Technische Universität München Department of Mechanical Engineering
Mechanical Engineering Annual Report Imprint
Technische Universität München Department of Mechanical Engineering Boltzmannstraße 15 85748 Garching near Munich Germany www.mw.tum.de
Editor: Prof. Dr. Tim C. Lüth, Dean Sub-editor: Dr. Till v. Feilitzsch Layout: Fa-Ro Marketing, Munich Photo credits: Uli Benz, Thomas Bergmann, Astrid Eckert, Kurt Fuchs, Andreas Gebert, Haslbeck, Andreas Heddergott, Mittermüller Bildbetrieb, Wotan Wilden and further illustrations by the institutes
March 2015 Technische Universität München Department of Mechanical Engineering
Mechanical Engineering Annual Report 2013-2014 Content
Preamble 6 TUM Department of Mechanical Engineering 7 Department Board of Management 8 Teaching 10 Research 11 Ranking Results 12 Facts and Figures 13 Projects and Clusters 14 Divisions of the Department of Mechanical Engineering 16 Faculty Graduate Center Mechanical Engineering 26 Center of Key Competences 27 Elected Representatives 28 Faculty Members 29
Prof. Dr.-Ing. Nikolaus Adams Institute of Aerodynamics and Fluid Mechanics 36 Prof. Dr.-Ing. Horst Baier Institute of Lightweight Structures 45 Prof. Dr. Klaus Bengler Institute of Ergonomics 49 Prof. Dr. Sonja Berensmeier Bioseparation Engineering Group 55 Prof. Dr. Carlo L. Bottasso Wind Energy Institute 58 Prof. Dr.-Ing. Klaus Drechsler Institute for Carbon Composites 63 Prof. Dr.-Ing. Michael W. Gee Mechanics & High Performance Computing Group 68 Prof. Dr.-Ing. habil. Dipl.-Geophys. Christian Große Institute of Non-destructive Testing 72 Prof. Dr.-Ing. Willibald A. Günthner Institute for Materials Handling, Material Flow, Logistics 75 Prof. Dr.-Ing. Oskar J. Haidn Institute of Flight Propulsion 84 Prof. Dr.-Ing. Oskar J. Haidn Space Propulsion Group 90 Prof. Dr.-Ing. Manfred Hajek Institute for Helicopter Technology 94 Prof. Dr.-Ing. Florian Holzapfel Institute of Flight System Dynamics 97 Prof. Dr.-Ing. Mirko Hornung Institute of Aircraft Design 105 Prof. Dr.-Ing. Hans-Jakob Kaltenbach Flow control and Aeroacoustics Group 110 Prof. Dr.-Ing. Harald Klein Institute of Plant and Process Technology 112 Prof. Phaedon-Stelios Koutsourelakis, Ph.D. Continuum Mechanics Group 116 Prof. Dr.-Ing. Andreas Kremling Systems Biotechnology Group 119
4 Content Prof. Dr. Oliver Lieleg Biomechanics Group 122 Prof. Dr.-Ing. Markus Lienkamp Institute of Automotive Technology 125 Prof. Dr.-Ing. Udo Lindemann Institute of Product Development 131 Prof. Dr.-Ing. Boris Lohmann Institute of Automatic Control 137 Prof. Dr. Tim C. Lüth Institute of Micro Technology and Medical Device Technology 142 Prof. Rafael Macian-Juan, Ph.D. Institute of Nuclear Engineering 149 Prof. Dr. Rudolf Neu Plasma Material Interaction Group 154 Prof. Wolfgang Polifke, Ph.D. Thermo-Fluid Dynamics Group 158 Prof. Dr. Julien Provost Assistant Professorship of Safe Embedded Systems 162 Prof. Dr.-Ing. Gunther Reinhart Institute for Industrial Management and Assembly Technologies 164 Prof. Dr. Ir. Daniel Rixen Institute of Applied Mechanics 169 Prof. Dr.-Ing. Thomas Sattelmayer Institute of Thermodynamics 174 Prof. Dr.-Ing. Veit Senner Sport Equipment and Materials Group 180 Prof. Dr.-Ing. Hartmut Spliethoff Institute for Energy Systems 183 Prof. Dr.-Ing. Karsten Stahl Institute of Machine Elements 188 Prof. Dr.-Ing. Birgit Vogel-Heuser Institute of Automation and Information Systems 198 Prof. Dr.-Ing. Wolfram Volk Institute of Metal Forming and Casting 206 Prof. Dr.-Ing. Georg Wachtmeister Institute of Internal Combustion Engines 211 Prof. Dr.-Ing. Wolfgang A. Wall Institute of Computational Mechanics 217 Prof. Dr. Ulrich Walter Institute of Astronautics 223 Prof. Dr. Ewald Werner Institute of Materials Science and Mechanics of Materials 229 Prof. Dr.-Ing. Dirk Weuster-Botz Institute of Biochemical Engineering 234 Prof. Dr. Dr.-Ing. Erich Wintermantel Institute of Medical and Polymer Engineering 239 Prof. Dr.-Ing. Michael F. Zaeh Institute for Machine Tools and Manufacturing Technology 243
Appendix 249
Content 5 Preamble
Dear Reader,
The Department of Mechanical Engineer- systems to the optimization of production KPIJCUEJCPIGFUKIPKƄECPVN[FWTKPI systems. Despite very diverse approach- recent years: GUVJGEQOOQPIQCNKUVQƄPFVGEJPKECN ■ Its project volume has almost tripled solutions for the challenges of our society: YKVJKPNGUUVJCPCFGECFGYKVJCUKIPKƄ- cant simultaneous shift towards public ■ Climate Change and Shortage of research funding e.g. through the DFG Resources and federal ministries. We work on new mobility concepts, ■ The department sets standards in production processes, which are VGTOUQHUEKGPVKƄEETGFKDKNKV[ YG JKIJN[GPGTI[CPFOCVGTKCNGHƄEKGPV have committed ourselves to accept development and usage scenarios for contributions in peer-reviewed journals novel, ultra light and strong materials sCMG[KPFKECVQTHQTUEKGPVKƄEUWEEGUU as well as both the development of CEQWTUGQPIQQFUEKGPVKƄERTCEVKEG JKIJN[GHƄEKGPVEQODWUVKQPRNCPVUCPF and academic integrity is mandatory renewable energies. for all doctoral candidates. The result ■ Demographic Change is far more than 4000 citations in top We study usage habits and develop UEKGPVKƄELQWTPCNUCPFVQRRQUKVKQPUKP robots and assistance systems e.g. for international research rankings. car and production environments as ■ Students, staff and faculty members well as medical devices and support of the department became much more systems for the elderly. diverse: 17% international students ■ Urbanization UKPEG HGOCNG #RRTQZCSWCTVGTQHVJGUEKGPVKƄEUVCHH UEKGPVKƄEUVCHH UKPEG works on projects related to safe and 12% international professors GHƄEKGPVITQWPFOQDKNKV[PQYVQCNCTIG (+100% since 2011). extent focused on the development of small vehicles with very low fuel This success allowed us to attract excel- consumption or new types of propul- lent new colleagues: sion units, and possible new types of ■ Prof. Bottasso (from Politecnico di ownership (car sharing etc.). Milano, 2013): newly founded Institute of Wind Energy With this brochure, we present an over- ■ Prof. Koutsourelakis (from Cornell view of the research at the department’s University, 2012): new Continuum institutes. We hope that it helps our Mechanics Group RCTVPGTUKPCECFGOKCCPFKPFWUVT[VQƄPF ■ Prof. Provost (from Chalmers University experts for their issues, prospective stu- of Technology, 2013): Assistant Profes- dents and junior researchers to identify the sorship for Safe Embedded Systems supervisor that suits best her/his interests ■ Prof. Neu (from Max Planck Insitute of and – last but not least – ourselves, the Plasma Physics, 2013): Plasma Material collegues and partners of this department, Interaction Group to learn even better about our research and teaching activities. However, one aspect has remained constant throughout the years: the TUM Department of Mechanical Engineering covers a very large variety of topics, both Prof. Dr. Tim C. Lüth, Dean in teaching and research. They range from VJGFGUKIPQHGHƄEKGPVIGCTUVQUVWFKGUQP the usability of driver assistance systems, HTQOVJGFGUETKRVKQPQHOKETQƅWKFKE
6 Preamble TUM Department of Mechanical Engineering
The Department of Mechanical Engineer- 6JGFGRCTVOGPVDGPGƄVUHTQOCJKIJN[ ing of the Technische Universität München innovative environment in a prestigious has stood for engineering excellence since university and the Garching campus, one 1868. It was founded amongst others by of the largest and most modern rese- the pioneer of refrigeration Carl von Linde arch centers in Europe, as well as from and the well-known mathematician and powerful partners in industry with their materials scientist Johann Bauschinger. headquarters or research centers in and It has been the workplace of famous uni- around Munich. versity teachers such as Gustav Niemann, author of the most important authoritative Young talented people form the core of work on mechanical engineering scientist, the Technische Universität München. Inte- the mechanical engineering August Föppl grated into an environment of experienced and the thermodynamics researcher UEKGPVKƄERGTUQPCNKVKGUVJG[CTGUWRRQTVGF Wilhelm Nußelt. The lectures given by Carl to develop their performance and indivi- von Linde inspired Rudolf Diesel to make dual strengths. The educational objectives his groundbreaking inventions. Other are expertise, judgment and responsibility. important students of the faculty were the Mental and emotional creativity, cultural aircraft designers Claude Dornier and Willy sensibility and social skills are as import- Messerschmidt. ant as technical sovereignty and entre- preneurial courage. The most talented of Today, the Department of Mechanical VJGOCTGRTQOQVGFURGEKƄECNN[6QFC[ Engineering is one of the most successful about 5000 students are enrolled at the engineering faculties of the world. Leading &GRCTVOGPVQH/GEJCPKECN'PIKPGGTKPI international surveys rank the TUM CNOQUVQPGƄHVJCTGKPVGTPCVKQPCNUVWFGPVU Department of Mechanical Engineering from 32 countries. in the world’s top group. This success is RTKOCTKN[CTGUWNVQHRWDNKUJGFUEKGPVKƄE excellence, based on a balanced mix of publicly funded projects and industrial cooperation.
TUM Department of Mechanical Engineering 7 Department Board of Management
The Department of Mechanical Enginee- ■ The classic administrative duties of ring is headed by the Dean, two Vice running the department are the Deans and the Dean of Studies, elected by responsibility of the Deanery unit. It the faculty of the department every three is responsible for the Departmental years. In order to facilitate communication Board as well as managing established and to put decisions onto a broader base, positions and personnel matters. the current Dean, Prof. Tim Lueth, esta- ■ 6JG&GCPoU1HƄEGUWRRQTVUVJG&GCP blished in 2014 a Department Board of in the development of the department, Management, comprising the deans and including appointments, as well as its representatives of groups of professors, resource management. GCEJCUUKIPGFYKVJCURGEKƄERQTVHQNKQQH ■ 6JG#ECFGOKE2TQITCOOGU1HƄEGUWR- responsibilities. The Department Board ports the Dean of Studies in developing of Management acts as an advisor to the the curriculum and teaching, and is &GCP VJGTGURQPUKDKNKV[QHVJG&GRCTVOGP- responsible for any questions regarding tal Board (‘Fakultätsrat’) regarding formal student matters. The unit also provides academic matters remains untouched. consultation to students and services for the students’ organization. The deans are supported by the adminis- ■ 6JG'ZCOKPCVKQP1HƄEGKUTGURQPUKDNG tration of the Department, organized into for all questions relating to examination four units: matters, starting with the suitability assessment process for prospective students and internships through to examination administration.
8 Department Board of Management Dean Prof. Dr.-Ing. Michael W. Gee Science and Publications Prof. Dr. Tim C. Lüth Finances, Appointments, Internationalisation
Vice Dean Prof. Dr.-Ing. Mirko Hornung Buildings and Safety Prof. Dr.-Ing. Wolfram Volk Evaluation and Department Publicity
Vice Dean Prof. Dr.-Ing. Boris Lohmann Special Projects Prof. Dr. Klaus Bengler Special Projects TUM Graduate School
Dean of Studies Prof. Dr.-Ing. Hartmut Spliethoff Special Projects Prof. Dr. mont. habil. Dr. rer. nat. h. c. Ewald Werner Teaching Structure and Quality
Prof. Dr.-Ing. Nikolaus A. Adams Prof. Dr.-Ing. Michael Zaeh Third Party Funds Personnel Matters and Contracts Dean of Studies MSE
Department Administration
Dr. Till von Feilitzsch Dr. Thomas Wagner &GCPoU1HƄEG #ECFGOKE2TQITCOOGU1HƄEG
Dieter Grimm Dr. Edda Wenzig Deanery 'ZCOKPCVKQP1HƄEG
Department Board of Management 9 Teaching
The TUM Department of Mechanical CPKPFKXKFWCNN[FGƄPGFEQWTUGECVCNQIWG Engineering is one of Germany’s largest designed to establish a deeper academic training facilities for engineers. Interdis- understanding of the subject concerned. ciplinary programs with partners like the University of Salzburg and membership in The Department of Mechanical Engineer- the ‘TIME’ double degree program (with ing is extensively networked with all the École Centrale Paris, Escuela Técnica other TUM faculties. In particular, the Superior de Ingenieros Industriales de HCEWNV[oUFGFKECVKQPKUTGƅGEVGFKPKVU Madrid, KTH Royal Institute of Technology teacher training (led by the TUM School of CPFOCP[QVJGTU EQPƄTOQWTKPVGTPCVKQPCN Education), in the Bachelor’s and Master’s reputation. programs in ‘Chemical Engineering’ (led by the Faculty for Chemistry), in the The linkage of teaching and research Master’s program in ‘Power Engineering’ is the basis for our academic training. (led by the Department of Electrical and All professors at the faculty are proven Information Technology), in the Master’s GZRGTVUKPVJGKTƄGNFUCPFVJG[JGCF program in ‘Robotics, Cognition, Intelli- trend-setting research projects in the gence’ (led by the Faculty for Computer national and international arena. This way, Science) and in the Bachelor’s program VJGNCVGUVTGUGCTEJTGUWNVUCTGTGƅGEVGF in ‘General Engineering Sciences’, as in teaching, and our students are given well as the Master’s program in ‘Industrial many different opportunities to participate Biotechnology’ (in collaboration with the in projects, especially through semester Munich School of Engineering). On the and thesis projects. Together with the international level, the Department of joint Bachelor’s program in ‘Engineering Mechanical Engineering participates in Sciences’ and a Master’s program in the joint Master’s program in Aerospace ‘Materials Sciences’ with Paris-Lodron Engineering, a collaboration between the University Salzburg, it currently hosts Technische Universität München (TUM) 5000 students. The Bachelor’s programs and Nanyang Technological University have a common curriculum and schedule (NTU), Singapore at the German Institute up to the 4th semester. In the 5th and of Science and Technology (GIST) in 6th semesters, students specialize in one Singapore. of the ten subject areas with specialized classes and a Bachelor’s thesis. Each of the 10 Master’s programs is based on
10 Teaching Research
Engineers enable our society to maintain ■ Urbanization its high standard of living for present and At the TUM Faculty of Mechanical upcoming generations. Future challenges Engineering, approx. one quarter of the arise from three global mega-trends: UEKGPVKƄEUVCHHYQTMUQPRTQLGEVUTGNCVGF to ground mobility, now to a large ■ Climate Change and Shortage of extent working on the development Resources of small vehicles with very low fuel At the TUM Faculty of Mechanical consumption or new types of propul- Engineering, we are already working on sion units, and possible new types of new mobility concepts and production ownership (car sharing etc.). processes, which are highly energy and OCVGTKCNGHƄEKGPVVJGFGXGNQROGPVCPF The research strength of the TUM Faculty usage scenarios for novel, ultra light of Mechanical Engineering derives from a and/or strong materials, as well as the high degree of both vertical and horizontal FGXGNQROGPVQHJKIJN[GHƄEKGPVEQO- integration of research competencies. bustion plants and renewable energies. Typically, the institutes address the whole XCNWGEJCKPHTQOUEKGPVKƄEHQWPFCVKQPUWR ■ Demographic Change to application scenarios. The large size At the TUM Faculty of Mechanical of the institutes allows them to build up Engineering, we study usage habits and interdisciplinary teams. develop robots and assistance systems e.g. for car and production environ- ments as well as medical devices and support systems for the elderly.
Research 11 Ranking Results
The Department of Mechanical Engineer- THE World University Ranking ing is now one of the most successful faculties of its kind worldwide and has The Times Higher Education Ranking occupied top places in the main research evaluates universities in their specialist rankings for the past several years. The areas according to their teaching and basis of this success is the publication of research performance, based primarily MG[UEKGPVKƄECEJKGXGOGPVUEQORTKUKPI on citations, teaching indicators and a balanced mix of both state and industry research volume. According to this promoted projects. ranking the TUM occupies the top place among German universities specialising in engineering science. QS World University Ranking by Subject Placement Engineering Sciences Wordwide: The QS World University Ranking by TUM Engineering Sciences: 28 (2014/15) Subject evaluates universities according Previous Years: to their academic reputation, employer 26 (2013-14), >50 (2012-13), reputation, number of citations per 43 (2011-12), >50 (2010-11). publication and h-index. In the past years our department has been placed among the top departments in Europe. Taiwan Ranking
Placement Worldwide for Mechanical The National Taiwan University Ranking Engineering: is based exclusively on the number of TUM Mech. Eng.: 30 (2014) publications, citations and h-indexes – Previous Years: primarily from the past decade. It therefore 23 (2013), 33 (2012), 36 (2011). reacts very slowly to the process of EJCPIG'XCNWCVKQPKUUWDLGEVURGEKƄE meaning that parts of the Department U-Multirank of Mechanical Engineering are not assessed (e.g. process technology and The new international university ranking materials science). The TUM Department system U-Multirank compares universities of Mechanical Engineering is especially and subjects using over 30 different strong regarding highly cited publications criteria but does not compile a compre- (rank 45). hensive ranking list. When considering the relevant teaching and research metrics of Placement Mechanical Engineering universities worldwide, the TUM Depart- worldwide: ment of Mechanical Engineering occupies TUM Mechanical Engineering: 68 (2014) top places among those conferring Previous years: 64 (2013), 78 (2012), doctorates. 118 (2011).
12 Ranking Results Facts and Figures
Staff
Full professors 32 Associate professors 11 Staff (total) 1200 Researchers 900 (including doctoral candidates, provided they are employed)
Students
Total 5000 Bachelor 2600 students total (6 semester programme) 750 freshmen per year 500 graduations per year Master 2400 students total (4 semester programme) 700 freshmen per year 650 graduations per year
Doctoral Programme
Candidates 900 Defenses 165 2014
Funding
State budget 4 M € incl. 2 M € tuition funds State positions 20 M € equiv. Acquired research funding 48 M a /aKP 22 M € Public sources 26 M € Private sources (thereof about 50% each direct cooperation and consortia) 700 externally funded research projects
Research Output
Publications 185 2014 (based on Scopus and ISI WoS) Citations 4428 2014 (based on Scopus and ISI WoS) Patents 21 Start-ups 31 last 10 years
Space
Total 60,000 sq.m. 1HƄEGURCEG 20,000 sq.m. Lab and workshop 30,000 sq.m.
Facts and Figures 13 Projects and Clusters
Collaborative Research Projects
Institutes and specialist groups at the SFB 863: Forces in Biomolecular Department of Mechanical Engineering are Systems participants in the following collaborative research projects: Spokesperson: Prof. Dr. Matthias Rief Technische Universität München Special Research Areas Department of Physics Institute of Biophysics SFB 768: Managing Cycles in Innovation Processes - Integrated Development Active since 2010 of Product-Service Systems based on Technical Products SFB 1032: Nanoagents for Spokesperson: Spatiotemporal Control of Molecular Prof. Dr.-Ing. Birgit Vogel-Heuser and Cellular Reactions Technische Universität München Department of Mechanical Engineering Spokesperson: Institute of Automation and Information Professor Dr. Joachim Rädler Systems Ludwig-Maximilians-Universität München Department of Physics Active since 2008 Institute of Experimental Physics, Solid State Physics
SFB TR40: Technological Foundations Active since 2012 for the Design of Thermally and Mechanically Highly Loaded Components for Future Space DFG Focus Programmes Transport Systems SPP 1276: MetStröm: Scale- Spokesperson: Independent Modelling in Flow Prof. Dr.-Ing. Nikolaus Adams Mechanics and Meterology Technische Universität München Department of Mechanical Engineering Coordinator: Institute of Aerodynamics and Fluid Prof. Dr.-Ing. Rupert Klein Mechanics Free University of Berlin Mathematics and Informatics Active since 2008
522 4GUQWTEG'HƄEKGPV5VTWEVWTCN SFB TR10: Integration of Forming, Elements Separation and Joining for the Flexible Manufacture of Lightweight Load- Coordinator: Bearing Structures Prof. Dr.-Ing. B.-R. Höhn Technische Universität München Spokesperson: Department of Mechanical Engineering Prof. Dr.-Ing. A. Erman Tekkaya Institute of Machine Elements Technical University of Dortmund Department of Forming Technology and Active since 2011 Lightweight Construction
Active since 2003
14 Projects and Clusters EU Projects (coordinated)
SPP 1593: Design for Future – Managed Aero-Sim: Development of a Selective Software Evolution Laser Melting Simulation Tool for Aero Engine applications Coordinator: Prof. Dr. Ursula Goltz Coordinator: Technical University of Braunschweig Prof. Dr.-Ing. Michael F. Zaeh Institute for Programming and Reactive Technische Universität München Systems Institute of Machine Tools and Manufactur - ing Technology www.iwb.tum.de/aerosim SPP 1748: Reliable Simulation Techniques in Solid Mechanics. Development of Non-standard ATHENAI: Aerodynamic Testing of Discretisation Methods, Mechanical Helicopter Novel Air Intakes and Mathematical Analysis Coordinator: Coordinator: Apl. Prof. Dr. Christian Breitsamter Prof. Dr.-Ing. Jörg Schröder Technische Universität München University of Duisburg-Essen Institute of Aerodynamics and Fluid Institute of Mechanics Mechanics www.athenai.tum.de
DFG Research Training Group HealCON: Self-healing Materials for GRK 1095: Aero-thermodynamic Design Prolonged Lifetime of a Scramjet – Propulsion Systems for Future Space Transport Systems Coordinator: Prof. Dr. Christian Große Spokesperson: Technische Universität München Prof. Dr.-Ing. Bernhard Weigand Institute of Non-Destructive Testing University of Stuttgart www.healcon.eu Institute of Thermodynamics for Aerospace MORPHELLE: Morphing Enabling Technologies for Propulsion System Nacelles
Coordinator: Prof. Horst Baier Technische Universität München Institute of Lightweight Structure Cordis.europa.eu/projects/rcn/ 110779_en.html
Projects and Clusters 15 Divisions of the Department of Mechanical Engineering
Automotive
■ Contact 6JGCWVQOQVKXGƄGNFKUQPGQHVJGOQUVKORQTVCPVQPGUCVVJG&GRCTV- OGPVQH/GEJCPKECN'PIKPGGTKPI#NOQUVGXGT[KPUVKVWVGKUKPXQNXGFXKCVJG Spokesperson: OQUVFKXGTUGTCPIGQHRTQLGEVU Prof. Dr.-Ing. Markus Lienkamp, Institute of Automotive Technology In addition to vehicle and usage concepts, The Munich metropolitan area probably Phone +49.89.289.15345 particular emphasis is also placed on the has the highest density of prestigious [email protected] powertrain, driver assistance systems as car manufacturers in the world, a very www.ftm.mw.tum.de well as the use of new materials and the KORQTVCPVHCEVQTHQTVJKUƄGNF-G[ Members: production process. One focus area is UEKGPVKƄEEJCNNGPIGUNKGKPWPFGTUVCPFKPI Prof. Dr. Klaus Bengler, how to ensure the viability of individual combustion processes and the properties Institute of Ergonomics VTCPURQTVVJTQWIJGHƄEKGPVXGJKENGUKPVJG of materials. www.lfe.mw.tum.de face of increasing resource shortages.
