation and investigating biological behaviors and responses of gene-modifed telocytes to infammation. Methods: Mouse primary lung telocytes were isolated and identifed using immune-labeling markers and immuno- electron microscopy. Primary telocytes were transformed with Simian vacuolating virus 40 small and large T antigen (SV40). Biological characters, behaviors morphology, and proliferation of those gene-modifed telocytes were defned and monitored dynamically for 50 generations, as compared with primary lung telocytes. Cell cycle of mouse primary lung telocytes or gene-modifed telocytes was detected by fow cytometry. Results: Gene modifed telocytes of generations 5, 10, 30 and 50 were observed with telopodes and also showed CD34 and ckit positive. Multiple cellular morphology were also observed on telocyte cell-line under monitor of celliq and enhanced cell proliferation were showed. SV40 transduction was also reduced apoptosis and increased the ratio of S and G2 phases in telocyte cell-line.
[Show full text]
Explorations in Olfactory Receptor Structure and Function by Jianghai
Explorations in Olfactory Receptor Structure and Function by Jianghai Ho Department of Neurobiology Duke University Date:_______________________ Approved: ___________________________ Hiroaki Matsunami, Supervisor ___________________________ Jorg Grandl, Chair ___________________________ Marc Caron ___________________________ Sid Simon ___________________________ [Committee Member Name] Dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Department of Neurobiology in the Graduate School of Duke University 2014 ABSTRACT Explorations in Olfactory Receptor Structure and Function by Jianghai Ho Department of Neurobiology Duke University Date:_______________________ Approved: ___________________________ Hiroaki Matsunami, Supervisor ___________________________ Jorg Grandl, Chair ___________________________ Marc Caron ___________________________ Sid Simon ___________________________ [Committee Member Name] An abstract of a dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Department of Neurobiology in the Graduate School of Duke University 2014 Copyright by Jianghai Ho 2014 Abstract Olfaction is one of the most primitive of our senses, and the olfactory receptors that mediate this very important chemical sense comprise the largest family of genes in the mammalian genome. It is therefore surprising that we understand so little of how olfactory receptors work. In particular we have a poor idea of what chemicals are detected by most of the olfactory receptors in the genome, and for those receptors which we have paired with ligands, we know relatively little about how the structure of these ligands can either activate or inhibit the activation of these receptors. Furthermore the large repertoire of olfactory receptors, which belong to the G protein coupled receptor (GPCR) superfamily, can serve as a model to contribute to our broader understanding of GPCR-ligand binding, especially since GPCRs are important pharmaceutical targets.
[Show full text]
Online Supporting Information S2: Proteins in Each Negative Pathway
