OR2W1 (Human) Recombinant Entrez GeneID: 26692 Protein Gene Symbol: OR2W1 Catalog Number: H00026692-G01 Gene Alias: MGC119162, MGC119163, MGC119165, hs6M1-15 Regulation Status: For research use only (RUO) Gene Summary: Olfactory receptors interact with Product Description: Human OR2W1 full-length ORF odorant molecules in the nose, to initiate a neuronal (NP_112165.1) recombinant protein without tag. response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family Sequence: of G-protein-coupled receptors (GPCR) arising from MDQSNYSSLHGFILLGFSNHPKMEMILSGVVAIFYLITL single coding-exon genes. Olfactory receptors share a VGNTAIILASLLDSQLHTPMYFFLRNLSFLDLCFTTSIIP 7-transmembrane domain structure with many QMLVNLWGPDKTISYVGCIIQLYVYMWLGSVECLLLAV neurotransmitter and hormone receptors and are MSYDRFTAICKPLHYFVVMNPHLCLKMIIMIWSISLANS responsible for the recognition and G protein-mediated VVLCTLTLNLPTCGNNILDHFLCELPALVKIACVDTTTV transduction of odorant signals. The olfactory receptor EMSVFALGIIIVLTPLILILISYGYIAKAVLRTKSKASQRKA gene family is the largest in the genome. The MNTCGSHLTVVSMFYGTIIYMYLQPGNRASKDQGKFL nomenclature assigned to the olfactory receptor genes TLFYTVITPSLNPLIYTLRNKDMKDALKKLMRFHHKSTK and proteins for this organism is independent of other IKRNCKS organisms. [provided by RefSeq] Host: Wheat Germ (in vitro) Theoretical MW (kDa): 36.1 Applications: AP (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Form: Liquid Preparation Method: in vitro wheat germ expression system with proprietary liposome technology Purification: None Recommend Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Page 1/1 Powered by TCPDF (www.tcpdf.org).
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages1 Page
-
File Size-