Prof. Dr.-Ing. Boris Lohmann, Institute of Automatic Control www.rt.mw.tum.de
Prof. Dr.-Ing. Karsten Stahl, Institute of Machine Elements www.fzg.mw.tum.de
Prof. Dr.-Ing. Georg Wachtmeister, Institute of Internal Combustion Engines www.lvk.mw.tum.de
Project Visio.M
The TUM developed a small electric The vehicle developed will also be used in vehicle in the previous project MUTE further research projects e.g. for teleoper- which could both be manufactured ated driving. and pass government controls. Upon successful conclusion of the project the www.visiom-automobile.de TUM decided to proceed further in the same vein, not only to investigate how the (WPFGFD[VJG)GTOCP(GFGTCN/KPKUVT[QH'FWECVKQP production of electric vehicles can be safe CPF4GUGCTEJ CPFGHƄEKGPVDWVCNUQEQUVGHHGEVKXG
Project UR:BAN
Thirty partners from the motor industry, n2GQRNGKP6TCHƄEoKPYJKEJWUGTKPVGTCEVKQP the industry’s suppliers, universities and with driver’s assistant systems is being research facilities, as well as local munici- investigated. palities, are developing driver’s assistant CPFVTCHƄEOCPCIGOGPVU[UVGOUKPC www.urban-online.org cooperative project UR:BAN for particu- NCTN[FGOCPFKPIEKV[VTCHƄE5CHGV[GPGTI[ (WPFGFD[VJG)GTOCP(GFGTCN/KPKUVT[QH'FWECVKQP GHƄEKGPE[CPFUVTGUUHTGGFTKXKPICTGCVVJG CPF4GUGCTEJ HQTGHTQPV6JG67/EQQTFKPCVGUVJGƄGNF
16 Divisions of the Department of Mechanical Engineering Energy
■ #UWUVCKPCDNGGPGTI[UWRRN[KUQPGQHVJGGUUGPVKCNTGSWKTGOGPVUHQTVJG Contact
HWVWTGQHQWTUQEKGV[6JGIQCNUQHTGFWEKPI%12GOKUUKQPUCEJKGXKPIEQUV GHHGEVKXGPGUUCPFUQEKGVCNCEEGRVCPEGRTQXKFGVJGEJCNNGPIGUHQTTGUGCTEJ Spokesperson: Prof. Dr.-Ing. Hartmut CPFFGXGNQROGPVQHHWVWTGGPGTI[UWRRN[ Spliethoff, Institute of Energy Systems The Department of Mechnical Enginee- Phone +49.89.289.16272 ring has been a hotbed of research into [email protected] www.es.mw.tum.de energy technology and thermodynamics ever since the days of Carl von Linde Members: and Wilhelm Nußelt. The department has Prof. Dr. Carlo Bottasso, a particularly excellent reputation in the Institute of Wind Energy www.wind.mw.tum.de areas of combustion technology and the development of advanced power stations. Prof. Dr.-Ing. Oskar Haidn Our research and teaching portfolio in (komm.), Institute of Flight renewable energy has been expanded Propulsion www.lfa.mw.tum.de considerably in recent years, e.g. through strengthening of many years of research the new Institute of Wind Energy and the into biomass, geothermal and solar energy. Prof. Dr.-Ing. Harald Klein, Institute of Plant and Process Technology www.apt.mw.tum.de Center for Power Generation Prof. Dr. Rafael Macian- Juan, PhD, Institute of The Center for Power Generation is a is the conversion, transport and storage of Nuclear Technology research alliance within the Technical energy but it also investigates areas such www.ntech.mw.tum.de University of Munich with the goal of com- as load spreading and infrastructure. DKPKPIUMKNNUCPFMPQYNGFIGKPVJGƄGNFU Prof. Wolfgang Polifke, PhD, Thermo-Fluid of chemistry, electrical and mechanical www.powergen.mse.tum.de Dynamics Group engineering and physics. Its primary focus www.tfd.mw.tum.de
Prof. Dr.-Ing. Thomas Sattelmayer, Institute of Energy Valley Bavaria – Flexible Power Stations Thermodynamics www.td.mw.tum.de The ‘Energy Valley Bavaria’ project at the Institute of Energy Systems on the Prof. Dr. Rudolf Neu, consists of an interdisciplinary team dynamic behaviour of steam generators. Plasma Material Interac- investigat ing the effects of the energy The results form the basis of dynamic tion Group revolution on generation systems and process simulations which illustrate all the www.pmw.mw.tum.de electricity grids. Investigative research processes at work in power stations. is carried out at the Institute of Thermo- F[PCOKEUQPKPETGCUKPIVJGƅGZKDKNKV[QH www.evb.mse.tum.de gas turbines and analysis is carried out
Holistic Design of Wind Turbines
The design of wind energy systems is a automated holistic design procedures. The complex engineering activity that typically resulting software tools enable the design aims at delivering the lowest possible of the next generation wind turbines, the EQUVQHGPGTI[6QCFFTGUUVJKUFKHƄEWNV exploration of the design space in search multidisciplinary problem, the Wind Energy of better solutions, as well as the evalua- Institute works on the development of tion of the impact of new technologies.
Divisions of the Department of Mechanical Engineering 17 Process Engineering
■ Contact 2TQEGUU'PIKPGGTKPIKUCMG[VGEJPQNQI[ HQTCNNRTQFWEVKQPKPFWUVTKGU Spokesperson: Prof. Dr.-Ing. Dirk Process engineering at the Department like chemistry, biotechnology, pharma Weuster-Botz, Institute of Biochemical Engineering of Mechanical Engineering is focused on and environmental engineering. Process Phone +49.89.289.15712 thermal process engineering and plant engineering at the Department of Mecha- [email protected] engineering, bioprocess and biochemical nical Engineering forms the engineering www.biovt.mw.tum.de engineering, systems biotechnology and science core of the interdisciplinary Members: bioseparation engineering. The mission is TUM-Research Center for Industrial Prof. Dr. Sonja Berens- to solve process engineering challenges of Biotechnology with a pilot plant on an meier, Bioseparation the future in an interdisciplinary environ- m3-scale operated in Garching. Group ment and with respect to industry sectors www.biovt.mw.tum.de
Prof. Dr.-Ing. Harald Klein, Institute of Plant and Process Technology www.apt.mw.tum.de
Prof. Dr.-Ing. Andreas Kremling, Systems Biotechnology Group www.biovt.mw.tum.de
Biotechnology 2020+: Basic Technologies for the Next Generation of Bioprocesses
New tools for dynamic process optimiz- membrane reactors on a nano-scale at ation based on mathematical models of the Institute of Biochemical Engineering. cellular metabolism and signal transduc- The Bioseparation Engineering group tion pathways are the objectives of the is focused on the rational design of Systems Biotechnology group. The junior peptide-surface interactions for selective research group Biocatalysis works on the separation of proteins. design, characterization and biocatalytic CRRNKECVKQPQHCTVKƄEKCNOWNVKGP\[OG (WPFGFD[$/$(
!nnovA2 – Innovative Apparatus and Plant Concepts HQT+PETGCUKPIVJG'HƄEKGPE[QH2TQFWEVKQP2TQEGUUGU
The !nnovA2 project involves research into OKZVWTGUQHICUGU VJGOKZKPIGHHGEVKPRCT- condensation on microstructured surfaces ticular warranting thorough investigation. KPQTFGTVQKPETGCUGVJGGHƄEKGPE[QHJGCV exchangers. The goal of this project is (WPFGFD[$/$( to expand the effect of condensation on
18 Divisions of the Department of Mechanical Engineering Aerospace
■ 1XGTCNNCGTQURCEGXGJKENGFGUKIPFQYPVQCGTQF[PCOKEUCPFHWPFCOGPVCN Contact ƅWKFF[PCOKEUTGUGCTEJOCVGTKCNUVTWEVWTCNFGUKIPRTQRWNUKQPCPFƅKIJV U[UVGOF[PCOKEUEQXGTVJGHWNNURGEVTWOQHCGTQURCEGGPIKPGGTKPI Spokesperson: Prof. Dr.-Ing. Mirko Hornung, Institute Research activities and the excellent educa- of Aircraft Design tion of the faculty are of great importance, Phone +49.89.289.15981 especially for the high-performance and [email protected] www.lls.mw.tum.de competitive aerospace location in Bavaria. Also embedded in Munich Aerospace – a Members: research platform founded together with Prof. Dr. Nikolaus Adams, the Universität der Bundeswehr (University Institute of Aerodynamics of the German Armed Forces), DLR as well environmentally friendly technologies for and Fluid Mechanics www.aer.mw.tum.de as Bauhaus Luftfahrt –TUM Aerospace CGTQURCEG6JKUKUCNUQTGƅGEVGFKPOCP[ is an important contributor in basic and joint research projects together with the Prof. Dr.-Ing. Horst Baier, applied research into future topics such aerospace industry including European sys- Institute of Lightweight CUUCHGTQRGTCVKQPCPFOQTGGHƄEKGPVCPF tem suppliers as well as innovative SMEs. Structures www.llb.mw.tum.de
Prof. Dr. Carlo Bottasso, SFB TR40 Technological Foundations for the Design of Thermally and Institute of Wind Energy Mechanically Highly Loaded Components for Future Space Transport www.wind.mw.tum.de Systems Prof. Dr.-Ing. Klaus Drechsler, Institute of Spacecraft of the next generation will fact that optimal solutions for one compo- Carbon Composites have rocket propulsion achieving the nent do not at present necessarily lead to www.lcc.mw.tum.de best compromise between development optimal solutions for the entire system. Prof. Dr.-Ing. Oskar Haidn costs, production costs and performance. (komm.) Institute of Flight The objective of the research is to model www.sfbtr40.de Propulsion very thermally and mechanically resilient www.lfa.mw.tum.de components. A particular challenge lies in (WPFGFD[VJG)GTOCP4GUGCTEJ(QWPFCVKQP Prof. Dr.-Ing. Oskar Haidn, ETGCVKPIUVTQPIKPVGTNKPMCIGTGƅGEVGFKPVJG Space Propulsion Group www.lfa.mw.tum.de
GRK 1095 Aero-Thermodynamic Design of a Scramjet Propulsion Prof. Dr.-Ing. Manfred Hajek, Institute of System for Future Space Travel Systems Helicopter Technology www.ht.mw.tum.de Air breathing, integrated jet engines which numerical fundamentals required to create use combustion at supersonic speeds a scramjet demonstrator. Prof. Dr.-Ing. Florian over Mach 5 (scramjets) represent a Holzapfel, Institute of Flight System Dynamics genuine alternative to classic rocket tech- www.uni-stuttgart.de/itlr/graduierten www.fsd.mw.tum.de nology. The goal of this research group is to work out both the experimental and (WPFGFD[VJG)GTOCP4GUGCTEJ(QWPFCVKQP Prof. Dr.-Ing. Hans-Jakob Kaltenbach, Flow Control and Aeroacoustics Group www.aer.mw.tum.de Award: Gordon Bell Prize Prof. Dr.-Ing. Ulrich Walter, A team at our Institute of Aerodynamics simulation of a cavitation bubble cloud. Institute of Astronautics www.lfa.mw.tum.de and Fluid Mechanics together with the Some 1.6 million processing units were Lawrence Livermore National Laboratory used to simulate 15,000 individual bubbles and the ETH Zürich was awarded the QPZƄPKVGXQNWOGU Gordon Bell Prize at the end of 2013 for VJGYQTNFoUNCTIGUVCPFOQUVGHƄEKGPVƅQY http://awards.acm.org/bell/year.cfm
Divisions of the Department of Mechanical Engineering 19 Materials
■ Contact /CVGTKCNUGPCDNGCPFFGVGTOKPGVJGOCPWHCEVWTGQHEQPUVKVWGPVRCTVU RQUUKDNGVTCPUOKVHQTEGUFGVGTOKPGVJGGHƄEKGPE[NGXGNUQHOCEJKPGUCPF Spokesperson: VJGEQORCVKDKNKV[QHOGFKECNKORNCPVU#NNVJTGGOCLQTOCVGTKCNUECVGIQTKGU Prof. Dr. Dr.-Ing Erich Wintermantel, RQN[OGTURNCUVKEUOGVCNUCPFEGTCOKEUCUYGNNCUVJQUGFGTKXGFHTQO Institute of Medical and VJGOGIECTDQPEQORQUKVGUCPFQVJGTEQORQUKVGOCVGTKCNURNC[CUKIPK- Polymer Engineering ƄECPVTQNGKPTGUGCTEJCPFVGCEJKPICVVJGFGRCTVOGPV Phone +49.89.289.16700 [email protected] www.medtech.mw.tum.de Key research areas include ultra-precise for Materials Research and Testing in antennae which can be used in space Mechan ical Engineering (part of the Members: for satellite navigation, manufacturing Bavarian government) is another highlight Prof. Dr. Horst Baier, medical components in sterile environ- which illustrates how our wide ranging Institute of Lightweight ments for use in the human body or the material analyses enable deep insights Structures www.llb.mw.tum.de automated manufacture of load-bearing into all solid materials. vehicle or aircraft parts. The Institute Prof. Dr. Klaus Drechsler, Institute of Carbon Composites www.lcc.mw.tum.de #PVK/KM #PVKOKETQDKCN2TQQƄPIQH+ORNCPVCPF/GFKECN/CVGTKCNU
Prof. Dr. Michael W. Gee, Competencies in compounding, activating small and medium sized companies in Mechanics and High the photo-analytical effects of titanium plastics and several medical product Performance Computing oxides in plastics matrices, as well as the manufacturers are working together in this Group www.mhpc.mw.tum.de KPƅWGPEGQHRNCUVKEUVJTQWIJCIITGUUKXG consortium. media e.g. blood or disinfectants are Prof. Dr. Rudolf Neu, all examined in the AntiMik project. The %QQRGTCVKQP2CTVPGTU 5ØFFGWVUEJGU-WPUVUVQHH Plasma Material Süddeutsche Kunststoffzentrum (Southern www.pmw.mw.tum.de Prof. Dr. Wolfgang Wall, Institute of Computational IGSSE Focus Area ‘Biomaterials’ Mechanics www.lnm.mw.tum.de Living systems are fundamentally different energy conversion and storage but also Prof. Dr. Ewald Werner, from state-of-the-art technology. They synthesis scenarios similar to those where Institute of Materials can build themselves from raw materials enzymes are present. Science and Mechanics through self organisation, have the ability These process are being thoroughly inves- of Materials to repair themselves, can reproduce and tigated as part of the IGSSE Focus Area www.wkm.mw.tum.de then decay back into their raw materials. by researchers with overlapping expertise Prof. Dr.-Ing. Veit Senner, Even if the fundamentals of life are not in engineering and natural sciences, with Sport Equipment and yet understood, fundamental modes of strong involvement from the Department Materials Group CEVKQPECPDGWPFGTUVQQFYKVJUWHƄEKGPV of Mechanical Engineering. www.spgm.tum.de precision to the point where they can be applied in biotechnology and materials (WPFGFD[VJG(GFGTCVKQPCPF)GTOCP.ÀPFGTCURCTV science. Examples of applications include QHVJG'ZEGNNGPEG+PKVKCVKXG 20 Divisions of the Department of Mechanical Engineering Christian Doppler Laboratory The Christian Doppler Laboratory development of residual stress. Research investigates the material mechanics of focused on practical applications as well high performance alloys and is part of as theoretical research for individual plans the Institute of Materials Science and is limited to materials, components and Mechanics of Materials at the TUM. Its manufacturing processes already being mission is to characterise the material and used in industry or whose implementation component properties as they relate to the is planned in the near future. parameters of the manufacturing process. The primary research areas include the www.wkm.mw.tum.de/cd-labor/ investigation of mechanical properties, microstructure development and the (WPFGFD[VJG%JTKUVKCP&QRRNGT4GUGCTEJ#UUQEKCVKQP FORCiM3A CRP is regarded as the ‘material of the of CRP components, other than their light future’ which has so far led to innovations weight and increased strength, is that they spanning many sectors. However, one may last longer and be even more precise. area in which CRP has not yet found a This is due to their higher material fatigue foothold is machine and factory construc- resistance when compared to metals. The tion. Whilst some successful combinations tasks of FORCiM3A include designing the of steel and carbon have been achieved relevant CRP compatible components in industry, simply replacing metal with (drive shaft, clutch, underlying structure, carbon is not possible. Surmounting this spring elements), designing the composite hurdle will therefore remain at the forefront CRP-metal material used for the compo- of research and development work under- nents and checking its stability against taken by FORCiM3A. The hybrid joining QWVUKFGKPƅWGPEGUFWTKPIQRGTCVKQPGI techniques i.e. the combination of metal temperature, aggressive media or frequent and CRP is a requirement for thorough changes in load. integration into the world of steel const- ruction and with that the secure joining in (WPFGFD[VJG$CXCTKCP4GUGCTEJ(QWPFCVKQP CNNTGNGXCPVIGQOGVTKECNEQPƄIWTCVKQPUCPF mechanical load scenarios. The advantage Divisions of the Department of Mechanical Engineering 21 Mechatronics ■ Contact 6JGHQEWUKPOGEJCVTQPKEUKUVJGFGUKIPQHOGEJCVTQPKEU[UVGOUHQT CITGCVPWODGTQHCRRNKECVKQPCTGCUUWEJCUCGTQURCEGCWVQOQVKXG Spokesperson: TQDQVKEURTQFWEVKQPCPFOGFKECNFGXKEGU Prof. Dr. Tim Lüth, Institute of Micro Techno- logy and Medical Device The design process relies heavily upon the experienced in modelling the behaviour of Technology development and validation of models. people, robots and materials under chang- Phone +49.89.289.15190 The research units at the Department of KPIEQPFKVKQPUCUYGNNCUTGEQPƄIWTCDNG [email protected] www.mimed.mw.tum.de Mechanical Engineering are particularly and multibody systems. Members: Prof. Dr. Michael Gee, Mechanics and High Performance Computing Group www.mhpc.mw.tum.de Prof. Dr. Phaedon-Stelios Koutsourelakis, Conti- nuum Mechanics Group www.contmech.mw.tum.de Prof. Dr.-Ing. Udo Linde- mann, Institute of Product Development www.pe.mw.tum.de Prof. Dr.-Ing. Boris Lohmann, Institute of Automatic Control www.rt.mw.tum.de SFB 768: Managing Cycles in Innovation Processes - Integrated Prof. Dr. Julien Provost, Development of Product-Service Systems based on Technical Products Assistant Professorship Safe Embedded Systems The goal of Collaborative Research Center systems. This is a major challenge espe- www.ses.mw.tum.de SFB 768 is the transdisciplinary develop- cially of companies in the manufacturing Prof. Dr. Daniel Rixen, ment of models, methods and tools sector. Institute of Applied for creating innovative product-service Mechanics systems. The principal objectives are to www.sfb768.de www.amm.mw.tum.de KORTQXGVJGGHHGEVKXGPGUUCPFGHƄEKGPE[QH Prof. Dr.