Online Supporting Information S2: Proteins in each negative pathway Index Proteins ADO,ACTA1,DEGS2,EPHA3,EPHB4,EPHX2,EPOR,EREG,FTH1,GAD1,HTR6, IGF1R,KIR2DL4,NCR3,NME7,NOTCH1,OR10S1,OR2T33,OR56B4,OR7A10, Negative_1 OR8G1,PDGFC,PLCZ1,PROC,PRPS2,PTAFR,SGPP2,STMN1,VDAC3,ATP6V0 A1,MAPKAPK2 DCC,IDS,VTN,ACTN2,AKR1B10,CACNA1A,CHIA,DAAM2,FUT5,GCLM,GNAZ Negative_2 ,ITPA,NEU4,NTF3,OR10A3,PAPSS1,PARD3,PLOD1,RGS3,SCLY,SHC1,TN FRSF4,TP53 Negative_3 DAO,CACNA1D,HMGCS2,LAMB4,OR56A3,PRKCQ,SLC25A5 IL5,LHB,PGD,ADCY3,ALDH1A3,ATP13A2,BUB3,CD244,CYFIP2,EPHX2,F CER1G,FGD1,FGF4,FZD9,HSD17B7,IL6R,ITGAV,LEFTY1,LIPG,MAN1C1, Negative_4 MPDZ,PGM1,PGM3,PIGM,PLD1,PPP3CC,TBXAS1,TKTL2,TPH2,YWHAQ,PPP 1R12A HK2,MOS,TKT,TNN,B3GALT4,B3GAT3,CASP7,CDH1,CYFIP1,EFNA5,EXTL 1,FCGR3B,FGF20,GSTA5,GUK1,HSD3B7,ITGB4,MCM6,MYH3,NOD1,OR10H Negative_5 1,OR1C1,OR1E1,OR4C11,OR56A3,PPA1,PRKAA1,PRKAB2,RDH5,SLC27A1 ,SLC2A4,SMPD2,STK36,THBS1,SERPINC1 TNR,ATP5A1,CNGB1,CX3CL1,DEGS1,DNMT3B,EFNB2,FMO2,GUCY1B3,JAG Negative_6 2,LARS2,NUMB,PCCB,PGAM1,PLA2G1B,PLOD2,PRDX6,PRPS1,RFXANK FER,MVD,PAH,ACTC1,ADCY4,ADCY8,CBR3,CLDN16,CPT1A,DDOST,DDX56 ,DKK1,EFNB1,EPHA8,FCGR3A,GLS2,GSTM1,GZMB,HADHA,IL13RA2,KIR2 Negative_7 DS4,KLRK1,LAMB4,LGMN,MAGI1,NUDT2,OR13A1,OR1I1,OR4D11,OR4X2, OR6K2,OR8B4,OXCT1,PIK3R4,PPM1A,PRKAG3,SELP,SPHK2,SUCLG1,TAS 1R2,TAS1R3,THY1,TUBA1C,ZIC2,AASDHPPT,SERPIND1 MTR,ACAT2,ADCY2,ATP5D,BMPR1A,CACNA1E,CD38,CYP2A7,DDIT4,EXTL Negative_8 1,FCER1G,FGD3,FZD5,ITGAM,MAPK8,NR4A1,OR10V1,OR4F17,OR52D1,O R8J3,PLD1,PPA1,PSEN2,SKP1,TACR3,VNN1,CTNNBIP1 APAF1,APOA1,CARD11,CCDC6,CSF3R,CYP4F2,DAPK1,FLOT1,GSTM1,IL2
[Show full text]
Copper-Mediated Thiol Potentiation and Mutagenesis-Guided Modeling Suggest a Highly Conserved… 2159
Cellular and Molecular Life Sciences (2020) 77:2157–2179 https://doi.org/10.1007/s00018-019-03279-y Cellular andMolecular Life Sciences ORIGINAL ARTICLE Copper‑mediated thiol potentiation and mutagenesis‑guided modeling suggest a highly conserved copper‑binding motif in human OR2M3 Franziska Haag1 · Lucky Ahmed2 · Krystle Reiss2 · Eric Block3 · Victor S. Batista2 · Dietmar Krautwurst1 Received: 5 November 2018 / Revised: 7 August 2019 / Accepted: 12 August 2019 / Published online: 21 August 2019 © The Author(s) 2019 Abstract Sulfur-containing compounds within a physiological relevant, natural odor space, such as the key food odorants, typi- cally constitute the group of volatiles with the lowest odor thresholds. The observation that certain metals, such as copper, potentiate the smell of sulfur-containing, metal-coordinating odorants led to the hypothesis that their cognate receptors are metalloproteins. However, experimental evidence is sparse—so far, only one human odorant receptor, OR2T11, and a few mouse receptors, have been reported to be activated by sulfur-containing odorants in a copper-dependent way, while the activation of other receptors by sulfur-containing odorants did not depend on the presence of metals. Here we identifed an evolutionary conserved putative copper interaction motif CC/CSSH, comprising two copper-binding sites in TMH5 and TMH6, together with the binding pocket for 3-mercapto-2-methylpentan-1-ol in the narrowly tuned human receptor OR2M3. To characterize the copper-binding motif, we combined homology modeling, docking studies, site-directed mutagenesis, and functional expression of recombinant ORs in a cell-based, real-time luminescence assay. Ligand activation of OR2M3 was potentiated in the presence of copper.
[Show full text]