-Ing. Veit Senner, innovation processes for product-service (WPFGFD[VJG)GTOCP4GUGCTEJ(QWPFCVKQP Sport Equipment and Materials Group www.spgm.tum.de Award: Entrepreneur of Excellence 2013 Prof. Dr.-Ing. Birgit Vogel-Heuser, Institute of Dr. Ingo Ederer was presented with the a company called voxeljet in 1999, a Automation and Informa- TUM’s Entrepreneur of Excellence 2013 RKQPGGTKP&RTKPVKPIYJKEJYCUƅQCVGF tion Systems award. He completed his studies, includ- on the New York Stock Exchange in 2013 www.ais.mw.tum.de ing his doctorate, at the Department of reaching a market capitalisation of over Prof. Dr. Wolfgang Wall, Mechanical Engineering before founding 300 million Euros. Institute of Computational Mechanics www.lnm.mw.tum.de 22 Divisions of the Department of Mechanical Engineering Medical Technology ■ /GFKECNVGEJPQNQI[KUQPGQHVJGJKIJGUVTGXGPWG Contact IGPGTCVKPIUGEVQTUKP)GTOCP[CPFCETQUUVJGYQTNF Spokesperson: Prof. Dr. Tim Lüth, Despite this there are only three large automotive and aerospace, medical tech- Institute of Micro Techno- university centres in Germany operating nology is characterised by companies with logy and Medical Device KPVJKUƄGNF 496*#CEJGP(#7'TNCPIGP fewer than 50 employees with the one Technology and the Technische Universität München. important exception being manufacturers Phone +49.89.289.15190 [email protected] In direct contrast to sectors such as of medical imaging equipment. www.mimed.mw.tum.de Members: Prof. Dr. Oliver Lieleg, Biomechanics Group www.imetum.tum.de/ forschung/biologische- hydrogele/allgemein Prof. Dr. Wolfgang Wall, Institute of Computational Mechanics www.lnm.mw.tum.de Prof. Dr. Dr.-Ing. Erich Wintermantel, Institute of Medical and Polymer Engineering www.medtech.mw.tum.de Micromanipulators for ENT Surgery Microsurgical interventions in the middle phase with three degrees of freedom GCTKPXQNXGVJGWUGQHJCPFQRGTCVGFƄPG is being improved and developed even instruments under very challenging condi- further. It makes the surgeon’s job less dif- tions. The limited visibility of the operating ƄEWNVCPFKORTQXGUVJGUWTIKECNQWVEQOG area, tremor and the limited precision of The manipulator and its operating concept the human hand make these procedures are tested in a clinical evaluation. CNNVJGOQTGFKHƄEWNV+PVJKURTQLGEVC OKETQOCPKRWNCVQTFGXGNQRGFKPVJGƄTUV (WPFGFD[VJG)GTOCP4GUGCTEJ(QWPFCVKQP Automated Live Imaging for Laparoscopic Procedures The goal of this project is to stream ‘live’ evaluating a robot. The current project images from the interior of the operation phase involves the further development of area to the surgeon during laparoscopic these three areas: the robot, control and (keyhole) procedures without increased visualisation. manpower requirements. The foundations YGTGCEEQORNKUJGFKPVJGƄTUVRTQLGEV (WPFGFD[VJG)GTOCP4GUGCTEJ(QWPFCVKQP phase which consisted of developing and Divisions of the Department of Mechanical Engineering 23 Production and Logistics ■ Contact #NQPIYKVJVJGCWVQOQVKXGKPFWUVT[RTQFWEVKQPVGEJPQNQI[KU)GT OCP[oUVQRGZRQTVGCTPGTCPFJCUDGGPQPGQHVJGRKNNCTUQHVJG&GRCTV- Spokesperson: OGPVQH/GEJCPKECN'PIKPGGTKPIUKPEGKVUQTKIKPCNHQWPFKPI Prof. Dr.-Ing. Wolfram Volk, Institute of Metal Forming and Casting Particular importance has been placed NKPMGF HQTKPUVCPEGYKVJVJGSWGUVKQPQH Phone +49.89.289.13791 for a long time on looking at the entire how vibration in production machines can [email protected] production chain when carrying out any be simulated and then suppressed, how www.utg.de optimisations – everything from design models for the design and production Members: right down to the end customer – and process can be implemented or how new Prof. Dr. Klaus Bengler, not merely considering each individual materials can be worked with in a way Institute of Ergonomics step in isolation. Theoretical research YJKEJKUDQVJGHƄEKGPVCPFGPXKTQPOGPVCNN[ www.lfe.mw.tum.de and practical applications are inextricably friendly. Prof. Dr.-Ing. Klaus Drechsler, Institute of Carbon Composites SFB TR10 Integration of Forming, Separating and Joining for the www.lcc.mw.tum.de Flexible Manufacture of Lightweight Load-Bearing Structures Prof. Dr.-Ing. Willibald Günthner, Institute of 6JKURTQLGEVKPXGUVKICVGUVJGUEKGPVKƄE the ability to manufacture at short notice. Materials Handling, fundamentals and methods for design- The demand for research lies not only in Material Flow, Logistics ing integrated process chains and the OCMKPIKPFKXKFWCNRTQEGUUGUOQTGƅGZKDNG www.fml.mw.tum.de associated technologies for automatic, but also in mastering the complexities of Prof. Dr.-Ing. Gunther RTQFWEVƅGZKDNGUOCNNUGTKGUOCPWHCE- the process chain. Reinhart, Institute of turing for light load-bearing frames. The Machine Tools and FGOCPFHQTƅGZKDKNKV[KPOCPWHCEVWTG www.leichtbau.de/tr10 Industrial Management relates to the usability of various item www.iwb.mw.tum.de quantities, usability with great variety and (WPFGFD[VJG)GTOCP4GUGCTEJ)TQWR Prof. Dr.-Ing. Birgit Vogel-Heuser, Institute of Automation and Informa- MAI Carbon tion Systems www.ais.mw.tum.de Seventy two companies and education/ a competence centre for lightweight Prof. Dr.-Ing. Michael Zäh, research facilities make up the top cluster EQPUVTWEVKQPHTQOECTDQPƄDTGTGKPHQTEGF Institute of Machine Tools initiative M•A•I Carbon as well as suppor- plastics (CFP). Other goals include cover- and Industrial Manage- ting organisations from the region encom- ing the entire CFP value chain and helping ment passing Munich, Augsburg and Ingolstadt. the organisations represented in the group www.iwb.mw.tum.de The founding partners of M•A•I Carbon reach world class rankings in this key are Audi, BMW, Premium AEROTEC, technology. The Technical University of Eurocopter, Voith and the GSL Group, the Munich’s main contribution is its expertise IHK Schwaben, Carbon Composites e.V. KPƄDTGRTQEGUUKPI and the Technical University of Munich. +VUOKUUKQPKUVQOCMGECTDQPƄVHQTVJG www.mai-carbon.de production phase and to establish the region Munich-Augsburg-Ingolstadt as (WPFGFCUCVQRENWUVGTVJTQWIJVJG$/$( 24 Divisions of the Department of Mechanical Engineering Fit4Age The aging population and the changing and in driving. This in spite of the increa- demographics associated with it represent sing average age of the population and one of the greatest challenges of the 21st the decrease in the number of younger century. The goal of the research organi- people of working age. UCVKQPKUVQƄPFVGEJPKECNUQNWVKQPCR proaches which allow older people to lead YYYƄVCIGQTI CFKIPKƄGFNKHGDQVJCVJQOGCVYQTMKP their interactions with their surroundings (WPFGFD[VJG$CXCTKCP4GUGCTEJ(QWPFCVKQP Divisions of the Department of Mechanical Engineering 25 Faculty Graduate Center Mechanical Engineering The Graduate Center Mechanical Engin- TUM Graduate School as a TUM corpo- eer ing was founded in 2009 as part of the rate institution is a unique format to sup- TUM Graduate School. Since the begin- port doctorate studies. Its basic program ning of 2014, participation is an integral consists of a three-day kick-off seminar at part of all doctorates. It provides training the beginning of the doctorate, a subject EQWTUGUURGEKƄECNN[QTKGPVGFVQYCTFVJG URGEKƄESWCNKƄECVKQPRTQITCOCPFVJG needs of engineers, promotes networking requirement to publish at least one scien- Dr. Till von of the doctoral candidates within the VKƄERCRGTQTEQPVTKDWVGVQVJGUEKGPVKƄE Feilitzsch faculty and beyond and helps the institu- community e.g. at conferences. In addition Managing VGUVQOCKPVCKPJKIJGUVUEKGPVKƄEUVCP- to the mandatory basic program, the TUM Director dards. This highly innovative programme Graduate School offers additional opti- has been awarded the Best Practice QPCNSWCNKƄECVKQPRTQITCOUVJCVUWRRQTV Award of acatech, the National Academy doctoral students in their transferable of Science and Engineering. skills, provide networks, expand their international and interdisciplinary horizon In 2013 and 2014, the Graduate Center and provide career orientation. Mechanical Engineering focused on implementing the recommendation of the Wissenschaftsrat on quality control of Rella Recsetar doctoral studies: Deputy Managing ■ %QWTUGUQPIQQFUEKGPVKƄERTCEVKEG Director, are now mandatory. This regulation is Courses unique at TUM. ■ All doctoral candidates have to be GODGFFGFKPVQVJGUEKGPVKƄEGPXKTQP- ment of TUM. This also applies to external candidates. Atiye Adali Admission 26 Faculty Graduate Center Mechanical Engineering Center of Key Competences The Center of Key Competences offers The Bachelor students who attend our students at the Faculty of Mechanical workshops on social competence topics, Engineering, the opportunity to expand such as presenting, communication, their professional skills in areas that are teamwork, motivation and facilitation, nowadays becoming increasingly important have again successfully demonstrated in both the job assessment process and their team skills in project work with their professional practice itself. Our motivation slogan ‘Simplify your student life’. In win- is to raise the awareness of developing ter semester 2014-15, about 800 students Dr. Birgit engineers with the necessary skills beyond started the tutor workshops receiving an Spielmann their usual scope. Providing them with skills intensive training in soft skills from the and aptitudes needed to meet adequately Center of Key Competences. Furthermore, the needs and demands of our highly many new tutors have been prepared to UGTXKEGCPFGHƄEKGPE[QTKGPVGFUQEKGV[9G act as a trainer for future participants in are committed to shaping the highest level the workshops. curriculum. Experience-based learning and activity- In the winter term 2013-14, the Center of oriented teaching form the cornerstones Key Competences introduced a new pro- of our educational guiding principles. For Franziska Glasl gram offering the improvement of certain our training, we use a broad variety of key competences to master students. teaching methods including project work, This newly-created workshop has been problem approaches, role plays or peer awarded the Ernst-Otto-Fischer Teaching counseling. Award. The module ‘soft skills workshops’ is composed of different workshops rea- Finally, we are very glad to be able to offer ching from personal to social and metho- our seminars in our new workshop rooms, dical skills. Students have the possibility where we have the opportunity to work to choose between diverse workshops, closely together as a team. Susanne Hottner enabling them to set an individual focus for their own personal development. ‘Getting to yes – Negotiation at Harvard’, ‘Conversation skills - To communicate clearly and consistently’ or ‘Intelligent 6GCOYQTM+PETGCUGVJGGHƄEKGPE[QHC team’ were only a few workshops offered in the institution’s curriculum, in 2014. Vanessa Scholz Center of Key Competences 27 Elected Representatives The following persons have been elected as representatives. Doctorate Speakers Helena Haschemi Viktoria Kindzierski Institute of Product Development Systems Biotechnology Group Patrick Gontar Stephan Hafenstein Institute of Ergonomics Institute of Materials Science and Mechanics of Materials Student Council Stephan Lie Franziska Ochsenfarth Charlotte Haid Kilian Andres Escayola Women’s Representative Franziska Sophie Klein, M. Sc. Dipl.-Ing. Isabell Franck Department Gender Equality &GRWV[)GPFGT'SWCNKV[1HƄEGT 1HƄEGT 28 Elected Representatives Faculty Members Prof. Dr.-Ing. Nikolaus Adams Prof. Dr. Carlo L. Bottasso Institute of Aerodynamics and Fluid Institute of Wind Energy Systems Mechanics www.wind.mw.tum.de www.aer.mw.tum.de ■ Wind energy system design, ■ Numerical modeling and simulation modeling and control QHEQORNGZƅQYU ■ Computational mechanics and ■ Low-speed aerodynamics simulation technology ■ /WNVKRJCUGƅQYUOKETQƅWKFKEU ■ Numerical and experimental ■ )CUF[PCOKEUECXKVCVKPIƅQYU aeroelasticity ■ Aircraft, spacecraft and automotive Page 58 aerodynamics Page 36 Prof. Dr.-Ing. Horst Baier Prof. Dr.-Ing. Klaus Drechsler Institute of Lightweight Structures Institute of Carbon Composites www.llb.mw.tum.de www.lcc.mw.tum.de ■ Smart and adaptive structures ■ Composite materials and process ■ Large membrane and deployable technology space structures ■ Textile technology ■ Fibre composite and hybrid ■ Lightweigth design materials structures Page 63 ■ Structural and multidisciplinary design optimization techniques Page 45 Prof. Dr. phil. Klaus Bengler Prof. Dr.-Ing. Michael W. Gee Institute of Ergonomics Mechanics and High Performance www.lfe.mw.tum.de Computing Group ■ Micro ergonomics www.mhpc.mw.tum.de ■ Human-machine-interaction ■ High performance parallel compu- ■ Digital human modelling ting Page 49 ■ Fluid-structure interaction ■ Cardiovascular biomechanics Page 68 Prof. Dr. rer. nat. Sonja Berensmeier Prof. Dr.-Ing. habil. Dipl.-Geophys. Bioseparation Engeneering Group Christian Große www.biovt.mw.tum.de Institute of Non-destructive Testing ■ Selective separation of bio- www.zfp.tum.de molecules ■ Quality control during construction ■ Downstream processing ■ Inspection of structures and com- ■ Magnetic separation ponents in civil and mechanical Page 55 engineering ■ Structural health monitoring Joint Appointment with the Faculty of Civil Engineering Page 72 Faculty Members 29 Prof. Dr.-Ing. Willibald A. Günthner Prof. Dr.-Ing. Florian Holzapfel Institute of Materials Handling, Institute of Flight System Dynamics Material Flow, Logistics www.fsd.mw.tum.de www.fml.mw.tum.de ■ Modeling, simulation and para- ■ RFID-based control and optimiza- meter estimation VKQPQHOCVGTKCNƅQYRTQEGUUGU ■ (NKIJVIWKFCPEGCPFƅKIJVEQPVTQN ■ Digital tools for logistics planning ■ Sensors, data fusion and naviga- ■ Role of humans in logistics tion Page 75 ■ Trajectory optimization Page 97 Prof. Dr.-Ing. Oskar J. Haidn Prof. Dr.-Ing. Mirko Hornung Institute of Flight Propulsion Institute of Aircraft Design www.lfa.mw.tum.de www.lls.mw.tum.de ■ Flight propulsion ■ Scenario analysis, future trends ■ Turbomachinery and technologies ■ Gas turbines ■ Aircraft design (civil and military) Page 84 ■ Analysis and evaluation of aircraft concepts Page 105 Prof. Dr.-Ing. Oskar J. Haidn Prof. Dr.-Ing. Hans-Jakob Space Propulsion Group Kaltenbach www.lfa.mw.tum.de Flow Control and Aeroacoustics ■ Thrust chamber technologies Group ■ High pressure combustion www.aer.mw.tum.de ■ In-space propulsion ■ #EVKXGCPFRCUUKXGƅQYEQPVTQN ■ Green propellants ■ 2TGFKEVKQPCPFOKVKICVKQPQHƅQY ■ Combustion dynamics noise Page 90 ■ Aircraft, automotive and railway aerodynamics Page 110 Prof. Dr.-Ing. Manfred Hajek Prof. Dr.-Ing. Harald Klein Institute of Helicopter Technology Institute of Plant and Process www.ht.mw.tum.de Technology ■ 'HƄEKGPE[KORTQXGOGPV www.apt.mw.tum.de ■ Reduced environmental impact ■ Thermodynamic properties ■ 'ZVGPUKQPQHVJGƅKIJVGPXGNQRG ■ Absorption processes Page 94 ■ Gas liquid contacting and heat transfer equipment Page 112 30 Faculty Members Prof. Phaedon-Stelios Prof. Dr.-Ing. Udo Lindemann Koutsourelakis, Ph.D. Institute of Product Development Continuum Mechanics Group www.pe.mw.tum.de www.contmech.mw.tum.de ■ Systems engineering and systems ■ 7PEGTVCKPV[SWCPVKƄECVKQPKPEQO- behavior putational science and engineering ■ Innovation processes and creativity ■ Bayesian formulations for inverse enhancing methods problems ■ Individualized products ■ Atomistic simulation of materials Page 131 Page 116 Prof. Dr.-Ing. Andreas Kremling Prof. Dr.-Ing. habil. Boris Lohmann Systems Biotechnology Group Institute of Automatic Control www.biovt.mw.tum.de www.rt.mw.tum.de ■ Mathematical modelling of cellular ■ Methods and application of systems nonlinear control ■ Model analysis and parameter ■ Modelling and model reduction of KFGPVKƄECVKQP dynamical systems ■ Model-based experimental design ■ Feedback control in manufactoring Page 119 processes Page 137 Prof. Dr. rer. nat. Oliver Lieleg Prof. Dr. rer. nat. Tim C. Lüth Biomechanics Group Institute of Micro Technology and www.imetum.tum.de/forschung/biolo- Medical Device Technology gische-gydrogele www.mimed.mw.tum.de ■ Mechanics of biomaterials ■ Medical navigation, robotics, and ■ Biological hydrogels control architectures ■ Biomedical/biophysical engineer- ■ Rapid prototyping ing ■ Technology for an aging society Page 122 Page 142 Prof. Dr.-Ing. Markus Lienkamp Prof. Rafael Macian-Juan, Ph.D. Institute for Automotive Technology Institute of Nuclear Technology www.ftm.mw.tum.de www.ntec.mw.tum.de ■ Vehicle concepts ■ Nuclear reactor safety ■ Electric mobility ■ Thermal-hydraulic and neutronic ■ Vehicle control and dynamics analysis of nuclear systems ■ Driver assistance systems ■ Radiation transport Page 125 Page 149 Faculty Members 31 Prof. Dr. Rudolf Neu Prof. Dr. Ir. Daniel Rixen Plasma Material Interaction Group Institute of Applied Mechanics www.pmw.mw.tum.de www.amm.mw.tum.de ■ Erosion and hydrogen retention in ■ Numerical methods for technical plasma facing materials dynamics ■ Tungsten alloys and composite ■ Experimental structure dynamics structures for heat removal ■ Multiphysicals models ■ *GCVƅQYVGUVUHQTCPFFGXGNQR- Page 169 ment of plasma facing materials Page 154 Prof. Wolfgang Polifke, Ph.D. Prof. Dr.-Ing. Thomas Sattelmayer Thermo-Fluid Dynamics Group Institute of Thermodynamics www.tfd.mw.tum.de www.td.mw.tum.de ■ Aero- and thermoacoustics ■ %QODWUVKQPCPFTGCEVKXGƅQYU ■ Mixing and reaction in turbulent noise and instabilities ƅQYU ■ Transport phenomena in single- ■ 6YQRJCUGƅQYU CPFVYQRJCUGƅQYU Page 158 ■ Energy systems and technologies Page 174 Prof. Dr. Julien Provost Prof. Dr.-Ing. Veit Senner Assistant Professorship Sport Equipment and Materials Safe Embedded Systems Group www.ses.mw.tum.de www.spgm.tum.de ■ Fault-tolerant systems ■ New materials (esp. carbon ■ (QTOCNXGTKƄECVKQPXCNKFCVKQP composites) in sports ■ Distributed control systems ■ Improved interaction between ■ Diagnosis of automated systems athletes and sports equipment Page 162 ■ Equipment for reduced injury risk in sports Page 180 Prof. Dr.-Ing. Gunther Reinhart Prof. Dr.-Ing. Hartmut Spliethoff Institute of Industrial Management Institute of Energy Systems and Assembly Technologies www.es.mw.tum.de www.iwb.mw.tum.de ■ Systems studies ■ Production management and ■ %QODWUVKQPCPFICUKƄECVKQPQH logistics solid fuels ■ Automation and robotics ■ Steam cycles ■ Assembly technology Page 183 Page 164 32 Faculty Members Prof. Dr.-Ing. Karsten Stahl Prof. Dr.-Ing. Wolfgang A. Wall Institute of Machine Elements Institute of Computational www.fzg.mw.tum.de Mechanics ■ Gear development www.lnm.mw.tum.de ■ Load capacity of spur and helical ■ /WNVKƄGNFRTQDNGOU gears ■ Multiscale problems ■ NVH analysis and improvements ■ Computational biomechanics and Page 188 biophysics Page 217 Prof. Dr.-Ing. Birgit Vogel-Heuser Prof. Prof. h. c. Dr. rer. nat. Institute of Automation and Ulrich Walter Information Systems Institute of Astronautics www.ais.mw.tum.de www.lrt.mw.tum.de ■ Model-based and integrated ■ Spacecraft and satellite techno- engineering logies ■ Distributed control systems ■ Systems engineering ■ Quality management and human ■ Human exploration technologies factors ■ Hypervelocity laboratory Page 198 Page 223 Prof. Dr.-Ing. Wolfram Volk Prof. Dr. mont. habil. Dr. rer. nat. Institute of Metal Forming and h. c. Ewald Werner Casting Institute of Materials Science and www.utg.mw.tum.de Mechanics of Materials ■ Manufacturing, tooling, and www.wkm.mw.tum.de measurement technology ■ Materials science of metals and ■ Development, heat treatment and mechanics of materials processing of new materials ■ Phase transformations ■ Virtual manufacturing processes ■ Aloy and process development Page 206 Page 229 Prof. Dr.-Ing. Georg Wachtmeister Prof. Dr.-Ing. Dirk Weuster-Botz Institute of Internal Combustion Institute of Biochemical Engines Engineering www.lvk.mw.tum.de www.biovt.mw.tum.de ■ Gas and diesel engines ■ Microbial bioprocess engineering ■ Injection processes and industrial biotechnology ■ Exhaust gas aftertreatment ■ Biocatalysis and fermentation Page 211 ■ Bioprocess integration Page 234 Faculty Members 33 Prof. Dr. med. Dr.-Ing. habil. Prof. Dr.-Ing. Michael F. Zaeh Erich Wintermantel Institute of Machine Tools and Institute of Medical and Polymer Manufacturing Technology Engineering www.iwb.mw.tum.de www.medtech.mw.tum.de ■ Machine tools ■ Hemocompatible and -active ■ Manufacturing processes surfaces and systems ■ Joining and cutting technologies ■ Functionalized polymeric implants Page 243 ■ Improved polymers, process tooling and analysis tools Page 239 34 Faculty Members Reports of the Institutes Institute of Aerodynamics and Fluid Mechanics 0WOGTKECNOQFGNKPIUKOWNCVKQPCPFGZRGTKOGPVCNCPCN[UKUQHƅWKFUCPFƅWKFƅQYU ■ The focus of the Institute of Aerodynamics and Fluid Mechanics in YCUQPCFXCPEGFPWOGTKECNOQFGNUHQTƅQYKPVGTCEVKQPUƅQY RJ[UKEUQHUJQEMKPVGTHCEGKPVGTCEVKQPUJGNKEQRVGTCGTQF[PCOKEUCPF unsteady effects in automotive aerodynamics. #JKIJNKIJVYCUVJCVCITQWRHTQOVJG VQTKGU HQTCUKOWNCVKQPQHECXKVCVKQP +PUVKVWVGTGEGKXGFVJG)QTFQP$GNN EQNNCRUGYKVJ|VTKNNKQPFGITGGUQH 2TKEGHQT2GCM2GTHQTOCPEG UJCTGFYKVJ HTGGFQOQPOQTGVJCPOKNNKQP%27 '6* Prof. Dr.-Ing. Nikolaus A. Adams Contact %CXKVCVKPI(NQYUCPF%CXKVCVKQP'TQUKQP YYYCGTOYVWOFG PKMQNCWUCFCOU"VWOFG Motivation and Objectives 2JQPG 9GKPXGUVKICVGNKSWKFƅQYUYKVJRCTVKCN GXCRQTCVKQPFWGVQƅQYKPFWEGFNQECN RTGUUWTGFTQRUDGNQYXCRQTRTGUUWTG MPQYPCUECXKVCVKQP%CXKVCVKPIƅQYURNC[ CPKORQTVCPVTQNGKPKPLGEVKQPU[UVGOUQH &KGUGNCPF1VVQGPIKPGUKPEQORQPGPVUQH URCEGETCHVGPIKPGUCUYGNNCUKPUJKRRTQ RWNUKQPU[UVGOU/CPCIKPIVJGEQORNGZKV[ QHVYQRJCUGƅQYUYKVJRJCUGVTCPUKVKQP KUEJCNNGPIKPICPFGZRGTKOGPVCNKPXGU VKICVKQPUQHVGPECPPQVIQDG[QPFOQFGN Cavitation structures in an ICE fuel injector. FGXKEGU+PRCTVKEWNCTXKQNGPVEQNNCRUGU QHXCRQTDWDDNGUCPFVJGTGUWNVKPIUJQEM VJG'WTQRGCP5RCEG#IGPE[CPFVJG YCXGUPGGFVQDGRTGFKEVGFCPFVJGKT 1HƄEGQH0CXCN4GUGCTEJGPCDNGUFKU GTQUKXGOGEJCPKUOUJCXGVQDGENCTKƄGF UGOKPCVKQPQHHWPFCOGPVCNTGUGCTEJKPVQ CRRNKECVKQP Way to Solution 5VCVGQHVJGCTVPWOGTKECNRTQEGFWTGU Key Results CPFRJ[UKECNOQFGNUHQTVJGUKOWNCVKQP ■ %2'IGTGT5*KEMGN5,5EJOKFV QHECXKVCVKPIƅQYUCTGFGXGNQRGF(WNN[ 0##FCOU2J[U(NWKFU EQORTGUUKDNGCRRTQCEJGUHQTEQORNGZ ƅWKFUKPENWFKPINKSWKFXCRQTICUOKZVWTGU ■ &4QUUKPGNNK$*GLC\KCNJQUUGKPK2 CPFCVKOGTGUQNWVKQPQHPCPQUGEQPFU *CFLKFQWMCU%$GMCU#%WTKQPK CTGMG[HCEVQTUHQTRTGFKEVKXGUKOWNCVKQPU #$GTVUEJ5(WVTCN5,5EJOKFV (WPFCOGPVCNTGUGCTEJKUHWPFGFD[VJG 0##FCOU2-QWOQWVUCMQU &GWVUEJG(QTUEJWPIUIGOGKPUEJCHVCPF +PVGTPCVKQPCN%QPHGTGPEGHQT*KIJ VJG'WTQRGCP7PKQP#RRNKGFTGUGCTEJKP 2GTHQTOCPEG%QORWVKPI0GVYQTMKPI EQQRGTCVKQPYKVJCWVQOQVKXGUWRRNKGTU 5VQTCIGCPF#PCN[UKU5% &GPXGT 36 Institute of Aerodynamics and Fluid Mechanics .CTIG'FF[5KOWNCVKQPQH%QORNGZ6WTDWNGPV(NQYU Motivation and Objectives 5EKGPVKƄEFKUEQXGT[VJTQWIJOQFGNKPI CPFRTGFKEVKXGUKOWNCVKQPTGSWKTGUPWOG TKECNOQFGNUCPFUQNWVKQPOGVJQFUVJCV CEEWTCVGN[TGRTGUGPVCPFTGUQNXGTGNGXCPV ƅQYRJ[UKEUCPFGHƄEKGPVN[GZRNQKVOQFGTP OCUUKXGN[RCTCNNGNUWRGTEQORWVGTU Way to Solution #FCRVKXGƅQYUKOWNCVKQPTGHGTUVQJKIJN[ Direct simulation of Richtmyer Meshkov instability. CWVQOCVGFƅQYUKOWNCVKQPUYJKEJTGSWKTG QPN[COKPKOWOQHWUGTKPVGTXGPVKQPU Key Results YJKNGFGNKXGTKPITGNKCDNGTGUWNVU6JKU ■ 6TKVUEJNGT81NUQP$.GNG5*KEMGN KPENWFGUOGVJQFUHQTCWVQOCVKEOGUJ 5*W:;#FCOU0# C , CFCRVCVKQPCUYGNNCUHQTVJGSWCPVKƄECVKQP (NWKF/GEJ QHWPEGTVCKPVKGUVJCVTGUWNVHTQOOQFGN ■ 6TKVUEJNGT8-#XFQPKP#*KEMGN5 CRRTQZKOCVKQPUKPKVKCNFCVCQTDQWPFCT[ *W:;#FCOU0# D 2J[U EQPFKVKQPU#FCRVKXG&05.'5TGSWKTGU (NWKFU OGVJQFUVJCVEQWRNGPWOGTKECNCPF ■ 4GOONGT5*KEMGN5 ,(NWKF RJ[UKECNOQFGNUQPOWNVKRNGUECNGUKPC /GEJ EQPUKUVGPVYC[(QTGZCORNGYGJCXG ■ *KEMGN5'IGTGT%2.CTUUQP, FGXGNQRGFUQRJKUVKECVGFYCNNVWTDWNGPEG 2J[U(NWKFU OQFGNUYJKEJHCEKNKVCVG.'5QHGPIKPGGT ■ %JGP<.*KEMGN5&GXGUC# KPICGTQF[PCOKECRRNKECVKQPU $GTNCPF,#FCOU0# 6JGQT %QOR(NWKF/GEJ ■ /G[GT/*KEMGN5$TGKVUCOVGT% #FCOU0# #+##RCRGT Particle Modeling of Fluid Dynamics RJ[UKECNOQFGN52*CPFVJGKTOGUQUEQ RKEGZVGPUKQP5&2&CTGXGT[CVVTCEVKXG PWOGTKECNOQFGNUHQTƅWKFƅQYQHGZVTGOG RJ[UKECNEQORNGZKV[ Way to Solution 9GJCXGFGXGNQRGF52*5&2&CR RTQCEJGUECRCDNGQHOQFGNKPIEQORNGZ OKETQƅQYU+PRCTVKEWNCTYGJCXGFGXKUGF SPH simulation of tip-streaming of a micro droplet with CPGY52*RCTCFKIOYJKEJGPCDNGU52* surfactant. VQTGCEJTGCNKUVKEƅQYRCTCOGVGTUYKVJQWV CTVKƄEKCNTGIWNCTK\CVKQP Motivation and Objectives &GURKVGVJGKTYKFGURTGCFWUGV[RKECNRCT Key Results VKENGOGVJQFUUWEJCUUOQQVJGFRCTVKENG ■ #FCOK5*W:;CPF#FCOU0#, J[FTQF[PCOKEU 52* HQTUKOWNCVKPIƅWKF %QOR2J[U s F[PCOKEUECPPQVFGCNYKVJTGCNKUVKEƅQY ■ .KVXKPQX5*W:;'NNGTQ/#FCOU RCTCOGVGTUYKVJQWVPWOGTKECNTGIWNCTK\ 0#/KETQƅWKF0CPQƅWKF&1+ CVKQPVJCVKPVGTHGTGUYKVJVJGWPFGTN[KPI U Institute of Aerodynamics and Fluid Mechanics 37 High-order Numerical Models for Complex Fluid Dynamics and Interactions Way to Solution $CUGFQPQWTPGYN[FGXGNQRGF9'01 OGVJQFQNQI[YGFGUKIPPWOGTKECN UEJGOGUYKVJVJGCDKNKV[VQUGRCTCVGƅQY UVTWEVWTGCEEQTFKPIVQVJGKTEJCTCEVGTKUVKE NGPIVJUECNGUCPFVQJCPFNGNCTIGUECNG CPFUOCNNUECNGUVTWEVWTGKPRJ[UKECNN[ EQPUKUVGPVYC[U6JGFGXGNQRGFPWOGTKECN UEJGOGUCEJKGXGXGT[IQQFTGUQNXCDKNKV[ YKVJQWVEQORTQOKUKPITQDWUVPGUU9G JCXGFGXGNQRGFCOWNVKUECNGOGVJQF Direct simulation of shock-liquid-drop interaction. VQEQRGYKVJWPFGTTGUQNXGFKPVGTHCEG UVTWEVWTGU6JGEQTGCRRTQCEJKUC Motivation and Objectives UQECNNGFUVKOWNWUTGURQPUGOQFGNYJKEJ #NVJQWIJJKIJQTFGTUEJGOGUJCXGDGGP OGCUWTGUVJGUOQQVJPGUUQHVJGKPVGTHCEG YKFGN[WUGFKPPWOGTKECNUKOWNCVKQPQH CPFUGRCTCVGUTGUQNXGFCPFPQPTGUQNXGF ƅQYRJGPQOGPCVJG[HCEGITGCVEJCNNGP UECNGUKPCUKORNGCPFGHƄEKGPVYC[ IGUHQTCEJKGXKPIDQVJJKIJTGUQNXCDKNKV[ QHƅQYUVTWEVWTGUCPFJKIJTQDWUVPGUUHQT Key Results EQRKPIYKVJFKUEQPVKPWKVKGUCPFKPVGTHCEG ■ 5EJTCPPGT(5*W:;#FCOU0#%QO KPVGTCEVKQPU6JGPWOGTKECNOQFGNKPIQH RWVGTU(NWKFU s OWNVKRJCUGƅQYUOWUVJCXGVJGECRCDKNKV[ ■ *W:;#FCOU0CPF5JW9%, VQTGRTQFWEGVJGGXQNWVKQPQHƅWKFKEKPVGT %QOR2J[U s HCEGUYJKEJOC[DGEQOGXGT[EQORNGZ ■ *CP.**W:;#FCOU0#,%QOR CPFRTQFWEGUOCNNUK\GUVTWEVWTGUDG[QPF 2J[U s VJGTGUQNXCDKNKV[QHVJGEQORWVCVKQPCNITKF ■ *CP.**W:;#FCOU0#,%QOR 5WEJWPFGTTGUQNXGFUVTWEVWTGUXGT[QHVGP 2J[U s NGCFVQPWOGTKECNKPUVCDKNKV[CPFHCKNWTGQH PWOGTKECNUKOWNCVKQP Aircraft and Helicopter Aerodynamics Motivation and Objectives 2GTHQTOCPEGGPJCPEGOGPVCPFTGFWE VKQPQHGOKUUKQPUCTGMG[QDLGEVKEGUKP VJGHTCOGQHVJG'WTQRGCPn(NKIJVRCVJ o(QTVJGEWTTGPVTGUGCTEJRTQLGEVU KORTQXKPIƅQYRJ[UKEUMPQYNGFIGCPF OQFGNNKPICTGTGNCVGFVQWPUVGCF[CGTQ F[PCOKEUCPFCGTQGNCUVKEKV[VWTDWNGPV ƅQYUCPFCEVKXGƅQYEQPVTQN5RGEKCN GORJCUKUKUQPVJGCGTQF[PCOKEEJCTCE VGTKUVKEUQHJKIJN[OCPGWXGTCDNGCKTETCHV CPFNCTIGVTCPURQTVCKTETCHVCUYGNNCUQP WPEQPXGPVKQPCNCPF7#8EQPƄIWTCVKQPU *GNKEQRVGTƅQYCPCN[UKUD[74#055#5EQORWVCVKQPU 5RGEKƄETGUGCTEJCEVKXKVKGUKPVJGƄGNFQH CKTETCHVCPFJGNKEQRVGTCGTQF[PCOKEUFGCN 38 Institute of Aerodynamics and Fluid Mechanics Way to Solution 6JGKPXGUVKICVKQPUCTGRGTHQTOGFKPENWF KPIDQVJYKPFVWPPGNGZRGTKOGPVUCPF PWOGTKECNUKOWNCVKQPU%QOOGTEKCNCU YGNNCUKPJQWUGEQFGUCTGWUGFYJKNG EQFGFGXGNQROGPVKUOCKPN[EQPFWEVGFKP VJGEQPVGZVQHCGTQGNCUVKEKV[CPFTGFWEGF QTFGTOQFGNU Key Results SAGITTA diamond wing. ■ #-ÒN\UEJCPF%$TGKVUCOVGT,QWT PCNQH#KTETCHV8QN0Q YKVJOGCPUQHFTCITGFWEVKQPD[UJCRG RR| QRVKOK\CVKQPPQXGNCKTKPVCMGUQNWVKQPU ■ ,7-NCTCPF%$TGKVUCOVGT,QWTPCNQH ƅQYEQPVTQNWUKPICEVKXGFGXKEGURWNUGF #KTETCHV8QN0QRR| DNQYKPICPFRNCUOCCEVWCVQTUCPFWPEQP XGPVKQPCNNKHVIGPGTCVKPIU[UVGOUKPENWFKPI ■ $$GIWKPCPF%$TGKVUCOVGT VJGƅWKFUVTWEVWTGKPVGTCEVKQPQHƅGZKDNG #GTQURCEG5EKGPEGCPF6GEJPQNQI[ CFCRVKXGYKPIU 8QN0QRR .COKPCTVWTDWNGPV6TCPUKVKQPYKVJ%JGOKECN 0QP 'SWKNKDTKWOKP*[RGTUQPKE$QWPFCT[NC[GT(NQYU Motivation +PJ[RGTUQPKEƅQYUVJGJGCVVTCPUHGT FKHHGTUWRVQCPQTFGTQHOCIPKVWFG EQORCTKPINCOKPCTCPFVWTDWNGPVDQWPFCT[ NC[GTU6JGRTGFKEVKQPQHVJGVTCPUKVKQP NQECVKQPQPDNWPVTGGPVT[EQPƄIWTCVKQPU CKOUCVVJGWPFGTUVCPFKPIQHVJGWPFGT N[KPIKPUVCDKNKV[OGEJCPKUOU6JGKPƅWGPEG QHVJGEJGOKECNUVCVGQHVJGDQWPFCT[NC[GT GSWKNKDTKWOQTPQPGSWKNKDTKWO KPVJGUG JKIJGPVJCNR[ƅQYUKUVJGOCKPHQEWU Finite-size disturbance of a hypersonic boundary layer. Way to Solution &KTGEVPWOGTKECNUKOWNCVKQPU &05 CTG Key Results EQPFWEVGFQPPCVKQPCN*2%HCEKNKVKGUUWEJ ■ %5VGOOGT,(GJP[VJ#+##(NWKF CU5WRGT/7%CPF*.454GUWNVUUJQY &[PCOKEU%QPHGTGPEG#VNCPVC)# VJCVGCTN[UVCIGUQHJ[RGTUQPKEVTCPUKVKQP CTGPQVUWDUVCPVKCNN[CHHGEVGFD[EJGOKECN ■ 5)QUJ4(TKGFTKEJ%5VGOOGT+PV TGCEVKQPU5KOWNCVKQPUCTGEWTTGPVN[WPFGT ,*GCV(NWKF(NQY YC[VCMKPIKPVQCEEQWPVVJGUWTHCEG TQWIJPGUUCPFVJGPQKUGYJKEJECPNGCF VQVTCPUKGPVITQYVJQHFKUVWTDCPEGUVQ PQPNKPGCTCORNKVWFGUYJGTGVJG[ECP DGGPJCPEGFVJTQWIJVJGRTGUGPVQHVJG EJGOKECNTGCEVKQPU Institute of Aerodynamics and Fluid Mechanics 39 Automotive Aerodynamics Way to Solution 1PGCRRTQCEJVQWPUVGCF[CGTQF[PCOKEU KUVQCPCN[\GVJGF[PCOKEDGJCXKQTQHVJG ƅQYƄGNFWUKPIF[PCOKEOQFGFGEQO RQUKVKQP &/& &/&KUHQWPFVQGZVTCEV WUGHWNKPHQTOCVKQPHTQOVJGƅQYYJGPKV KUCRRNKGFVQVJTGGFKOGPUKQPCNXGNQEKV[ XGEVQTƄGNFU+VKUCOGVJQFVQGZVTCEV EQJGTGPVUVTWEVWTGUD[FGEQORQUKPI VJGƅQYKPVQF[PCOKEOQFGU#PCN[\KPI .CTIGUECNGVWTDWNGPVƅQY Motivation VJGVWTDWNGPVUVTWEVWTGUCPFVJGKTQTKIKPU UVTWEVWTGUCTQWPFVJG67/#'4 #WVQOQVKXGCGTQF[PCOKEUFGCNUYKVJVJG CNNQYUUJCRGQRVKOK\CVKQPNGCFKPIVQFTCI DRIVAER car body. CGTQF[PCOKEQRVKOK\CVKQPQHXGJKENGU TGFWEVKQPQHVJGEQORQPGPVQTHWNNECT FTKXGPD[EQODWUVKQPGPIKPGUQTGNGEVTKECN OQVQTU-G[QDLGEVKXGUCTGFTCITGFWEVKQP Key Results CPFWPUVGCF[CGTQF[PCOKEUYKVJKVU ■ /2GKEJN5/CEM6+PFKPIGT( KPƅWGPEGQPVJGFTKXKPIUVCDKNKV[CPFVJG &GEMGT #5/'(NWKFU'PIKPGGTKPI CGTQF[PCOKEEQGHƄEKGPVU9KVJTGURGEV 5WOOGT/GGVKPI#WIWUV VQJKIJFTCITGFWEVKQPRQVGPVKCNVJG %JKECIQ75#('&5/ YJGGNYJGGNJQWUGTGIKQPKUFGFKECVGFVQ ■ $5EJPGRH)6GUEJ6+PFKPIGT ,5#' U[UVGOCVKEQRVKOK\CVKQP #PPWCN5RTKPI%QPITGUU2CRGT /C[;QMQJCOC ,CRCP &()5QPFGTHQTUEJWPIUDGTGKEJ644 6GEJPQNQIKECN(QWPFCVKQPUHQTVJG&GUKIPQH6JGTOCNN[ and Mechanically Highly Loaded Components of Future 5RCEG6TCPURQTVCVKQP5[UVGOU KPVGITCVKQPKPVQVJGURCEGVTCPURQTVCVKQP U[UVGO %TKVKECNVJGTOCNN[CPFOGEJCPKECNN[JKIJN[ NQCFGFEQORQPGPVUQHUWEJURCEGVTCPU RQTVCVKQPU[UVGOUCTGVJGEQODWUVKQP EJCODGTVJGPQ\\NGVJGCHVDQF[CPFVJG EQQNKPIQHVJGUVTWEVWTG6JGUGEQORQ PGPVUQHHGTVJGJKIJGUVRQVGPVKCNHQTVJG Shock-turbulent boundary layer interaction. GHƄEKGPE[KPETGCUGQHVJGGPVKTGU[UVGO *QYGXGTCNNEQORQPGPVUCTGKPENQUGCPF 6JGKPUVKVWVGJCUVJGURGCMGTTQNGYKVJKP FKTGEVKPVGTCEVKQPYKVJGCEJQVJGT1RVKOK\ VJG&()5($6440GZVIGPGTCVKQP CVKQPQTVJGHWPFCOGPVCN[PGYFGUKIPQHC URCEGVTCPURQTVCVKQPU[UVGOUYKNNDG UKPINGEQORQPGPVFKTGEVN[CHHGEVUCNNQVJGT DCUGFQPTQEMGVRTQRWNUKQPU[UVGOU EQORQPGPVU YJKEJFGNKXGTVJGDGUVEQORTQOKUGDG 6JGRTQLGEVUHTQO67/496*#CEJGP VYGGPFGXGNQROGPVCPFRTQFWEVKQPEQUV 67$TCWPUEJYGKICPFVJG75VWVVICTVCU CPFRGTHQTOCPEG6JG644HQEWUGUQP YGNNCURCTVPGTUHTQO&.4CPF#+4$75 NKSWKFTQEMGVRTQRWNUKQPU[UVGOUCPFVJGKT &5KPXGUVKICVGKPKPVGTFKUEKRNKPCT[ 40 Institute of Aerodynamics and Fluid Mechanics GZRGTKOGPVCNCPFPWOGTKECNVGCOU6JG UEKGPVKƄEHQEWUQHCNNƄXGTGUGCTEJCTGCU FGXGNQRGFEQPEGRVUYKNNDGVGUVGFQP YKVJKPVJG644KUVJGCPCN[UKUCPFVJG UWDUECNGEQODWUVKQPEJCODGTUCPFYKNN OQFGNKPIQHEQWRNGFU[UVGOU$CUGFQP DGFGXGNQRGFVQCUVCIGQHCRRNKECDKNKV[+P TGHGTGPEGGZRGTKOGPVUFGVCKNGFPWOGTKECN CFFKVKQPRTKPEKRCNGZRGTKOGPVUCTGIQKPI OQFGNUCTGFGXGNQRGFYJKEJUGTXGCUVJG VQDGEQPFWEVGFVQFGOQPUVTCVGPGY DCUKUHQTGHƄEKGPVCPFTGNKCDNGRTGFKEVKXG VGEJPQNQIKGUFGXGNQRGFKPVJG6446JG UKOWNCVKQPVQQNUHQTFGUKIP Research Foci Courses ■ 0WOGTKECNƅWKFCPFƅQYOQFGNKPI ■ (NWKFOGEJCPKM+CPF++ CPFUKOWNCVKQP ■ #GTQF[PCOKM+WPF++ ■ %QORNGZ(NWKFU ■ )TGP\UEJKEJVVJGQTKG ■ 6WTDWNGPVCPFVTCPUKVKQPCNƅQYU ■ +PUVCVKQPÀTG#GTQF[PCOKM+WPF++ ■ #GTQF[PCOKEUQHCKTETCHVCPFCWVQ ■ #GTQCMWUVKM OQDKNGU ■ #GTQF[PCOKMWPF$CWYGTMG ■ 'PXKTQPOGPVCN#GTQF[PCOKEU ■ 0WOGTKUEJG$GTGEJPWPIVWTDWNGPVGT 5VTÒOWPI Competences ■ #GTQF[PCOKMUVWORHGT-ÒTRGT ■ /WNVKRJ[UKEUEQFGCPFRCTVKENGDCUGF ■ #GTQF[PCOKMXQP*ÒEJUVNGKUVWPIUHCJT OQFGNFGXGNQROGPV \GWIGP ■ #FCRVKXGOWNVKTGUQNWVKQPRCTCNNGN ■ 5VTÒOWPIUOGEJCPKMKPFGT8GTHCJTGPU UKOWNCVKQPEQFGU VGEJPKM ■ &TKX#GTECTIGQOGVT[ ■ %QORWVCVKQPCN5QNKFUCPF(NWKF&[PC ■ 'ZRGTKOGPVCN#GTQF[PCOKEU OKEU ■ #PIGYCPFVG%(& Infrastructure ■ 6WTDWNGPVG5VTÒOWPIGP ■ NQYURGGFYKPFVWPPGNU OQXKPIDGNV ■ )CUF[PCOKM U[UVGO ■ $KQƅWKF/GEJCPKEU ■ UJQEMVWDGU ■ 5VTÒOWPIURJ[UKMWPF/QFGNNIGUGV\G ■ #GTQF[PCOKMDQFGPIGDWPFGPGT (CJT\GWIG ■ #GTQF[PCOKMFGT4CWOHCJT\GWIG ■ #P+PVTQFWEVKQPVQ/KETQƅWKFKE5KOWNC VKQPU ■ )TWPFNCIGFGTGZRGTKOGPVKGNNGP5VTÒ OWPIUOGEJCPKM Institute of Aerodynamics and Fluid Mechanics 41 Management &KRN+PI6JQOCU-CNNGT 2TQH&T+PI0KMQNCWU##FCOU&KTGEVQT -GPVCTQ-CVQ/5E &T+PI#NDGTV2GTPRGKPVPGT &KRN+PI(NQTKCP-PQVJ CRN2TQH&T+PIJCDKN%JTKUVKCP$TGKVU &KRN+PI#PLC-ÒN\UEJ COVGT 5GTIGL.KVXKPQX/5E 2&&T+PIJCDKN%JTKUVKCP5VGOOGT ,KCP.WQ/5E &T+PI:KCPI[W*W &KRN+PI,CP/CVJGKU 2&&T+PIJCDKN6JQOCU+PFKPIGT .W/KCQ/5E 2TQHK4&T+PIJCDKN4CKPGT(TKGFTKEJ &KRN+PI/KEJCGN/KJCVUEJ 'OGTKVKWU 2CVTKEM0CVJGP/5E 2TQHGO&T+PI$QTKU.CUEJMC'OGTKVKWU &KRN2J[U%JTKUVQRJ0KGFGTOGKGT CRN2TQHK4&T+PI*CPU9GPING &KRN+PI(GNKZ²TNG[ 'OGTKVKWU 5JWEJGPI2CP/5E &KRN+PI8KVQ2CUSWCTKGNNQ Visiting Lecturer /CTVKP2GKEJN/5E &T+PI4CKPGT&GOWVJ $/9)TQWR &KRN+PI,WNKG2KSWGG &KRN+PI,CP(TGFGTKM3WCCV\ Administrative Staff &KRN+PI5GDCUVKCP4GOONGT #PIGNC)T[IKGT &KRN2J[U4QOCP4G» &KRN$GVTKGDUY (* 5CPFTC)TGKN &KRN6GEJ/CVJ5VGHHGP5EJOKFV .K5W/5E &KRN+PI$CUVKCP5EJPGRH &KRN+PI(GNKZ5EJTCPPGT Research Staff &KRN+PI/CTEQ5VWJNRHCTTGT &OKVTKK#\CTP[MJ/5E &KRN+PI/CVVJKCU6JCNJCOGT $TWPQ$GDCP/5E ,KVJGPFTC6KTCMCNC/5E &KRN+PI$GTPF$WFKEJ &KRN+PI8QNMGT6TKVUEJNGT &KRN+PI#PFTGK$W\KEC &KRN+PI/CZKOKNKCP9KPVGT &KRN+PI%JTKUVQRJGT%QNNKP &T+PI:KCQRGPI:WG (GNKZ&KGIGNOCPP/5E &KRN+PI,CG*WP;QW &KRN+PI5GDCUVKCP'DGTJCTFV %JK 42 Institute of Aerodynamics and Fluid Mechanics Publications 2013-14 ■ $ÅIWKP$$TGKVUCOVGT% 'HHGEVUQHOGODTCPG ■ *KEMGN5'IGTGT%2.CTUUQP, 5WDITKFUECNG RTGUVTGUUQPVJGCGTQF[PCOKEEJCTCEVGTKUVKEUQHCP OQFGNKPIHQTKORNKEKV.CTIG'FF[5KOWNCVKQP GNCUVQƅGZKDNGOQTRJKPIYKPI #GTQURCEG5EKGPEG QHEQORTGUUKDNGƅQYUCPFUJQEMVWTDWNGPEG CPF6GEJPQNQI[ 8QNWOG#WIWUV KPVGTCEVKQP2J[UKEUQH(NWKFUFQK ■ $KCP:'NNGTQ/ #URNKVVKPIKPVGITCVKQPUEJGOG HQTVJG52*UKOWNCVKQPQHEQPEGPVTCVGFRCTVKENG ■ *ÒXGNOCPP#$TGKVUCOVGT% 'ZRGTKOGPVCN UWURGPUKQPU %QORWVGT2J[UKEU%QOOWPKECVKQPU KPXGUVKICVKQPUQPXQTVGZƅQYRJGPQOGPCQHC 8QNWOG+UUWG,CPWCT[ FKCOQPFYKPIEQPƄIWTCVKQP VJ%QPITGUUQHVJG ■ $KCP:'NNGTQ/ KPVGITCVKQPUEJGOGHQTVJG52* +PVGTPCVKQPCN%QWPEKNQHVJG#GTQPCWVKECN5EKGPEGU UKOWNCVKQPQHEQPEGPVTCVGFRCTVKENGUWURGPUKQPU +%#5 %QORWVGT2J[UKEU%QOOWPKECVKQPU 8QNWOG ■ *WDGT5+PFKPIGT6#FCOU05EJWGV\6 +UUWG,CPWCT[ 'ZRGTKOGPVCNCPF0WOGTKECN5VWF[QH*GCV6TCPUHGT ■ $KCP:.KVXKPQX5'NNGTQ/9CIPGT0, CVVJG7PFGTDQF[QHC2TQFWEVKQP%CT 5#'+PVGT *[FTQF[PCOKEUJGCTVJKEMGPKPIQHRCTVKEWNCVG PCVKQPCN,QWTPCNQH%QOOGTEKCN8GJKENGU 8QNWOG UWURGPUKQPWPFGTEQPƄPGOGPV ,QWTPCNQH +UUWG/C[ 0QP0GYVQPKCP(NWKF/GEJCPKEU 8QNWOG ■ -CVQ-$TGKVUCOVGT%C1DK5 (NQYUGRCTCVKQP 0QXGODGT EQPVTQNQXGTC)ÒCKTHQKND[PCPQUGEQPF ■ $QTEJGTV5#EJCV\74GOONGT5*KEMGN5 RWNUGRGTKQFKEFKUEJCTIG 'ZRGTKOGPVUKP(NWKFU *CTNCPFGT78KPE\G/#NGZCPFTQX-&4KGRGT 8QNWOG+UUWG (*GRRGNOCPP6&QNCRVEJKGX5+ (KPKVGXQNWOG ■ -NCT,7$TGKVUCOVGT% 7PUVGCF[CGTQF[PCOKE OQFGNUYKVJKORNKEKVUWDITKFUECNGRCTCOGVGTK\C NQCFUQPCJKIJCIKNKV[CKTETCHVFWGVQYCMGXQTVGZ VKQPHQTVJGFKHHGTGPVKCNN[JGCVGFTQVCVKPICPPWNWU GPEQWPVGT ,QWTPCNQH#KTETCHV 8QNWOG+UUWG /GVGQTQNQIKUEJG Institute of Aerodynamics and Fluid Mechanics 43 ■ $ÀFGT&+PFKPIGT6#FCOU0#7PVGTNGEJPGT ■ .KVXKPQX5*W:;'NNGTQ/#FCOU0# 29KEMGTP) +PVGTHGTGPEGGHHGEVUQHEQQNKPI /GUQUEQRKEUKOWNCVKQPUQHVJGVTCPUKGPVDGJCXKQT CKTƅQYUQPCIGPGTKEECTDQF[,QWTPCNQH9KPF QHUGOKFKNWVGFRQN[OGTUQNWVKQPUKPCOKETQEJCPPGN 'PIKPGGTKPICPF+PFWUVTKCN#GTQF[PCOKEU HQNNQYKPIGZVGPUKQPCNƅQY/KETQƅWKFKEUCPF 0CPQƅWKFKEU ■ $GIWKP$$TGKVUCOVGT%#FCOU0 9CMG ■ /G[GT/$TGKVUCOVGT% #GTQF[PCOKEEJCTCEVGT OGCUWTGOGPVUVQCUUGUUVJGƅQYUVTWEVWTG KUVKEUQHVJGDNGPFGFYKPIDQF[#%(#0QVGU KPVGTCEVKQPQHCPGNCUVQƅGZKDNGOQTRJKPIYKPI QP0WOGTKECN(NWKF/GEJCPKEUCPF/WNVKFKUEKRNKPCT[ EQPƄIWTCVKQP0QVGUQP0WOGTKECN(NWKF/GEJCPKEU &GUKIP CPF/WNVKFKUEKRNKPCT[&GUKIP ■ /G[GT/*KEMGN5$TGKVUCOVGT%#FCOU0 ■ $KCP:'NNGTQ/ #URNKVVKPIKPVGITCVKQPUEJGOG 9CNNOQFGNNGFKORNKEKVNCTIGGFF[UKOWNCVKQPQHVJG HQTVJG52*UKOWNCVKQPQHEQPEGPVTCVGFRCTVKENG 4#5%JKIJNKHVEQPƄIWTCVKQPUV#+###RRNKGF UWURGPUKQPU%QORWVGT2J[UKEU%QOOWPKECVKQPU #GTQF[PCOKEU%QPHGTGPEG5CP&KGIQ%# 7PKVGF 5VCVGU ,WPG ■ %JGP<.*KEMGN5&GXGUC#$GTNCPF, ■ /KJCVUEJ/55EJOKFV5,6JCNJCOGT/CPF #FCOU0# 9CNNOQFGNKPIHQTKORNKEKVNCTIGGFF[ #FCOU0# 0WOGTKECN2TGFKEVKQPQH'TQUKXG%QN UKOWNCVKQPCPFKOOGTUGFKPVGTHCEGOGVJQFU NCRUG'XGPVUKP7PUVGCF[%QORTGUUKDNG%CXKVCVKPI 6JGQTGVKECNCPF%QORWVCVKQPCN(NWKF&[PCOKEU (NQYU+8+PVGTPCVKQPCN%QPHGTGPEGQP%QORWVCVKQ PCN/GVJQFUKP/CTKPG'PIKPGGTKPI5RTKPIGT ■ (NGKUEJGT&$TGKVUCOVGT% 'HƄEKGPV%QORWVCVKQP ■ 0KGFGTOGKGT%#/ØNNGT*,CTE\[M/*KEMGN5 QH7PUVGCF[#GTQF[PCOKE.QCFU7UKPI%QORWVC #FCOU0#2ƄV\PGT/D .CTIGGFF[UKOWNCVKQP VKQPCN(NWKF&[PCOKEU.KPGCTK\GF/GVJQFU,QWTPCN QHVWTDWNGPVVTCPUCPFUWRGTETKVKECNOKZKPIUV QH#KTETCHV #+##%QORWVCVKQPCN(NWKF&[PCOKEU%QPHGTGPEG ■ (NGKUEJGT&$TGKVUCOVGT% %(&DCUGFOGVJQFU 5CP&KGIQ%#7PKVGF5VCVGU,WPG HQTVJGEQORWVCVKQPQHIGPGTCNK\GFCGTQF[PCOKE ■ 4GOONGT5*KEMGN5 0WOGTKECNKPXGUVKICVKQPQH HQTEGU0QVGUQP0WOGTKECN(NWKF/GEJCPKEUCPF UVTCVKƄGFVWTDWNGPEG*KIJ2GTHQTOCPEG%QORWVKPI /WNVKFKUEKRNKPCT[&GUKIP KP5EKGPEGCPF'PIKPGGTKPIs6TCPUCEVKQPUQH ■ (WTOCP#$TGKVUCOVGT% 6WTDWNGPVCPFWPUVGCF[ VJG*KIJ2GTHQTOCPEG%QORWVKPI%GPVGT5VWVVICTV ƅQYEJCTCEVGTKUVKEUQHFGNVCYKPIXQTVGZU[UVGOU *.45 #GTQURCEG5EKGPEGCPF6GEJPQNQI[ ■ 4GOONGT5(TWOCP/&*KEMGN5 &KTGEV ■ )JQNCOK$%QOGTHQTF#'NNGTQ/ #OWNVKUECNG PWOGTKECNUKOWNCVKQPQHCDTGCMKPIKPGTVKCITCXKV[ 52*RCTVKENGOQFGNQHVJGPGCTYCNNF[PCOKEUQH YCXG,QWTPCNQH(NWKF/GEJCPKEU8QNWOG/C[ NGWMQE[VGUKPƅQY+PVGTPCVKQPCN,QWTPCNHQT0WOGTK ECN/GVJQFUKP$KQOGFKECN'PIKPGGTKPI ■ 4GOONGT5*KEMGN5 5RGEVTCNUVTWEVWTGQHUVTC ■ )KINOCKGT/3WCCV\,()CYGJP6)ØNJCP VKƄGFVWTDWNGPEG &KTGEVPWOGTKECNUKOWNCVKQPUCPF ##FCOU0# 0WOGTKECNCPFGZRGTKOGPVCN RTGFKEVKQPUD[NCTIGGFF[UKOWNCVKQP6JGQTGVKECN KPXGUVKICVKQPUQHRUGWFQUJQEMU[UVGOUKPCRNCPCT CPF%QORWVCVKQPCN(NWKF&[PCOKEU PQ\\NGs+ORCEVQHD[RCUUOCUUƅQYFWGVQPCTTQY ICRU ■ 4KGRGT(*KEMGN5#EJCV\7 #EQPUGTXCVKXG ■ )TKNNK/8C\SWG\3WGUCFC#'NNGTQ/ 6TCPUKVKQP KPVGITCVKQPQHVJGRUGWFQKPEQORTGUUKDNGGSWCVKQPU VQVWTDWNGPEGCPFOKZKPIKPCXKUEQGNCUVKEƅWKF YKVJKORNKEKVVWTDWNGPEGRCTCOGVGTK\CVKQP/QPVJN[ ƅQYKPIKPUKFGCEJCPPGNYKVJCRGTKQFKECTTC[QH 9GCVJGT4GXKGY E[NKPFTKECNQDUVCENGU2J[UKECN4GXKGY.GVVGTU ■ 5EJTCPPGT(5*W:;#FCOU0# #RJ[UKECNN[ EQPUKUVGPVYGCMN[EQORTGUUKDNGJKIJTGUQNWVKQP ■ )TKNNK/*KEMGN5#FCOU0# .CTIGGFF[ CRRTQCEJVQWPFGTTGUQNXGFUKOWNCVKQPUQHKPEQO UKOWNCVKQPQHUWRGTUQPKEVWTDWNGPVDQWPFCT[NC[GT RTGUUKDNGƅQYU%QORWVGTUCPF(NWKFU8QNWOG QXGTCEQORTGUUKQPGZRCPUKQPTCOR+PVGTPCVKQPCN ,QWTPCNQH*GCVCPF(NWKF(NQY ■ 5JK; 44 Institute of Aerodynamics and Fluid Mechanics Institute of Lightweight Structures Structural design concepts – structural simulation, optimization and experimental methods – adaptive and shape morphing structures ■ A focus in 2013-14 was to improve and generalize methods and appro- aches for shape morphing structures and to investigate a broader scope of their potential applications. In the area of design optimization methods, those combining structural mechanics and crash behavior with manufac- turing aspects have been developed. The latter is derived from qualitative information and transferred to numerical models. (QTVJGVCUMQHQRVKOCNOCVGTKCNUGNGEVKQP tion on related algorithms. For large space KPCFFKVKQPVQIGQOGVTKERCTCOGVGTU structures including deployable precision continuous-discrete optimization methods TGƅGEVQTUEQPEGRVUFGTKXGFHTQOFGUKIP have been further developed and demons- considerations and large scale simulations Univ. Prof. Dr.-Ing. VTCVGFYKVJVGUVGZCORNGU+PVJKUƄGNF are transferred to laboratory models Horst Baier a team of doctoral students received a to undergo severe environmental and winning award in a world-wide competi- EQPEGRVXGTKƄECVKQPVGUVU Contact www.llb.mw.tum.de [email protected] Phone +49.89.289.16103 Shape morphing structures Different methods are investigated to ation needs while the system is in orbit. handle the design ‘contradiction’ of shape As investigated in different studies for OQTRJKPIUVTWEVWTGUVQDGJKIJN[ƅGZKDNG VJG'WTQRGCP5RCEG#IGPE[ '5# OCP[ for morphing but also to be able to take micro-actuators induce deformations with high loads and keep the required shape a high spatial frequency and considerable accuracy. This results in special concepts CORNKVWFGUYJKNGVJGOQTRJKPITGƅGEVKPI which combine different materials together surface shall not undergo spurious thermal with design concepts based on highly deformations in space and has to have ƅGZKDNGMKPGOCVKEFGITGGUQHHTGGFQO proper electromagnetic properties. (QTGZCORNGVJGRJQVQUJQYUCUCPFYKEJ This has been achieved by an electromag- plate for aircraft control surfaces which PGVKEYCXGTGƅGEVKPIUWTHCEGOCFGQWVQH can undergo large in-plane deformations CURGEKCNECTDQPƄDGTTGKPHQTEGFUKNKEQPG while also being able to take large bending Results gained from simulation and loads. This is achieved by a net-type GZRGTKOGPVCNNCDQTCVQT[OQFGNCTGPQYVQ facesheet and a sandwich core with be further substantiated. certain kinematic degrees of freedom Shape morphable sandwich plates being manufactured by additive layer which also take high lateral and bending loads for aircraft wing technology. components Further investigations relate to morphing concepts for aircraft engine nacelles to KORTQXGVJGCKTƅQYVQKPETGCUGGHƄEKGPE[ while reducing noise. This EU project MorphElle is led by LLB with KTH 5VQEMJQNO7PKXQH$TKUVQNCPF$CWJCWU .WHVHCJTVCUVGCORCTVPGTU#URGEKƄECNN[ investigated challenge is the proper interaction of the circumferential shape OQTRJKPIKPNGVYKVJKORTQXGFCKTƅQYCPF possible reduction of radiated noise. 5JCRGOQTRJKPITGƅGEVQTUQHEQOOWPK- ECVKQPUCVGNNKVGUUJCNNCFCRVVJGKTTGƅGEVKPI #EQOOWPKECVKQPCPVGPPCTGƅGEVQTYKVJOKETQ shape to changing electromagnetic radi- actuators for in-orbit shape morphing Institute of Lightweight Structures 45 Large Space Structures A major challenge for large space structures lays in their dense packaging for launch and reliable and precise deployment and shape for proper functionality in orbit. This espe- cially holds for large deployable antenna TGƅGEVQTUNKMGVJCVUJQYPKPVJGƄIWTG6Q QDVCKPRTQRGTMKPGOCVKEUHWPEVKQPCNKV[CPF UVTWEVWTCNDGJCXKQTPGYV[RGUQHOCVGTKCNU are also investigated like special carbon ƄDGTTGKPHQTEGFƅGZKDNGUKNKEQPGOCVTKZ #NCTIGTGƅGEVQTFGRNQ[GFKPURCEG V[RKECNFKCOGVGTU 8-15 m) %ƄDGTTGKPHQTEGFUKNKEQPGCPF OCVGTKCNU6JGUGEQORQUKVGUCTGƅGZKDNG its micromechanical simulation enough for stowage but stiff enough to model (hole size around 1-2 mm) achieve double curved parabolic shapes in in-orbit attitude control system to com- orbit with good electric performance and pensate such small but highly undesirable GZVTGOGN[NQYVJGTOCNGZRCPUKQP6JGJQNGU disturbances. These investigations have in the material not only save mass but also led to a further startup company originating TGFWEGVJGGHHGEVKXGCTGCHQTUQNCTRTGUUWTG from LLB. This will advance the technolo- which then decreases the burden for the gies under more industrial conditions. Model based structural design optimization behavior have been determined and GZRGTKOGPVCNN[XGTKƄGFHQTFKHHGTGPVV[RGUQH JQOQIGPGQWUCPFƄDGTTGKPHQTEGFOGVCNU These investigations have been well complemented by those done in the SFB project TR 10. Methods to determine pro- per optimal cross-section shapes possibly with additional reinforcing materials for the Al-alloy base material and scattering properties of the crash absorber compo- PGPVUJCXGDGGPFGXGNQRGFCPFXGTKƄGF Simulation and optimization model Once the structural system behavior can *GZCIQPCNQTUKOKNCTETQUUUGEVKQP QHVJGDQF[KPYJKVGHQT67/oU DGUWHƄEKGPVN[YGNNOQFGNNGFRTQRGTKH UJCRGUHQTETCUJDQZGUJCXGUJQYP electric car together with its front crash absorber (in color) not optimal design parameters can be higher robustness against scattering data determined by nonlinear mathematical and properties. optimization methods. This often requires The simultaneous consideration also of JKIJEQORWVCVKQPCNGHHQTVGURGEKCNN[KP manufacturing aspects in such design the case of large and highly nonlinear optimization processes is demonstrated for dynamic simulation models as needed FKHHGTGPVJ[DTKFOCVGTKCNCPFECTDQPƄDGT to also cover crash impact. For such composite automotive structures as done ECUGURTQRGTOQFGNTGFWEVKQPVGEJPKSWGU HQTGZCORNGKPVJG5RKV\GPENWUVGT ENWUVGTQH JCXGDGGPFGXGNQRGFYJKEJVQIGVJGT GZEGNNGPEG /#+ECTDQP/GVJQFUVQVTCPU- with parallelized optimization techniques fer qualitative knowledge into mathematical running on many computer processors models for calculating the manufacturing simultaneously then reasonably limit the effort as function of design optimization computational effort. variables have been favorably combined (QTUWHƄEKGPVN[RTGEKUGUKOWNCVKQPOQFGNU with structural simulation models to obtain material models covering crash impact comprehensive optimal designs. 46 Institute of Lightweight Structures Research Focus Management ■ Adaptive and shape morphing struc- 2TQH*QTUV$CKGT&KTGEVQT tures ■ Hybrid material structures Adjunct Professors ■ Large Space structures Prof. Dr. Pierre Mertiny ■ Model based design optimization Prof. Dr. Rudolf Schwarz methods Administrative Staff Competence Amely Schwörer ■ Adaptive structures and smart materials ■ Design optimization methods Research Scientists ■ Structural mechanics and design &KRN+PI,QJCPPGU#EJNGKVPGT concepts Dr. Valeria Antonelli ■ Mechanical and environmental testing &KRN+PI.WK\FC4QEJC5EJOKFV &T.GTK&CVCUJXKNKUGPKQTTGUGCTEJ Infrastructure scientist ■ Computer cluster with 250 processors &KRN+PI5VGRJCP'PFNGT ■ CAD and several FEM tools &KRN+PI/CVVJKCU(TKGOGN ■ Dynamic simulation tools Lali Gigineishvili ■ Design optimization tools #PFTGCU*GTOCPWV\/5E ■ 9QTMUJQRHQTOGVCNCPFƄDGTEQORQ- &KRN+PI2GVGT-TGORN site parts 6CQ.WQ/5E ■ Mechanical and environmental test 0KMQNQ\/CIJCNFCF\G/5E facilities incl. cryogenic temperatures &KRN+PI/CTVKP/CJN ■ 'ZVGPUKXGOGCUWTGOGPVU[UVGOU &KRN+PI#NGZCPFGT/QTCUEJ ■ Non-destructive materials and parts &KRN+PI)WPCT4GKPKEMG inspection &KRN+PI$GTPJCTF5CWGTGT &KRN+PI/CTMWU5EJCV\ Courses .KCPI5K/5E ■ Leichtbau &KRN+PI*QNIGT5VCCEM ■ Luft- und Raumfahrtstrukturen &KRN+PI(GNKZ5VTQUEJGT ■ Multidisciplinary Design Optimization 6CPWV7PIYCVVCPCRCPKV/5E ■ Adaptive Strukturen 'TKEJ9GJTNG/5E ■ Faserverbundwerkstoffe &KRN+PI4CKPGT9GJTNG ■ Membranstrukturen $KP9GK/5E ■ Betriebsfestigkeit &KRN+PI/CVVJKCU9GKP\KGTN ■ Multifunctional Polymer Parts ■ 8KDTQ#MWUVKMWPF.ÀTO Technical Staff Manfred Bauer &KRN+PI (* -CTN.WFYKI-TÀOGT Bernhard Lerch Christian Mörlein Dirk Steglich ,QUKR5VQMKE Institute of Lightweight Structures 47 Publications 2013-14 Reviewed Papers ■ 'PFNGT5 &CVCUJXKNK. $CKGT* 4QQUG5 'PJCP- ■ /QTCUEJ# /CVKCU& $CKGT* /CVGTKCN EGOGPVQHVJG'NGEVTQ/CIPGVKE$GJCXKQWTQH(NGZKDNG OQFGNNKPIHQTETCUJUKOWNCVKQPQHVJKPGZVTWFGF (KDGT%QORQUKVG/CVGTKCNUD[5WTHCEG%QCVKPI CNWOKPKWOUGEVKQPU+PVGTPCVKQPCN,QWTPCNQH%TCUJ +PVGTPCVKQPCN%QPHGTGPEGQP#FXCPEGF.KIJVYGKIJV YQTVJKPGUU&1+ 5VTWEVWTGUCPF4GƅGEVQT#PVGPPC6DKNKUK ■ ■ /QTCUEJ# 9GFGMKPF/ /CVKCU& $CKGT* (TKGOGN/ $CKGT*6JGTOCN6GUVKPIQH%(427PFGT 6JGTOQOGEJCPKECNDGJCXKQTCPFOCVGTKCN #*KIJ0WODGTQH6GORGTCVWTG%[ENGU'5#%QPHGT HCKNWTGQHUVGGNYKTGTGKPHQTEGFCNWOKOWO2TQEGFKC GPEGQP5RCEG5VTWEVWTGU/CVGTKCNUCPF6GUVKPI ■ %+42 RR +JNG# &CVCUJXKNK. 5EJOKFV, *CTVOCPP& ■ FC4QEJC5EJOKFV. *GTOCPWV\# $CKGT* 2TQKGVVK 48 Institute of Lightweight Structures Institute of Ergonomics &GƄPKVKQPCPFGXCNWCVKQPQHJWOCPOCEJKPGKPVGTCEVKQPCPFCPVJTQRQOGVTKENC[QWV QHVGEJPKECNU[UVGOU5CHGV[GHƄEKGPE[QHWUGCPFWUGTUCVKUHCEVKQP ■ The focus of the Institute of Ergonomics in 2013-14 was to stabilize and increase the activities in the area of cooperative interaction between human and vehicle or human and robots on an global level. This was possible as national and international funded project proposals were successful to continue the basic research at the institute funded by DFG. The second focus was to successfully A highlights were the launch of an reinitiate the engagement of anthropo- individualized 3D printed thumb support metrics and biomechanics in the area of for workers in automotive production. production ergonomics. The launch of our open source Arduino Furthermore the institute organized the Detection-Response-Task (DRT) and annual spring conference of the Gesell- Mobile Detection Task (MDT) for Android 2TQH&TRJKN schaft für Arbeitswissenschaft 2014 in Smartphones. -NCWU$GPINGT cooperation with the University of Applied Sciences Munich. %QPVCEV www.ergonomie.tum.de [email protected] Phone +49.89.289.15388 %QQRGTCVKXG5[UVGOUCPF#WVQOCVKQP Advances in data acquisition and data processing technologies enabled the development of automated and coop- erating human machine systems. On one hand (from technical view) cooperation and automation are a logical development of individual assistance systems, while (on the other hand) from an ergonomics perspective represent a paradigm shift to driver-vehicle interaction. This research group aims at a holistic view of coop- Projects erative and automated systems whose ■ ASHAD (automation and society – functionalities are no longer considered as highly automated driving) isolated assistance functions. Such inte- ■ HFAuto – human factors of automated grated systems will cause drastic changes driving in the tasks of the operator, the man- ■ SaMSys – safety management system machine interaction and the associated in aviation user interface and interaction technologies ■ H-Mode2KFF – from H-Mode to in the future. cooperative vehicle guidance 6QKPETGCUGUCHGV[EQOHQTVCPFGHƄEKGPE[ ■ KobotAERGO – adaptive collaborative of socio-technical systems and to provide robots as age-adjusted companion a framework for social and legal discussi- HQTCPGTIQPQOKECPFƅGZKDNGOCVGTKCN ons, it is important not only to investigate handling the functional development or the limits ■ .KHVKPI#KFsFGXGNQROGPVCPFXGTKƄEC- of automation, but also the exploration of tion of a body-worn lifting equipment the potentials and limitations of human for work support performance in collaboration with the automation (Haslbeck et al., 2012). Institute of Ergonomics 49 &TKXGT#UUKUVCPEG5[UVGOU the ADAS research is to support the driver KPWTDCPVTCHƄE6JGUGKPENWFGVJGKPVGTUGE- VKQPCUUKUVCPVVJGVTCHƄENKIJVCUUKUVCPVNGHV turn assistant or systems to reduce fuel consumption, which are developed under the projects KOLIBRI or eCoMove. In the project FAS Akzeptanz (ADAS Accep- tance), the use and acceptance of driver assistance systems already in the market have been examined with the aim of identi- -1.+$4+VTCHƄENKIJVCUUKUVCPVQPOQDKNGFGXKEG H[KPIVJGDCTTKGTUQHVJGFTKXGTU+PVJGƄGNF Reference: Andreas Haslbeck of display technologies new display options such as the use of contact-analogue Due to the mass production in the head-up displays are investigated. automotive industry, a high degree of individual mobility is reached. This mass Projects mobilization is accompanied by many ■ eCoMove – cooperative mobility sys- economic disadvantages (e.g. increased VGOUCPFUGTXKEGUHQTGPGTI[GHƄEKGPE[ number of accidents, environmental ■ Urban Space: user oriented assistance pollution, and longer travel times). These systems and network management social costs must be reduced in the future ■ Usage of augmented reality technology to maintain or even improve the quality for assisting drivers of industrial trucks QHKPFKXKFWCNOQDKNKV[#UKIPKƄECPVUJCTG ■ Local4Global – system-of-systems that of it can be done by the driver assistance act locally for optimizing globally systems (ADAS). ■ KOLIBRI – cooperative optimization Research in this area focuses on the QHVTCHƄEUKIPCNEQPVTQNsDCXCTKCPRKNQV development and evaluation of existing project and future cooperative driver assistance ■ Optimized display concepts for a systems with the aim to assist the driver in contact analog head-up display terms of perception, action planning, and ■ Heat Vision vehicle interaction. Currently the focus of *WOCP/QFGNKPI siological, anthropometrical and cognitive models is the main task of the described research group ‘Human Modeling’. Bio- mechanics, physiology and anthropometry can already be precisely modelled and simulated. Therefore, reliable predictions QHVJGKPƅWGPEGQHUKPINGHCEVQTUQP discomfort, load, workload and human Visualisation of different digital human models performance are possible. Human beings are complex systems, whose parameters Today, emerging ergonomic problems in ECPKPƅWGPEGGCEJQVJGT(QTKPUVCPEG product and workspace designs can be discomfort and workload depend on an UQNXGFQTGXCNWCVGFOQTGGHƄEKGPVN[CPF interaction of factors. Basic research, competitively with digital human models. crosslinking individual systems, modeling The development of biomechanical, phy- approaches and application-oriented 50 Institute of Ergonomics studies are used for a further development Projects of physical, numerical and theoretical ■ UDASim – global discomfort assess- OQFGNU&KHHGTGPVƄGNFUQHCRRNKECVKQPHQT ment for vehicle passengers by as holistic as possible models are auto- simulation motive, mobility, production, logistics and ■ visio.m sports. The research activities consider in ■ .KHVKPI#KFsFGXGNQROGPVCPFXGTKƄEC- addition to objective parameters of load, tion of a body-worn lifting equipment also workload and subjective measures, for work support as comfort and discomfort. /QVKXCVKQPCPF%QIPKVKQP motivation in his model of human perfor- OCPEG ƄTUVN[VJGOQVKXCVKQPVJCVKUTQQVGF in the individual, can be supported and maintained by the motivation to others but also appropriate organizational framework. This may concern, for example the design of tasks in context of school. How can instructions be designed to stimulate employment? How can teaching be organized to motivate students for long Ergonomic tool-kit for classroom measurements by VKOG!6JGƄPFKPIUJGNRVQFGUKIPNGCTPKPI pupils (funded by TÜV Süd Stiftung) environments in a way that people select, initiate and/or continue desired learning Motivational design of learning environ- activities. The motivation research offers a ments is a central topic for information variety of starting points. socities. The focus is on learning environ- ments in school, study and training. Projects Motivation is an essential prerequisite for ■ AUVA: age-based workplaces for small the provision of power and thus has a and medium-sized enterprises direct reference to ergonomics. Schmidtke ■ Ergonomics for classrooms: The (1993, p.112) points out two aspects of ergonomic tool-box 7UCDKNKV[CPF7UGT'ZRGTKGPEG The main focus of the research on WUCDKNKV[CPFWUGTGZRGTKGPEGKUVJGƄPFKPI and understanding of different factors of human machine interface design and their effects on usability and user experi- ence. A basic requirement for consistent EQOOWPKECVKQPCPFTGUGCTEJKUCEQPƄPGF FGƄPKVKQPCPFFKHHGTGPVKCVKQPQHVJGVGTOU usability and user experience. It is the foundation for fundamental research which aims at identifying relevant factors that can be adjusted to optimize human Haptic touchpad for automotive infotainment systems machine interaction. This is of importance (Blattner 2013) Institute of Ergonomics 51 because current use of the terms shows recommendations for industrial use and strong ambiguity and overlap, is a source consumer products differ widely. of misinterpretation and complicates The group contributes to a general consistent attribution of design factors. propagation of ergonomic product design The research at the Institute of Ergono- by taking part in standard publishing mics mainly consists of experiments with committees (e.g. VDI 3850). software on touchscreen devices. For those design recommendation and style Projects guides are postulated, evaluated and ■ Optimized handling of a car-infotain- combined with the goal of easing human ment-system using a touchpad with machine interface design and establishing haptic feedback well-grounded basic rules. Use cases that ■ GE³STIK – guidelines for an ergonomic are concerned include production environ- FGUKIPCPFƅGZKDNGU[UVGOCTEJKVGEVWTG ments, robot programming, human car of touch screen interaction interaction, home appliances. An import- ant goal of the research is evaluating general validity of style guides because &TKXKPI&[PCOKEU2GTEGRVKQP driving behavior. Competing development goals like sportiness and driving dynamic are facing demands to reduce CO2-emis- sions and fuel consumption and affect the dynamic characteristics of a vehicle UKIPKƄECPVN[#NVGTPCVKXGFTKXGEQPEGRVU create new demands on the design of the vehicle dynamics and corresponding interaction interfaces for the user, which have to be investigated ergonomically with G/7%C/WPKEJƄGNFVTKCNYKVJ/+0+'GNGEVTKE UEKGPVKƄEOGVTKEU vehicles One of the main objectives in this research ITQWRKUVJGSWCPVKƄECVKQPQHVJGJWOCP Concerning the base functionality, perceptual performance concerning especially in the premium segment, the vehicle dynamics. Regarding the driver as current vehicle development is located on the controller in the driver-vehicle control a very high level. There is a trend towards loop, the basic interactions of vehicle active design of driving experience and dynamics and driver behavior (driving EWUVQOGTURGEKƄERCTCOGVGTK\CVKQPQH style) are investigated in naturalistic individual vehicle characteristics. This driving studies. This provides recommen- trend suggests a user-centered vehicle dations for the design of future vehicles development, in contrast to technology- and the optimization of driver assistance centered development of the past. The systems. A special application for the dynamics of the vehicle as well as its longitudinal dynamic tuning can be found RGTEGRVKQPD[VJGFTKXGTRNC[UCUKIPKƄECPV KPVJGƄGNFQHGNGEVTKEOQDKNKV[CUCHTWICN role in many respects. use of the available energy is of great Advancements in drive technology, both importance here. in terms of downsizing measures, as well as to electric drives, raise the question of Project how the driver perceives these changes ■ G/7%sC/WPKEJƄGNFVTKCNYKVJ/+0+' and how these perceptions affect the electric vehicles 52 Institute of Ergonomics 4GUGCTEJ(QEWU #FOKPKUVTCVKXG5VCHH ■ Digital human modeling for ergonomic Simona Chiritescu-Kretsch anthropometric workplace layout Doris Herold ■ Biomechanical modelling of forces on Julia Fridgen LQKPVURGEKƄENGXGN Elfriede Graupensberger ■ Investigation of interaction concepts HQTGHƄEKGPVEQQRGTCVKQPYKVJHWVWTG 4GUGCTEJ5EKGPVKUVU assistance systems and highly automa- Dr.-Ing. Herbert Rausch ted systems Dipl.-Ing. Martin Albert ■ Investigation of multimodal inter- Carmen Aringer M.A. action, concepts for human machine Dipl.-Ing. Jurek Breuninger interaction Benedikt Brück M.Sc. ■ Development of measurement metrics Antonia Conti M.Sc. ■ Research on motivational aspects of Dipl.-Ing. Ilja Feldstein user behavior Patrick Galaske M.Sc. Dipl.-Ing. Christian Gold %QORGVGPEG Joel Gonçalves M.Sc. ■ Interdisciplinary research approach Dipl.-Ing. Patrick Gontar ■ Development of evaluation methods, Dipl.-Ing. Martin Götze models and implementation of inter- Dipl.-Ing. Andreas Haslbeck action concepts in the areas anthro- Dipl.-Ing. Magnus Helmbrecht pometry/biomechanics as well as Dipl.-Ing. Uwe Herbst cognitive ergonomics Christin Hölzel M.A. Dipl.-Sportwiss. Marius Janta M.Sc. +PHTCUVTWEVWTG Ralf Kassirra ■ Static driving simulator mockup Dipl.-Ing. Verena Knott ■ Static driving simulator (360° fov) Dipl.-Psych. Moritz Körber ■ Remote and head mounted eye Dipl.-Ing. Michael Krause M.Sc. trackers Dipl.-Ing. Florian Kremser ■ Pupil dilation measurement equipment Dipl.-Ing. Alexander Lange ■ 8+%10OQVKQPECRVWTKPIU[UVGO Dipl. Wirtsch.-Ing. Christian Lehsing M.Sc. ■ Seating lab Bastiaan Petermeijer M.Sc. ■ Driver distraction usability lab Lisa Pfannmüller M.Sc. ■ Climate chamber Dipl.-Inf. Severina Popova-Dlugosch ■ Biomechanical laboratory Dipl.-Ing. Jonas Radlmayr Dipl.-Ing. Christoph Rommerskirchen Courses Dipl.-Ing. Jonas Schmidtler ■ Arbeitswissenschaft/Ergonomie &KRN+PH0CFKPG9CNVGT ■ Produktergonomie (Master) Dipl.-Ing. Sebastian Smykowski ■ Produktionsergonomie (Master) Dipl.-Ing. Paul Stuke ■ Menschliche Zuverlässigkeit (Master) Dipl.-Ing. Annika Ulherr ■ Human Factors – Ergonomie (Master) Dipl.-Ing. Thomas Weißgerber Dipl.-Ing. Matthias Wiedemann /CPCIGOGPV Dipl.-Ing. Albert Zaindl Prof. Dr. phil. Klaus Bengler, Director Dipl.-Medieninf. Markus Zimmermann #FLWPEV2TQHGUUQTU 6GEJPKECN5VCHH Prof. Dr.-Ing. Markus Maurer Michael Arzberger Heribert Hart Papist Robert Institute of Ergonomics 53 2WDNKECVKQPU ■ Akamatsu, Motoyuki; Green, Paul; Bengler, Klaus, ■ Manstetten, D.; Bengler, K.; Busch, F.; Färber, B.; Automotive Technology and Human Factors .GJUKPI% 0GWMWO# 5EJGPF\KGNQT\674 $#0 Research: Past, Present, and Future, International – a German project focusing on human factors to Journal of Vehicular Technology, 2013, Volume 2013 KPETGCUGVTCHƄEUCHGV[KPWTDCPCTGCU2TQEGGFKPIU ■ Bortot, D.; Born, M.; Bengler, K., Directly or of the 20th ITS World Congress, Tokyo, Japan, 2013 on Detours? How Should Industrial Robots ■ Müller, T.; Hajek, H.; Radic-Weissenfeld, L.; Approximate Humans?, 89-90, Proceedings of Bengler, K., Can You Feel the Difference? The Just the 8th ACM/IEEE International Conference on 0QVKEGCDNG&KHHGTGPEGQH.QPIKVWFKPCN#EEGNGTCVKQP Human-Robot Interaction, Tokio, Japan, 8th ACM/ Proceedings of the Human Factors and Ergonomics IEEE International Conference on Human-Robot Society 57th Annual Meeting, HFES 2013, San Interaction, 2013 Diego, USA, 2013 ■ Breuninger, Jurek; Popova-Dlugosch, Severina; ■ Popova-Dlugosch, S.; Breuninger, J.; Lemme, B.; Bengler, Klaus, The Safest Way to Scroll a List: Bengler, K., Is Walking Bad for Tablet Use or Is A Usability Study Comparing Different Ways of Tablet Use Bad for Walking? An Experimental Study Scrolling Through Lists on Touch Screen Devices, on the Effect of Walking on Tablet Use, Analysis, Analysis, Design, and Evaluation of Human- Design, and Evaluation of Human-Machine Systems Machine Systems 2013, Las Vegas, USA, Elsevier, 2013, International Federation of Automatic Control, IFAC, 2013 Elsevier, IFAC, 2013 ■ Damböck, D.; Weissgerber, T.; Kienle, M; Bengler, ■ Rommerskirchen, Ch.; Helmbrecht, M.; Bengler, K., Requirements for Cooperative Vehicle Guidance, Klaus, Increasing complexity of driving situations Proceedings of the 16th International IEEE Annual and its impact on an ADAS for anticipatory Conference on Intelligent Transportation Systems. assistance for the reduction of fuel consumption: +65%6JG*CIWG6JG0GVJGFGTNCPFU Symposium, Proceedings of the IEEE Intelligent Oct. 2013 Vehicle Symposium, Gold Coast, Australia, 23-26 ■ Eichinger, A.; Kellerer, J., Between laboratory and June; Symposium, 2013 simulator: a cognitive approach to evaluating cockpit ■ Zimmermann, M.; Bengler, K., A Multimodal interfaces by manipulating informatory context, Interaction Concept for cooperative Driving: Sym- Cognition, Technology & Work, 2013, Oct posium, Proceedings of the IEEE Intelligent Vehicle ■ Gold, C.; Damböck, D.; Lorenz, L.; Bengler, K., Take Symposium, Gold Coast, Australia, Symposium, Over! How Long Does It Take to Get the Driver Back 2013 Into the Loop?, Proceedings of the Human Factors ■ Beck, J.; Eichinger, A.; Bengler, K., Trait, state or and Ergonomics Society 57th Annual Meeting, artefact? Assessing experts’ regulatory focus in HFES 2013, San Diego, USA, 2013 nuclear power plant control, Cognition, Technology ■ Götze, Martin; Conti, Antonia S.; Keinath, Andreas; & Work, 2014, 1-10 [2/17]: Eichinger, A.; Bengler, 5CKF6CTGM $GPINGT-NCWU'XCNWCVKQPQHC0GY K., Representations and operations: parts of the Cockpit Color Concept under Mesopic Lighting for problem and the solution: Comments on J.C.F. de Urban Driving, Design, user experience, and usabi- Winter: Controversy in human factors constructs NKV[.CU8GICU0875#5RTKPIGT$GTNKP*GKFGNDGTI CPFVJGGZRNQUKXGWUGQHVJG0#5#6.: COGCUWTG 2013 ment perspective, Cognition, Technology & Work, ■ Haslbeck, A, Eichinger, A., Bengler, B., Pilot 2014 Decision Making: Modeling Choices in Go-Around ■ )QNF% .QTGP\. $GPINGT-+PƅWGPEGQH#WVQ- Situations, 548-553, Proceedings of the 17th Inter- mated Brake Application on Take-Over Situations in national Symposium on Aviation Psychology, 17th Highly Automated Driving Scenarios, Proceedings International Symposium on Aviation Psychology, of the FISITA 2014 World Automotive Congress, 2013 /CCUVTKEJ0GVJGTNCPFU,WPG ■ Helmbrecht, Magnus; Bengler, Klaus; Vilimek, ■ Haslbeck, A.; Kirchner, P.; Schubert, E.; Bengler, K., 4QOCP#FCRVCVKQPUKP&TKXKPI'HƄEKGPE[YKVJ A Flight Simulator Study to Evaluate Manual Flying Electric Vehicles, Human-Computer Interaction. Skills of Airline Pilots, Proceedings of the Human Applications and Services – 15th International Factors and Ergonomics Society (HFES) 2014, %QPHGTGPEG*%++PVGTPCVKQPCN.CU8GICU08 Chicago, Illinois, USA, 27.10.-31.10.2014, SAGE USA, July 21-26, 2013, Proceedings, Part II, Las Journals, 2014 8GICU0875#5RTKPIGT ■ Helmbrecht, M.; Olaverri-Monreal, C.; Bengler, ■ Herbst, Uwe; Rühl, Steffen Wilhelm; Hermann, K.; Vilimek, R.; Keinath, A., How Electric Vehicles Andreas; Xue, Zhixing; Bengler, Klaus, Ergonomic Affect Driving Behavioral Patterns, IEEE Intelligent 6D Interaction Technologies for a Flexible and Transportation Systems Magazine. Special Issue on Transportable Robot System: A Comparison, Ana- Electro-Mobility, 2014, 22-32 lysis, Design, and Evaluation of Human-Maschine ■ Radlmayr, J.; Gold, C.; Lorenz, L.; Farid, M.; Systems 2013, Elsevier, IFAC, 2013 $GPINGT-*QY6TCHƄE5KVWCVKQPUCPF0QP&TKXKPI ■ Kienle, M.; Damböck, D.; Bubb, H.; Bengler, K., The Related Tasks Affect the Take-Over Quality in Highly ergonomic value of a bidirectional haptic interface Automated Driving, Proceedings of the Human when driving a highly automated vehicle, Cognition, Factors and Ergonomics Society (HFES) 2014, Technology & Work, 2013, 15 (4), 15, 475-482 Chicago, Illinois, USA, 27.10.-31.10.2014, SAGE ■ -TCWUG/ $GPINGT-/[2JQPG/[%CTCPF|+ Journals, 2014 s#PF/C[DGC6TCHƄE.KIJV#UUKUVCPV+%1056JG 8th International Conference on Systems, Seville, Spain, 2013 ■ Körber, M.; Eichinger, A.; Bengler, K; Olaverri Monreal, C., User Experience Evaluation in an Automotive Context, IEEE Intelligent Vehicles Symposium Workshops, Gold Coast, Australia, 2013 54 Institute of Ergonomics Bioseparation Engineering Group Process development, particle synthesis and functionalization, and extraction ■ The Bioseparation Engineering Group deals with different aspects of VJGKUQNCVKQPCPFRWTKƄECVKQPQHDKQOQNGEWNGU1PGHQEWUKPYCU VQGUVCDNKUJUGXGTCNPGYOGVJQFUHQTRCTVKENGCPFUWTHCEGEJCTCEVGTK\CVKQP PQVQPN[KPUKFGVJGITQWRKVUGNHDWVCNUQQPVJGYJQNG)CTEJKPIECORWU +PCFFKVKQPVQCFUQTRVKXGUGRCTCVKQPVGEJPKSWGUGZVTCEVKQPYKNNDGCPGY TGUGCTEJƄGNFQHVJGITQWR One highlight was the start of the BMBF 6GEJPQNQI[ -+6 6JGCKOQHVJKUJKIJTKUM ƄPCPEGFVCPFGORTQLGEV 'WTQOKNNKQP project is to develop a web-based tool for CV67/ YKVJVJG-CTNUTWJG+PUVKVWVGQH designing surface-selective peptides. Prof. Dr. Sonja Berensmeier New Stationary Phases Contact YYYDKQXVOYVWOFG 0GYUVCVKQPCT[RJCUGUCTGGUUGPVKCNKP selektive-trenntechnik DKQUGRCTCVKQPUEKGPEGU ENCUUKECNRJCUGU [email protected] 2JQPG CTGCNTGCF[YGNNFGXGNQRGFCPFTGCEJ VJGKTNKOKVU6JG$KQUGRCTCVKQP'PIKPGGTKPI )TQWRKUURGEKCNK\GFQPU[PVJGUKUCPF functionalization of magnetic particles and conductive materials as well as their process implementation. Making use of OCIPGVKUOQTEQPFWEVKXKV[CNNQYUHQTCP additional degree of freedom for state-of- the-art process development. Projects 5'/QHOWNVKYCNNECTDQPPCPQVWDGU ■ #K(+()2TQLGEVs5[PVJGUKUEJCTCEVGTK- \CVKQPCPFCRRNKECVKQPQHPGYUVCVKQPCT[ phases for potential-controlled chro- OCVQITCRJ[ Functional Interfaces In separation sciences the interaction of Projects particulate carriers among each other and ■ $/$($KQVGEJPQNQI[ KPKVKCVKXG to target molecules is essential for process – Rational design of peptide-surface development. Selective interactions as interactions well as high binding capacities of target ■ #K(<+/s56'2/#) 8GTHCJTGPWPF molecules to solid phases determine the /GUUIGTÀV\WT3WCPVKƄ\KGTWPIFGTOCI- ƄPCNRWTKV[CPF[KGNFCPFVJGTGHQTGVJG netischen Mobilität von Nanomaterialen SWCNKV[KPYJQNGQHVJGUGRCTCVKQPUVGR WPFFGTGP8GTVGKNWPI In contrast, uncontrolled aggregation of ■ &GXGNQROGPVQHPGYUVCVKQPCT[RJCUGU particles decreases process performance HQTCPVKDQF[RWTKƄECVKQP EQPEGTPKPITQDWUVPGUUTGRTQFWEKDKNKV[ CPFUECNCDKNKV[#NNVJGUGCURGEVUCTGOCKP focus topics of our projects. 5KOWNCVKQPQHRGRVKFG 5QWTEG 2TQH&T9GP\GN-+6 Bioseparation Engineering Group 55 Process Development In addition to the optimization of classical downstream processes new innovative separation techniques as well as integra- ted process concepts are subjects under TGUGCTEJ#HQEWUCTGCKUVJGTGUGCTEJ on high-gradient magnetic separation and membrane assisted extraction with HQEWUQPXKUEQWUOGFKCYKVJJKIJN[UQNKF content. Projects ■ $/$(2TQLGEVs0GYGP\[OGTGE[ENKPI strategies in industrial processes *KIJITCFKGPVOCIPGVKEUGRCTCVQTKUNQECVGFCVVJG ■ $/$(G $KQKPKVKCVKXGs5[U$KQ6GTRs TUM Research Center for Industrial Biotechnology Innovative strategies for a sustainable production of bioactive molecules ■ 8GTHØIWPIUHQPF/9s2TGRCTCVKXG RWTKƄECVKQPQHICUVTKERQTEKPGOWEKPGU Research Focus Infrastructure: ■ Downstream processing ■ 5s.CDU 9QTMKPIYKVJIGPGVKEECNN[ ■ Bioprocess integration OQFKƄGFOKETQQTICPKUOUsUCHGV[ ■ High-gradient magnetic separation NGXGN| ■ New magnetic or conductive particles ■ 2CTCNNGNDKQTGCEVQTU[UVGO ■ Optimization of chromatographic ■ High-gradient magnetic separator processes *)/5 ■ Biomolecule-surface-interaction ■ &KXGTUGEJTQOCVQITCRJ[CPFƄNVTCVKQP ■ 'ZVTCEVKQP U[UVGOU ■ 2CTVKENGUWTHCEGCPCN[VKEU &.5$'6 Competence 4#/#06)#/5EQPVCEVCPING ■ 5[PVJGUKUCPFEJCTCEVGTK\CVKQPQHPCPQ VGPUKQOGVT[ and microparticles ■ *2.%U[UVGOU ■ Surface functionalization ■ Magnetic separation and automation Courses ■ Fermentation ■ $KQUGRCTCVKQP'PIKPGGTKPI+ ++ ■ /QNGEWNCTDKQNQI[/KETQDKQNQI[ ■ $KQVGEJPQNQI[HQT'PIKPGGTU $KQEJGOKUVT[ ■ 2TCEVKECN6TCKPKPIQP$KQRTQEGUU ■ Simulation with COSMO-RS, COMSOL 'PIKPGGTKPI /WNVKRJ[UKEUCPF5WRGT2TQ&GUKIPGT ■ 2TCEVKECN6TCKPKPIQP2CTVKEWNCTG 0CPQVGEJPQNQI[ ■ 2TCEVKECN6TCKPKPIQP2TGRCTCVKXG %JTQOCVQITCRJ[ 56 Bioseparation Engineering Group Management &T2CWNC(TCIC)CTEKC 2TQH&T5QPLC$GTGPUOGKGT&KTGEVQT Dipl.-Chem. Matthias von Roman Lars Janoschek, M.Sc. Administrative staff Dipl.-Ing. Hans-Christian Roth /TU5WUCPPG-WEJGPDCWT6GCO#UUKUVCPV 8GTQPKMC5EJÒOKI/5E Sebastian Schwaminger, M.Sc. Research Scientists Silvia Blank, M.Sc. Technical Staff Markus Brammen, M.Sc. &KRN+PI (* #FTKCP4CWUEJGPDCEJ -GTUVKP&KGNGT/5E Publications 2013-14 ■ (TCIC)TCEÉC2(TGKJGTTXQP4QOCP/4GKPNGKP5 Reviews: 9QNH/$GTGPUOGKGT5 +ORCEVQHPCPQRCTVKENGCI ■ 2GWMGT76JQOCU1*QDNG[6(TCP\TGD/ ITGICVKQPQPRTQVGKPTGEQXGT[VJTQWIJCRGPVCFGP- $GTGPUOGKGT55EJÀHGT/*KEMUVGKP$ $KQUGRCTC- VCVGEJGNCVGNKICPFQPOCIPGVKEECTTKGTU#%5#RRN tion, Magnetic particle adsorbents, book chapter, /CVGT+PVGTHCEGU s 'PE[ENQRGFKCQH+PFWUVTKCN$KQVGEJPQNQI[,QJP ■ Janoschek L, Freiherr von Roman M, Berensmeier 9KNG[5QPU 5 2TQVGKP#CHƄPKV[RTGEKRKVCVKQPQHJWOCPKOOWPQ- ■ *G[F/-QJPGTV#6CP6*0WUUGT/-KTUEJJÒHGT INQDWNKP),%JTQOCVQIT$ ($TGPPGT9GKUU)(TCP\TGD/$GTGPUOGKGT5 ■ (TGKJGTTXQP4QOCP/$GTGPUOGKGT5 +ORTQXKPI &GXGNQROGPVCPFVTGPFUQHDKQUWTHCEVCPUCPCN[UKU VJGDKPFKPIECRCEKVKGUQHRTQVGKP#EJTQOCVQITCRJKE CPFRWTKƄECVKQPWUKPITJCOPQNKRKFUCUGZCORNG OCVGTKCNUD[OGCPUQHNKICPFRQN[OGTK\CVKQP, TGXKGY#PCN$KQCPCN%JGO %JTQOCVQIT# ■ )KTTDCEJ//GNKEKCPK+9CVGTMQVVG$$GTVJQNF5 ■ $GTGPUOGKGT5 /CIPGVKERCTVKENGUHQTUGRCTCVKQP 1UVGT#$TWTGKP(5VTWPM69CFJYCPK2$GTGPU- CPFRWTKƄECVKQPQHPWENGKECEKFOQNGEWNGUTGXKGY OGKGT59GP\GN95EJOKV\- #ƅWQTGUEGPEG #RRN/KETQDKQN$KQVGEJPQN RQNCTK\CVKQPCUUC[HQTVJGGZRGTKOGPVCNXCNKFCVKQPQH CPKPUKNKEQOQFGNQHVJGEJGOQMKPG%:%.DKPFKPI VQTGEGRVQTFGTKXGFRGRVKFGU2J[U%JGO%JGO 2J[U ■ (TGKJGTTXQP4QOCP/-QNNGT#XQP4ØFGP& $GTGPUOGKGT5 +ORTQXGFGZVTCEGNNWNCTGZRTGUUKQP CPFRWTKƄECVKQPQHTGEQODKPCPV5VCRJ[NQEQEEWU CWTGWURTQVGKP#2TQVGKP'ZRT2WTKH Bioseparation Engineering Group 57 Wind Energy Institute Wind energy technology ■ The Wind Energy Institute (WEI) was founded in 2013. Focus of the +PUVKVWVGKPKVUƄTUV[GCTQHQRGTCVKQPYCUVJGFGXGNQROGPVQHCEQORNGVGN[ PGYVGCEJKPIRTQITCOKPYKPFGPGTI[EQPUKUVKPIQHUGXGTCNPGYFGFK ECVGFEQWTUGUCPFCEWVVKPIGFIGTGUGCTEJCEVKXKV[ 9'+JCUFGƄPGFHQWTJKIJN[KPVGTEQPPGEVGF VJGPGZVGFKVKQPQHVJGOCKPUEKGPVKƄE thrust areas where it is concentrating its conference in wind energy worldwide. The research activities: simulation, testing, con- award of the organization of this major trol and design. The Institute works both event is an important recognition of the QPDCUKEUEKGPVKƄECPFCRRNKECVKQPQTKGPVGF standing of TUM in the wind energy scien- problems, often in close collaboration VKƄEEQOOWPKV[UQQPCHVGTVJGHQWPFKPI Prof. Dr. YKVJKPFWUVT[#TGCUQHURGEKƄEGZRGTVKUG of WEI. Carlo L. Bottasso GODTCEGCNNOCKPTGNGXCPVUEKGPVKƄEFKUEKR- Another highlight was the award of a lines, including aerodynamics, structures, contract with a major wind turbine manu- Contact dynamics, materials, controls and electrical facturer, which aims at demonstrating in aspects. The Institute staff has also a VJGƄGNFCPGYYKPFUGPUKPIVGEJPQNQI[ www.wind.mw.tum.de [email protected] unique experience in the development of invented by WEI staff. The technology, Phone +49.89.289.16681 scaled wind turbine and wind farm models which measures wind conditions by using for wind tunnel testing, which are among load sensors available on board modern the most sophisticated ever developed for wind turbines, enables smart control stra- these applications. tegies of individual machines or complete A highlight of the year was the award to wind farms. TUM of the organization of Torque 2016, Scaled Wind Turbine and Wind Farm Testing WEI has developed a scaled experimental facility, for the simulation of wind turbines and wind farms in a boundary layer wind tunnel. This unique facility enables the conduction of experiments in aeroser- voelasticity, the study of wakes, machi- ne-to-machine interactions, and wind farm control for power maximization and load mitigation. The facility is highly instrumen- ted, allowing for the collection of a wide range of high quality data, both regarding VJGƅQYEQPFKVKQPUCPFVJGTGURQPUGQH UVTCVKQPQHYCMGFGƅGEVKQPUVTCVGIKGUVJCV the machines. Such data can be used for make use of the wind sensing technology VJGXGTKƄECVKQPQHRGTHQTOCPEGQHEQPVTQN developed by WEI. strategies, as well as the validation of computational tools. The experimental Projects UGVWRKUJKIJN[ƅGZKDNGCNNQYKPIHQT ■ BMWi project compact wind ‘Erhöhung FKHHGTGPVOCEJKPGEQPƄIWTCVKQPUQRG- des Flächenenergieertrags in Wind- rational scenarios, and the testing of parks durch avancierte Anlagen- und different control algorithms used onboard Parkregelung’ the individual wind turbines or the whole ■ Industrial project ‘Wind Farm Control’ wind farm. An ambitious plan of extremely ■ One post-doc position (MSE seed interesting new experiments is planned funding) for 2015 and 2016, including the demon- 58 Wind Energy Institute Wind Sensing Technology WEI develops technology for the use of wind turbines as wind sensors. By the use of wind turbine response data, as provided by sensors installed on the blades or the nacelle, the technology computes in real-time the wind conditions at each machine, including wind speed, wind direction, vertical and horizontal shear, wake state (full, partial, no wake interference) and turbulence intensity. Such technology is capable of providing detailed information on the wind condi- tions, in support of improved operation Projects of each machine or the whole wind farm ■ Industrial project ‘Wind Estimation from through smart control strategies. This may Rotor Loads’ lead to improved power output and power ■ H2020 ETN Project AWESOME ‘Wind quality, and to fatigue load mitigation. The Energy Operation and Maintenance’ technology can also be used for very short ■ One Ph.D. position (Chinese Scholars- time assessment and forecasting of wind hip Council) conditions within a wind farm, with impact on operation and control of the power plant. Design of Wind Turbines WEI works on the development of automated multidisciplinary design software tools, with the goal of enabling the optimization of wind turbines, the effective exploration of the design space, the understanding of design trade-offs, as well as the evaluation of the impact of new technologies. Advancements in light- weight rotor design are being investigated through improvements in the aerodyna- mics, in the structural design and the use of smart sensing and control strategies. Projects By the combination of these technologies, ■ Industrial Ph.D. project ‘Design of Very reduced ultimate and fatigue loads can Large Light-Weight Rotors’ be achieved and exploited for reducing weight and improving performance, thereby in turn reducing the cost of energy from wind. Wind Energy Institute 59 Research Focus Courses ■ Modeling and simulation of wind energy ■ Introduction to Wind Energy systems ■ Modeling, Control and Design of Wind ■ Multidisciplinary design Energy Systems ■ Aeroservoelasticity, loads and stability ■ Wind Turbine Simulation ■ Control of wind turbines and wind ■ Wind Turbine Design farms ■ Aeroservoelasticity ■ Wind tunnel testing Management Competence Professor Dr. Carlo L. Bottasso, Director ■ Multibody dynamics, computational OGEJCPKEUPQPNKPGCTƄPKVGGNGOGPV Administrative Staff methods Elfriede Sabine Matzner ■ /QFGNTGFWEVKQPCPFU[UVGOKFGPVKƄEC- tion Research Scientists ■ Design and synthesis of model-based Pietro Bortolotti, M.Sc. controllers Stefano Cacciola, Ph.D. ■ Design and manufacturing of aeroela- Filippo Campagnolo, Ph.D. stically-scaled and actively controlled Dr.-Ing. Mark Capellaro wind turbine models for wind tunnel 8NCJQ2GVTQXKæ&T5E testing Jiangang ‘Jesse’ Wang, M.Sc. ■ Data processing and analysis Infrastructure ■ Scaled wind turbine and wind farm models ■ Model building lab ■ Computational lab Publications 2013-14 Book Chapters ■ C.L. Bottasso, S. Cacciola, ‘Model Independent Periodic Stability Analysis of Wind Turbines’, Wind ■ C.L. Bottasso, F. Campagnolo, A. Croce, C. Tibaldi, Energy, doi:10.1002/we.1735, 2014. ■ ‘Fatigue Damage Mitigation by the Integration of C.L. Bottasso, F. Campagnolo, V. Petrovic, Active and Passive Load Control Techniques on ‘Wind Tunnel Testing of Scaled Wind Turbine Wind Turbines’, Wind Energy and the Impact of Models: beyond Aerodynamics’, Journal of Wind Turbulence on the Conversion Process, M. Hoelling, Engineering & Industrial Aerodynamics, 127:11-28, J. Peinke and S. Ivanell, Eds., Springer, ISBN: 978- doi:10.1016/j.jweia.2014.01.009, 2014. ■ 3-642-54695-2 (print), 978-3-642-54696-9 (online), C.L. Bottasso, S. Cacciola, X. Iriarte, ‘Calibration of 2014. Wind Turbine Lifting Line Models from Rotor Loads’, Journal of Wind Engineering & Industrial Aerodyna- mics, 124:29-45, doi:10.1016/j.jweia.2013.11.003, Peer-reviewed Journals 2014. ■ C.L. Bottasso, C.E.D. Riboldi, ‘Estimation of Wind ■ C.L. Bottasso, P. Montinari, ‘Rotorcraft Flight Misalignment and Vertical Shear from Blade Loads’, Envelope Protection by Model Predictive Control’, Renewable Energy, 62:293-302, doi:10.1016/j. Journal of the American Helicopter Society, renene.2013.07.021, 2014. accepted, to appear, 2015. ■ E. Asadi, C.L. Bottasso, ‘Tightly-Coupled Stereo ■ C.L. Bottasso, C.E.D. Riboldi, ‘Validation of a Wind Vision-Aided Inertial Navigation using Feature-Ba- Misalignment Observer using Field Test Data’, sed Motion Sensors’, Advanced Robotics, doi:10.10 Renewable Energy, 74:298-306, doi:10.1016/j. 80/01691864.2013.870496, 2014. renene.2014.07.048, 2015. ■ C.L. Bottasso, S. Cacciola, X. Iriarte, ‘Calibration of ■ C.L. Bottasso, P. Pizzinelli, C.E.D. Riboldi, Wind Turbine Lifting Line Models from Rotor Loads’, ‘LiDAR-Enabled Model Predictive Control of Journal of Wind Engineering & Industrial Aerodyna- Wind Turbines with Real-Time Capabilities’, mics, 124:29-45, doi:10.1016/j.jweia.2013.11.003, Renewable Energy, 71:442-452, doi:10.1016/j. 2014. renene.2014.05.041, 2014. 60 Wind Energy Institute ■ C.L. Bottasso, C.E.D. Riboldi, ‘Estimation of Wind ■ C.L. Bottasso, ‘Computational Tools for Wind Misalignment and Vertical Shear from Blade Loads’, Energy Systems, and their Validation and Calibra- Renewable Energy, 62:293-302, doi:10.1016/j. tion’, Plenary lecture, CWE 2014, 6th International renene.2013.07.021, 2014. Symposium on Computational Wind Engineering, ■ C.L. Bottasso, A. Croce, C.E.D. Riboldi, M. Hamburg, Germany, June 8-12, 2014. Salvetti, ‘Cyclic Pitch Control for the Reduction ■ C.L. Bottasso, ‘Wind Energy: Trends, Challenges of Ultimate Loads on Wind Turbines’, Journal of and Perspectives’, The Terawatt Challenge: What Physics: Conference Series 524 (2014) 012063, Research for our Future Energy?, International doi:10.1088/1742-6596/524/1/012063. Symposium, Accademia Nazionale dei Lincei, ■ C.L. Bottasso, A. Croce, L. Sartori, F. Grasso, Rome, November 5-6, 2013. ‘Free-form Design of Rotor Blades’, Journal of ■ C.L. Bottasso, ‘Design: the Final Judge of Physics: Conference Series 524 (2014) 012041, Technological Innovation’, Keynote lecture, Future doi:10.1088/1742-6596/524/1/012041. of Wind Power Symposium, Technische Universitaet ■ C.L. Bottasso, A. Croce, C.E.D. Riboldi, Muenchen, Garching near Munich, Germany, June ‘Optimal Shutdown Management’, Journal of 27, 2013. Physics: Conference Series 524 (2014) 012050, ■ C.L. Bottasso, ‘Validation and Calibration of Com- doi:10.1088/1742-6596/524/1/012050. putational Tools for Wind Energy Systems’, Plenary ■ V. Petrovic, C.L. Bottasso, ‘Wind Turbine lecture, GAMM 2013, 84th Annual Meeting of the Optimal Control During Storms’, Journal of International Association of Applied Mathematics Physics: Con ference Series 524 (2014) 012052, and Mechanics, Novi Sad, Serbia, March 18-22, doi:10.1088/1742-6596/524/1/012052. 2013. ■ F. Campagnolo, C.L. Bottasso, P. Bettini, ‘Design, Manufacturing and Characterization of Aero-Elasti- cally Scaled Wind Turbine Blades for Testing Active and Passive Load Alleviation Techniques within an International Conferences ABL Wind Tunnel’, Journal of Physics: Conference ■ P. Bortolotti, C.L. Bottasso, ‘Integrated Aero- Series 524 (2014) 012061, doi:10.1088/1742- Structural Optimization of Wind Turbine Rotors’, 6596/524/1/012061. Proceedings of the 10th PhD Seminar on Wind ■ E. Asadi, C.L. Bottasso, ‘Delayed Fusion for Energy, Orleans, France, October 28-31, 2014. Real-Time Vision-Aided Inertial Navigation’, Journal ■ C.L. Bottasso, F. Campagnolo, V. Petrovic, of Real-Time Image Processing, Special Issue on S. Cacciola, ‘Wind Farm Cooperative Control: Robot Vision, doi:10.1007/s11554-013-0376-8, /GVJQFUCPF'ZRGTKOGPVCN8GTKƄECVKQPo9QTMUJQR 2013. on Cooperative Systems, Dubrovnik, Croatia, ■ C.L. Bottasso, F. Luraghi, G. Maisano, M. Shaohua, September 10-12, 2014. ‘Global Solution of Optimization Problems in ■ C.L. Bottasso, P. Bortolotti, A. Croce, F. Gualdoni, Rotorcraft Flight Mechanics’, Journal of Aerospace L. Sartori, ‘Aero-Structural Design of Rotors’, 2014 Engineering, doi:10.1061/(ASCE)AS.1943- Sandia Wind Turbine Blade Workshop, Albuquer- 5525.0000370, 2013. que, NM, USA, August 26-28, 2014. ■ C.L. Bottasso, F. Campagnolo, A. Croce, S. Dilli, F. ■ C.L. Bottasso, A. Croce, C.E.D. Riboldi, M. Salvetti, Gualdoni, M.B. Nielsen, ‘Structural Optimization of ‘Cyclic Pitch Control for the Reduction of Ultimate Wind Turbine Rotor Blades by Multi-Level Sectional/ Loads on Wind Turbines’, The Science of Making Multibody/3DFEM Analysis’, Multibody System Torque from Wind, Copenhagen, Denmark, June Dynamics, doi:10.1007/s11044-013-9394-3, 2013. 18-20, 2014. ■ C.L. Bottasso, F. Campagnolo, C. Tibaldi, ‘Optimi- ■ C.L. Bottasso, A. Croce, L. Sartori, F. Grasso, zation-Based Study of Bend-Twist Coupled Rotor ‘Free-form Design of Rotor Blades’, The Science of Blades for Passive and Integrated Passive/Active Making Torque from Wind, Copenhagen, Denmark, Load Alleviation’, Wind Energy, 16:1149-1166, June 18-20, 2014. doi:10.1002/we.1543, 2013. ■ C.L. Bottasso, A. Croce, C.E.D. Riboldi, ‘Optimal ■ C.L. Bottasso, S. Cacciola, A. Croce, ‘Estimation Shutdown Management’, The Science of Making of Blade Structural Properties from Experimental Torque from Wind, Copenhagen, Denmark, June Data’, Wind Energy, 16:501-518, doi:10.1002/ 18-20, 2014. we.1497, 2013. ■ V. Petrovic, C.L. Bottasso, ‘Wind Turbine Optimal ■ C.L. Bottasso, A. Croce, C.E.D. Riboldi, Y. Nam, Control During Storms’, The Science of Making ‘Multi-Layer Control Architecture for the Reduction Torque from Wind, Copenhagen, Denmark, June of Deterministic and Non-Deterministic Loads on 18-20, 2014. Wind Turbines’, Renewable Energy, 51:159-169, ■ F. Campagnolo, C.L. Bottasso, P. Bettini, ‘Design, 2013. Manufacturing and Characterization of Aero-Elasti- cally Scaled Wind Turbine Blades for Testing Active and Passive Load Alleviation Techniques within an Journals with a National Editorial Board ABL Wind Tunnel’, The Science of Making Torque from Wind, Copenhagen, Denmark, June 18-20, ■ C.L. Bottasso, ‘Design Optimization of Wind Turbine 2014. Blades’, Compositi Magazine, 30:8-19, 2013. ■ C.L. Bottasso, F. Campagnolo, ‘An Experimental Facility for Wind Farm Control Testing’, Wind Farm Monitoring and Control Conference, London, UK, June 4-5, 2014. Plenary or Keynote Lectures at ■ C.L. Bottasso, S. Cacciola, ‘Estimation of Wind Turbine Model Properties - Towards the Validation International Conferences of Comprehensive High-Fidelity Multibody Models’, EWEA 2014 Annual Event, Barcelona, Spain, March ■ C.L. Bottasso, ‘The Role of Technological 10-13, 2014. Innovation in the Future Growth of Wind Energy’, ■ C.L. Bottasso, A. Croce, L. Sartori, F. Grasso, ‘Free- The Hemke Lecture 2014, Rensselaer Polytechnic Form Aero-Structural Optimization of Rotor Blades’, Institute, Troy, NY, USA, September 3, 2014. poster, EWEA 2014 Annual Event, Barcelona, Spain, March 10-13, 2014. Wind Energy Institute 61 ■ C.L. Bottasso, A. Croce, F. Gualdoni, ‘Simultaneous ■ C.L. Bottasso, F. Campagnolo, A. Croce, F. Structural Sizing of Wind Turbine Rotor and Tower’, Gualdoni, ‘Multidisciplinary Design Optimization of poster, EWEA 2014 Annual Event, Barcelona, Spain, Wind Turbines by a Multibody/Cross-Sectional/FEM March 10-13, 2014. Integrated Approach’, ECCOMAS Thematic Confer- ■ C.L. Bottasso, F. Campagnolo, ‘Wind Turbine and ence on Multibody Dynamics, Zagreb, Croatia, July Wind Farm Control Testing in a Boundary Layer 1-4, 2013. Wind Tunnel’, SciTech 2014, AIAA Science and ■ L. Sartori, F. Grasso, C.L. Bottasso, A. Croce, ‘Inte- Technology Forum and Exposition, 32nd ASME gration of Airfoil Design During the Design of New Wind Energy Symposium, Washington, DC, USA, Blades’, ICOWES2013, International Conference on January 13-17, 2014. Aerodynamics of Offshore Wind Energy Systems ■ C.L. Bottasso, S. Cacciola, R. Riva, ‘Floquet and Wakes, Lyngby, Denmark, June 17-19, 2013. Stability Analysis of Wind Turbines using Input-Out- ■ C.L. Bottasso, P. Montinari, ‘Rotorcraft Flight put Models’, SciTech 2014, AIAA Science and Envelope Protection by Model Predictive Control’, Technology Forum and Exposition, 32nd ASME AHS 69th Annual Forum and Technology Display, Wind Energy Symposium, Washington, DC, USA, Phoenix, AZ, USA, May 21-23, 2013. January 13-17, 2014. ■ C.L. Bottasso, C.E.D. Riboldi, ‘Improved Wind ■ F. Campagnolo, C.L. Bottasso, ‘Wind Tunnel Direction Measurement through Blade Loads’, Aeroelastic Models in Complex Terrains’, IEA R&D AHS 69th Annual Forum and Technology Display, Wind Task 11 Topical Expert Meeting on Challenges Phoenix, AZ, USA, May 21-23, 2013. of Wind Energy in Complex Terrain, University of ■ C.L. Bottasso, C.E.D. Riboldi, ‘Improved Wind Stuttgart, Germany, November 12-13, 2013. Direction Measurement through Blade Loads’, ■ V. Petrovic, C.L. Bottasso, ‘Loading Conditions in EWEA 2013 Annual Event, Vienna, Austria, February Complex Terrains and Load Alleviation Strategies’, 4-7, 2013. IEA R&D Wind Task 11 Topical Expert Meeting on ■ C.L. Bottasso, P. Pizzinelli, C.E.D. Riboldi, Challenges of Wind Energy in Complex Terrain, ‘LiDAR-Enabled Real-Time Control of Wind Tur- University of Stuttgart, Germany, November 12-13, bines’, EWEA 2013 Annual Event, Vienna, Austria, 2013. February 4-7, 2013. ■ E. Asadi, C.L. Bottasso, ‘Delayed Fusion of Relative ■ C.L. Bottasso, ‘Multidisciplinary Design Optimiza- State Measurements by Extending Stochastic tion of Wind Energy Systems’, NREL Wind Energy Cloning via Direct Kalman Filtering’, FUSION2013, System Engineering Workshop, Boulder, CO, USA, International Conference on Information Fusion, January 29-30, 2013. Istanbul, Turkey, July 9-12, 2013. 62 Wind Energy Institute Institute for Carbon Composites Fundamental research on material behavior, processing technology and simulation of high performance composite materials ■ The focus of the Institute for Carbon Composites in 2013-14 was to establish and strengthen its research program within the four research groups. The main goal was to explore new ways and possibilities to reduce the process cycle time and the raw material costs to be able to implement high performance composite structures in high volume appli- cations. Different process technologies using e.g. tailored textiles and advanced matrix systems have been patented. New material models and process simulation methods have been developed and these were imple- mented in conventional software tools to enable advanced composites part and process design solutions. Prof. Dr.-Ing. EQPHGTGPEGKPVJGƄGNFQHƄDGTEQORQ- Klaus Drechsler UKVGUKP'WTQRGVJG'%%/ 'WTQRGCP %QPHGTGPEGQH%QORQUKVG/CVGTKCNU KP Contact ,WPG YYYNEEOYVWOFG #URGEKCNJKIJNKIJVYCUVJGKPUVCNNCVKQP FTGEJUNGT"NEEOYVWOFG QHQWTn5RNKVJQRMKPUQPDCToGSWKROGPV 2JQPG UWKVCDNGHQTVJGKFGPVKƄECVKQPQHOGEJCPKECN RTQRGTVKGUQHEQORQUKVGUWPFGTF[PCOKE NQCFKPI+PECUGQHETCUJQTKORCEVGXGPVU Split Hopkinson bar equipment EQORQUKVGUUVTWEVWTGUCTGNQCFGFXGT[ TCRKFN[KPCXGT[UJQTVRGTKQFQHVKOGJGPEG 9GYGTGJQPQTGFVQJQUVVJG5[ORQUKWO KVKUPGEGUUCT[VQKPXGUVKICVGVJGUVTCKPTCVG QPVJGQEECUKQPQHVJGVJCPPKXGTUCT[QH FGRGPFGPVOGEJCPKECNTGURQPUGHQTXCTKQWU VJG+PUVKVWVGHQT%CTDQP%QORQUKVGUHTQO F[PCOKENQCFKPIECUGU#VVJG.%%UVCVG 5GRVGODGTYKVJOQTGVJCP QHVJGCTVCPFWPKSWGN[ƅGZKDNGVGPUKQP RCTVKEKRCPVU#OQPIURGCMGTU.%% EQORTGUUKQPCPFVQTUKQPDCTUGVWRUCTG FQEVQTCNECPFKFCVGUVQQMVJGQRRQTVWPKV[VQ CXCKNCDNG#VVJG.%%CWPKSWGN[ƅGZKDNG RTGUGPVVJGKTNCVGUVTGUGCTEJTGUWNVU UVCVGQHVJGCTVGSWKROGPVKUCXCKNCDNGVQ #JKIJNKIJVJCUDGGPVJGUGNGEVKQPQHVJG VGUVWPFGTVGPUKQPCNEQORTGUUKQPCNCUYGNN .%%VQCNKIPVJGOQUVKORQTVCPVUEKGPVKƄE VQTUKQPCNNQCFKPI UEGPCTKQU Process Technology for Fibers and Textiles 6JGn2TQEGUU6GEJPQNQI[HQT(KDGTUCPF 6GZVKNGUoITQWRHQEWUGUQPOCPWHCEVWTKPI RTQEGUUGUVJCVECPCTTCPIGƄDGTUKP VCKNQTGFQTKGPVCVKQPU5WEJRTQEGUUGU CNNQYVJGƄDGTUVQDGCNKIPGFYKVJVJGNQCF RCVJUYKVJKPVJGEQORQUKVGEQORQPGPV 9GJCXGVJTGGVGCOUEQXGTKPITGUGCTEJ KPVQDTCKFKPIVGEJPQNQI[CWVQOCVGFƄDGT RNCEGOGPVCPFVCKNQTGFVGZVKNGU9GCTG WVKNK\KPIJKIJN[FGXGNQRGFCPFWPKSWG #WVQOCVGFƄDGTRNCEGOGPV RTQEGUUKPIGSWKROGPVVJCVCNNQYUHQTVJG equipment CWVQOCVGFCPFTGRTQFWEKDNGOCPWHCEVWT RTGKORTGIPCVGFQTFT[ƄDTQWUVCRGUYKVJ KPIQHƄDGTRTGHQTOU&GRGPFKPIQPVJG DKPFGTCUYGNNCUFKHHGTGPVVGZVKNGHCDTKEU OCPWHCEVWTKPIOGVJQFsFT[ƄDGTDWPFNGU CTGWUGFCUTCYOCVGTKCNU Institute for Carbon Composites 63 Automated Fiber Placement Tailored Textiles 9KVJVYQQHOQUVCFXCPEGFƄDGTRNC- $[EQODKPKPIKPPQXCVKXGRTQEGUUGUHQT EGOGPVOCEJKPGUKPVJGYQTNFHQTDQVJ VJGOCPWHCEVWTKPIQHVGZVKNGUYGCTG VJGTOQRNCUVKECPFVJGTOQUGVOCVGTKCNUYG FGXGNQRKPIUVTCVGIKGUHQTHWVWTGRTGHQTO CTGYQTMKPIQPEJCNNGPIKPIEQORQPGPVU RTQFWEVKQPQHPGVUJCRGNQCFQRVKOK\GF YKVJEQORNGZIGQOGVTKGU9GCTGEJCTCE- EQORQUKVGƄDGTUVTWEVWTGU VGTK\KPIKPPQXCVKXGOCVGTKCNUCPFFGXGNQR KPIPGYFGUKIPUVTCVGIKGUHQTHWVWTGƄDGT Public Funded Projects RNCEGOGPVCRRNKECVKQPU ■ #+(RTQLGEVn%(CUGT2CRKGTo ■ #+(RTQLGEVn%(CJTTCFHGNIGPo Braiding Technology ■ #+(RTQLGEVn%Q%Qo 9GCTGYQTMKPIQPKPVGITCVKPIQWTDTCKFKPI ■ 56/9+86RTQLGEVn%QO$Qo GSWKROGPVKPVQCOCPWHCEVWTKPIEGNN ■ '7RTQLGEVn*+81%1/2o VQGPCDNGGHƄEKGPVCPFHWNN[CWVQOCVGF ■ $/$(RTQLGEVn519'/#o OCPWHCEVWTKPIQHNQYYCUVGƄDGTRTGHQTOU ■ $/$(RTQLGEVn8KUKQ/o YKVJGPJCPEGFOCVGTKCNRTQRGTVKGU ■ $/$(RTQLGEVn/#+RNCUVo ■ $/$(RTQLGEVn/#+RTQƄNo ■ $/$(RTQLGEVn#+4%#4$10++o ■ $/$(RTQLGEVn/#+VCPMo Process Technology for Matrix Systems OGPVCNWPFGTUVCPFKPIQHCYKFGTCPIG QHRQUUKDNGOCPWHCEVWTKPIOGVJQFUVQ CEJKGXGCEQUVVKOGCPFTGUQWTEGQRVKOK- \GFRTQFWEVKQPQHƄDGTTGKPHQTEGFRNCUVKEU Tooling Systems 6JGEQPUQNKFCVKQPQHEQORQUKVGRCTVUKU ECTTKGFQWVWUKPIOQNFU%QPUGSWGPVN[ OQNFUDTKPIVQIGVJGTVJGRCTVFGUKIPCPF VJGRTQEGUUGU$GECWUGQHVJKUVJGVQQN 6JGITQWRn2TQEGUU6GEJPQNQI[HQT/CVTKZ JCUCEGPVTCNTQNGKPVJGRTQFWEVKQPQH 5[UVGOUoCFFTGUUGUVJGTQDWUVCPF EQORQUKVGU6JGVGCOn6QQNKPI5[UVGOUo GHƄEKGPVRTQEGUUKPIQHOCVTKZU[UVGOUHQT FQGUKVUTGUGCTEJQPVJGFGXGNQROGPVQH VJGRTQFWEVKQPQHƄDGTTGKPHQTEGFEQORQ- JQNNQYEQORQPGPVUVJGQRVKOK\CVKQPQH UKVGRCTVU GPGTI[GHƄEKGPVOQNFUCPFPGYOGVJQFU HQTQPNKPGRTQEGUUOQPKVQTKPI Hybrid Materials and Structures 6JGVGCOn*[DTKF/CVGTKCNU5VTWEVWTGUo Public Funded Projects FGCNUYKVJVJGDGPGƄEKCNEQODKPCVKQPQH ■ #+(RTQLGEVn*Q/GJTo Hybrid material combination with FKHHGTGPVRQN[OGTU OCVTKEGU FKHHGTGPV ■ $/$(RTQLGEVn(.#/'o VJGTOQRNCUVKEƄNOU TGKPHQTEKPIƄDGTUCPFQTCFFKVKQPCNOGVCNNKE ■ $/$(RTQLGEVn+P(Qo EQORQPGPVU*[DTKFUVTWEVWTGUKPXQNXG ■ $/$(RTQLGEVn/#+RNCUVo VJGFGUKIPCPFVJGRTQEGUUNC[QWVKPQTFGT ■ $/$(RTQLGEVn/#+HQo VQOCPWHCEVWTGRCTVUYJKEJEQPUKUVQH ■ $(5RTQLGEVn(14%K/#o FKHHGTGPVOCVGTKCNUQTLQKPOWNVKRNGOCVGTKCNU ■ $(5RTQLGEVn6+2o ■ '7RTQLGEVn&KUCEQRo Processes and Production Systems ■ '7RTQLGEVn.GG6QTDo 6JGCKOQHVJGn2TQEGUUGUCPF2TQFWEVKQP 5[UVGOUo6GCOKUVQGPJCPEGVJGHWPFC- 64 Institute for Carbon Composites Simulation 6JGJKIJRQVGPVKCNKPNKIJVYGKIJVFGUKIPQH Compaction, Curing and Consolidation EQORQUKVGRCTVUKUEJCNNGPIGFD[VJGPGGF Simulation HQTCWVQOCVKQPQHVJGOCPWHCEVWTKPIRTQ- (QEWUGUQPVJGVJGTOCNOGEJCPKECNCU EGUUGUVJGTGFWEVKQPQHE[ENGVKOGUCPF YGNNCUƅQYCPFEQORCEVKQPTGNCVGF RTQEGUUEQUVU/QFGNKPIVJGOCPWHCEVWT RJGPQOGPCCPFVJGKTKORCEVQPFGXKCVKQPU KPIRTQEGUUKUCPGHHGEVKXGCPFƅGZKDNG KPVGTOUQHIGQOGVT[sRTQEGUUKPFWEGF CRRTQCEJVQWPFGTUVCPFCPFQRVKOK\GVJG FGHQTOCVKQPU 2+& sCPFVJGOCVGTKCNU RTQEGUUNQPIDGHQTGVJGƄTUVRTQVQV[RGKU CTEJKVGEVWTGUWEJCUXQKFEQPVGPV DWKNVCPFVQVTCPUHGTVJGRTQEGUUKPHQTOC- n/CVGTKCN/QFGNKPICPF5VTWEVWTCN#PCN[- VKQPKPVJGUVTWEVWTCNCPCN[UKUQHVJGRCTV UKUoHQEWUGUQPVJGCPCN[UKUQHƄDGTTGKP- 6JGTGUGCTEJKPRTQEGUUUKOWNCVKQPCPF HQTEGFRNCUVKEUCUYGNNCUOGEJCPKECNCPF UVTWEVWTCNCPCN[UKUKUCEEQORCPKGFD[ DQPFGFLQKPVUCVFKHHGTGPVNGPIVJUECNGU FGXGNQROGPVQHOCVGTKCNEJCTCEVGTK\CVKQP VGEJPKSWGU VQIGVJGTYKVJVJGVGUVKPI Public Funded Projects ITQWR VJGXCNKFCVKQPQHVJGUKOWNCVKQP ■ &()RTQLGEVn&4)o CRRTQCEJQPIGPGTKEUVTWEVWTGUCPFKVU ■ 56/9+86RTQLGEVn%QO$Qo CRRNKECVKQPQPCRCTVNGXGN ■ $/$(RTQLGEVn/#+FGUKIPo Draping (left) and braiding (right) ■ $/$(RTQLGEVnVTCPUJ[DTKFo simulation Forming and Flow Process Simulation ■ $/$(RTQLGEVn/#+RTQƄNo (QEWUGUQPRTGHQTOKPIRTQEGUUGUUWEJ ■ $/$(RTQLGEVn/#+HQTOo CUDTCKFKPIFTCRKPICPFCWVQOCVGFƄDGT ■ $/$(RTQLGEVn/#+6#+o RNCEGOGPVCUYGNNCUVJGUKOWNCVKQPQHVJG ■ $/$(RTQLGEVn/#+JKTCU JCPFNGo ƄNNKPIRTQEGUUQHƄDGTUVGZVKNGUCPFHWNN ■ $(5RTQLGEVn(14%K/#o UECNGRCTVU ■ '7RTQLGEVn.GG6QTDo Research Focus Courses ■ 2TQEGUUVGEJPQNQI[HQTƄDGTUCPF ■ /CVGTKCNUCPF2TQEGUU6GEJPQNQIKGUHQT VGZVKNGU %CTDQP%QORQUKVGU ■ 2TQEGUUVGEJPQNQI[HQTOCVTKZU[UVGOU ■ %QORQUKVG/CVGTKCNUCPF5VTWEVWTG ■ 5KOWNCVKQP RTQRGTV[4GNCVKQPUJKR ■ /CVGTKCNDGJCXKQTCPFVGUVKPI ■ #PCN[UKUCPF&GUKIPQH%QORQUKVG 5VTWEVWTGU Competence ■ 2TQFWEVKQP6GEJPQNQIKGUHQT%QORQUKVG 6JG.%%VCMGUCPKPVGTFKUEKRNKPCT[ 2CTVU CRRTQCEJVQTGUGCTEJGZVGPFKPIHTQOVJG ■ 2TQEGUU5KOWNCVKQPCPF/CVGTKCN TCYOCVGTKCNUVJTQWIJKORNGOGPVCVKQPQH /QFGNKPIQH%QORQUKVGU OCPWHCEVWTKPIVGEJPQNQIKGUVQEQORNGVG ■ %CTDQPCPF)TCRJKVGs*KIJ2GTHQT- EQORQUKVGEQORQPGPVU9KVJURGEKCNN[ OCPEG/CVGTKCNUHQT-G[+PFWUVTKGU FGXGNQRGFUKOWNCVKQPOGVJQFUVJG ■ 5WRRN[%JCKPCPF8CNWG%TGCVKQP EQORQUKVGOCPWHCEVWTKPIRTQEGUUEJCKP %QORQUKVGU ECPDGTGRTGUGPVGFXKTVWCNN[ Infrastructure ■ %QORQUKVGVGEJPKECNNCDn2TGHQTOKPI CPF6JGTOQUGV+PLGEVKQP6GEJPQNQI[o ■ %QORQUKVGVGEJPKECNNCDn6JGTOQRNCUVKE 6GEJPQNQI[o ■ %QORQUKVGVGUVNCDQT ■ %QORWVKPIENWUVGT Institute for Carbon Composites 65 Management &TVGEJP4QNCPF*KPVGTJÒN\N 2TQH&T+PI-NCWU&TGEJUNGT&KTGEVQT &KRN+PI2JKNKRR*ÒTOCPP &TOQPV'NKUCDGVJ.CFUVÀVVGT &KRN+PI$GTPJCTF*QTP &KRN+PI2JKNKRR-COOGTJQHGT Adjunct Professors &KRN+PI-CNNG-KPF &T+PI1UYKP²VVKPIGT &KRN+PI#PFTGCU-QNNOCPPUDGTIGT &T+PI%JTKUVKCP9GKOGT &T*CPPGU-ÒTDGT 6JGQFQUKC-QWTMQWVUCMK/5E Administrative and Technical Staff &KRN+PI,CP-TQNNOCPP 5VGRJCPKG*GPPG 2GVGT-WJP/5E %KIFGO-CTCMWU %JTKUVKCP.GOMG/5E &KCPC Publications 2013-14 ■ *CTDGTU6 'DGN% &TGEJUNGT- 'PFTGU# ■ -ÒTDGT* :CXKGT, %COCPJQ22 'UUC;' /ØNNGT) *KIJN[GHƄEKGPVRTQFWEVKQPCPFEJCTCE /CTVÉPFGNC'UECNGTC( *KIJUVTCKPTCVGDGJCXKQWT VGTK\CVKQPQH%(42OCFGHTQOTGE[ENGFECTDQP QHJCTPGUUUCVKPYGCXGHCDTKEECTDQPGRQZ[ ƄDGTU5#/2',QWTPCN EQORQUKVGWPFGTEQORTGUUKQPCPFEQODKPGF ■ *ÒTOCPP2 5VGN\N& .KEJVKPIGT4 8CP0KGWYGP- EQORTGUUKQPUJGCTNQCFKPI+PVGTPCVKQPCN,QWTPCNQH JQXG5 /C\ÏP%CTTQ) &TGEJUNGT- 1PVJG 5QNKFUCPF5VTWEVWTGU PWOGTKECNRTGFKEVKQPQHTCFKCVKXGJGCVVTCPUHGTHQT ■ .KEJVKPIGT4 *ÒTOCPP2 5VGN\N& *KPVGTJÒN\N VJGTOQUGVCWVQOCVGFƄDGTRNCEGOGPV%QORQUKVGU 4 6JGGHHGEVUQHJGCVKPRWVQPCFLCEGPVRCVJU 2CTV# #RRNKGF5EKGPEGCPF/CPWHCEVWTKPI FWTKPICWVQOCVGFƄDTGRNCEGOGPV%QORQUKVGU2CTV # #RRNKGF5EKGPEGCPF/CPWHCEVWTKPI 66 Institute for Carbon Composites ■ /CTIQUUKCP# $GN5 $CNXGTU,/ .GWV\& ■ /KVYCNUM[/ .GG5 8GKJGNOCPP$ $TCPF (TGKVCU4 *KPVGTJÒN\N4 (KPKVGGNGOGPVHQTOKPI / 'DGN% &TGEJUNGT- 1PNKPG6QYURTGCFKPI UKOWNCVKQPQHNQECNN[UVKVEJGFPQPETKORHCDTKEU KPVJGDTCKFKPIRTQEGUU5'+%1VJ+PVGTPC- %QORQUKVGU2CTV# #RRNKGF5EKGPEGCPF/CPWHCE- VKQPCN6GEJPKECN%QPHGTGPEG(QTWOn.QY%QUV VWTKPI %QORQUKVG2TQEGUUKPIHTQO#GTQURCEG11#VQ ■ /GKGT4 9CNDTCP# *CJP% Institute for Carbon Composites 67 Mechanics & High Performance Computing Group Parallel algorithms and high performance computing in computational continuum mechanics ■ The focus of the Mechanics & High Performance Computing Group in 2013-14 was to develop and establish several new methods and models KPVJGƄGNFQHEQORWVCVKQPCNOQFGNKPIQHUQNKFƅWKFKPVGTCEVKQPCNIQTKVJOU cardiovascular phenomena and disease as well as in the product develop- OGPVQHXCUEWNCTCUUKUVFGXKEGU#FFKVKQPCNN[CPGYOGVJQFQNQI[HQTVJG GHƄEKGPVUQNWVKQPQHJKIJN[EQPXGEVKXGU[UVGOUQHGSWCVKQPUDCUGFQPC new type of algebraic multigrid was developed. #JKIJNKIJVKUVJGUVCTVQHVJG$(5HWPFGF n#/WNVKUECNG/QFGNQH#VJGTQUENGTQUKUo+P TGUGCTEJRTQLGEVn4GXGTUG4GOQFGNKPI CFFKVKQPRTQITGUUKPVJGFGXGNQROGPVQH 6JTQWIJ'RKECTFKCN#WIOGPVCVKQPoVJG #/)OGVJQFUHQTEQPXGEVKQPFQOKPCVGF Prof. Dr. Michael W. Gee UVCTVQHVJG+)55'(QEWU#TGCQP$KQOC- U[UVGOUQHGSWCVKQPUYCUCEJKGXGF VGTKCNUCPFQWTKPVGTFKUEKRNKPCT[RTQLGEV Contact YYYOJREOYVWOFG UGMTGVCTKCV"OJREOYVWOFG 2JQPG Algebraic Multigrid for Convection Dominated Problems +POCP[ƄGNFUQHQWTTGUGCTEJVJGTGKU CFGURGTCVGPGGFHQTHCUVCPFGHƄEKGPV UQNXGTU/WNVKITKFOGVJQFUCTGCOQPI VJGDGUVOGVJQFUHQTUQNXKPIU[OOGVTKE RQUKVKXGFGƄPKVGU[UVGOU*QYGXGT HQTOCP[CRRNKECVKQPU %(&VTCPURQTV EQPXGEVKXGRJGPQOGPCRNC[CPKORQTVCPV TQNGCPFOC[FQOKPCVGVJGYJQNGRTQEGUU %QPXGEVKXGVGTOUTGUWNVKPPQPU[OOGVTKE NKPGCTU[UVGOUVJCVQHVGPVWTPQWVVQDG XGT[EJCNNGPIKPIHQTKVGTCVKXGUQNXKPI OGVJQFU9GFGXGNQRCPGYHTCOGYQTM PQPU[OOGVTKEU[UVGOU(WTVJGTOQTGKV HQTCNIGDTCKEOWNVKITKFRTGEQPFKVKQPGTU RTQXKFGUƅGZKDKNKV[VJCVCNNQYUVJGEQPVK- VJCVKUCNUQCRRTQRTKCVGHQTVJGUGMKPFUQH PWGFFGXGNQROGPVQHTQDWUV#/) Functional Modeling of the Heart and an Extravascular Assist Device (VAD) 5KPEGVJGPWODGTQHVTCPURNCPVCDNG JGCTVUKUFGETGCUKPICPFEWTTGPVJGCTV CUUKUVFGXKEGVGEJPQNQIKGUNCEMUGEWTG CPFTQDWUVCRRNKECDKNKV[CPQXGNGZVTCXC- UEWNCTXGPVTKEWNCTCUUKUVFGXKEGKUDGKPI FGXGNQRGFKPENQUGEQNNCDQTCVKQPDGVYGGP #FLW%QT)OD*CPF/*2%6QQRVKOK\G FGUKIPCPFHWPEVKQPCUYGNNCUVQOKPKOK\G XWNPGTCDNGKPVGTCEVKQPYKVJVJGJGCTVYG FGXGNQRCEEWTCVG&RCVKGPVURGEKƄEƄPKVG GNGOGPVOQFGNUQHVJGXGPVTKENGUYKVJEQW- RNKPIVQVJGEKTEWNCVQT[U[UVGOCPFHWTVJGT OQFGNVJGKPVGTRNC[YKVJVJGXGPVTKEWNCT CUUKUVFGXKEG 68 Mechanics & High Performance Computing Group Coupling Methods and Time Integration in Fluid-Structure Interaction GURGEKCNN[YJGPKVEQOGUVQNCTIGUECNG CRRNKECVKQPU(QTUQOGPWOGTKECNN[XGT[ EJCNNGPIKPI(5+RTQDNGOUYGEQWNFUJQY VJCVOQPQNKVJKEEQWRNKPIUEJGOGUQWV RGTHQTORCTVKVKQPGFCRRTQCEJGU6JGGHƄ- EKGPE[QHVJGOQPQNKVJKEUEJGOGKUDCUGF QPPGYN[FGXGNQRGFKVGTCVKXGUQNXGTUHQT VJGEQWRNGFNKPGCTU[UVGOQHGSWCVKQPU 9GCKOCVFGXGNQRKPIKORNKEKVVKOGKPVG- ITCVKQPUVTCVGIKGUHQT(5+RTQDNGOUYKVJ 0WOGTKECNCPCN[UKUQHƅWKFUVTWEVWTGKPVGT- IQQFUVCDKNKV[CEEWTCE[CPFGHƄEKGPE[ CEVKQP (5+ RJGPQOGPCRNC[UCPKORQTV- RTQRGTVKGU+ORNKEKVUEJGOGUUGGOVQDG CPVTQNGKPOCP[ƄGNFUQHCRRNKECVKQPUNKMG CRRTQRTKCVGHQTVJKUV[RGQHRTQDNGO+P EKXKNOGEJCPKECNCGTQURCEGQTDKQOG- QTFGTVQICKPOQTGGHƄEKGPE[CPFTGFWEG EJCPKECNGPIKPGGTKPI#NNVJGUGFKUEKRNKPGU VJGEQORWVCVKQPCNEQUVUCFCRVKXGVKOG FGCNYKVJJKIJN[F[PCOKERTQDNGOUYJGTG UVGRRKPIRTQEGFWTGUCTGXGT[RTQOKUKPI CUVCDNGCPFCEEWTCVGVKOGKPVGITCVKQPKU GURGEKCNN[YJGPNCTIGUECNGPQPNKPGCT ETWEKCN6JGEQORWVCVKQPCNGHƄEKGPE[QH RTQDNGOUCTGKPVJGHQEWUQHKPVGTGUV VJGCRRNKGFCNIQTKVJOUKUQHITGCVKPVGTGUV Image Registration and Inverse Analysis UWEJCUEQORWVGFVQOQITCRJ[ %6 OCIPGVKETGUQPCPEGVQOQITCRJ[ /46 QTWNVTCUQWPF*QYGXGTVJGDKLGEVKXG EJCTCEVGTKUVKEQHCVTCPUHQTOCVKQPKGVJG WPKSWGCPFKPXGTVKDNGOCRRKPIQHOCVGTKCN RCTVKENGUKUPQVECRVWTGFD[VJGCDQXG OGPVKQPGFENKPKECNKOCIKPIVGEJPKSWGU 6JWUKOCIGTGIKUVTCVKQPHQTFGHQTOCVKQP GUVKOCVKQPEQPUVKVWVGUCPKNNRQUGFKPXGTUG RTQDNGOYJKEJKUKPPGGFQHTGIWNCTK\CVKQP UVTCVGIKGU9GHQEWUQPVJGCRRNKECVKQPQH nOGCUWTGOGPVUoHTQOKOCIGTGIKUVTCVKQP KPOCVGTKCNRCTCOGVGTGUVKOCVKQPHQTƄPKVG GNGOGPVOQFGNU+PXGTUGCPCN[UKURTQXKFGU +OCIGTGIKUVTCVKQPRNC[UCMG[TQNGKPC COGVJQFVQGUVKOCVGOCVGTKCNRCTCOGVGTU DTQCFXCTKGV[QHENKPKECNCPFKPFWUVTKCN CEEQTFKPIVQCIKXGPTGHGTGPEGUQNWVKQP CRRNKECVKQPUYJGPGXGTKPHQTOCVKQPKU KGnOGCUWTGOGPVUo6JGUGOGCUWTGOGPVU GPEQFGFD[KOCIGU'URGEKCNN[KPENKPKECN ECPDGQDVCKPGFPQPKPXCUKXGN[GID[ CRRNKECVKQPUVJGCESWKUKVKQPQHKPHQTOCVKQP GZVTCEVKPIFGHQTOCVKQPKPHQTOCVKQPHTQO KUJKIJN[DCUGFQPKOCIKPIVGEJPKSWGU OGFKECNKOCIGU Mechanics & High Performance Computing Group 69 A Multiscale Model of Atherosclerosis #OWNVKUECNGCPFOWNVKFKUEKRNKPCT[ CRRTQCEJVQVJGOGEJCPQDKQNQI[QH CVJGTQUENGTQUKUKUVCMGPVJCVKUDCUGFQP EQORWVCVKQPCNVGEJPKSWGUCPFGZRGTKOGP- VCNECNKDTCVKQPCPFXGTKƄECVKQPCUYGNNCU KPXKXQOQNGEWNCTKOCIKPI6JGDKQNQIKECN RTQEGUUGUKPXQNXGFVCMGRNCEGCVVJG UWD EGNNWNCTNGPIVJUECNGCPFYKNNDGCUUGUUGF GZRGTKOGPVCNN[D[JKUVQNQI[D[QWTRTQLGEV RCTVPGTUHTQO-NKPKMWOTGEJVUFGT+UCT $CUGFQPVJGKOCIGF&IGQOGVTKGU OCETQUEQRKEEQORWVCVKQPCNƅWKFUQNKF KPVGTCEVKQPOQFGNUYKVJVTCPURQTVCPF OCETQUEQRKEEQPVKPWWOTGRTGUGPVCVKQP FKHHWUKQPQHURGEKGUCPFEGNNUUWRRN[CP QHVJGTGIKQPQHKPVGTGUVKPCOWNVKUECNG WPFGTUVCPFKPIQHVJGNQECNOGEJCPKECN HTCOGYQTM+OCIKPIQHUGXGTCNUVGPQUGUKP EQPFKVKQPUYJKEJECPVJGPDGEQTTGNCVGF OKEGCUYGNNCUECTGHWNN[FGUKIPGFKPXKVTQ VQVJGDKQNQIKECNƄPFKPIU#EQORWVCVK- GZRGTKOGPVUCTGCRRNKGFVQVGUVVJGJ[RQ- QPCNOKETQUEQRKEDKQNQIKECNOQFGNYKNN VJGUGUQHVJGOQFGNECNKDTCVGKVUDGJCXKQT DGKORNGOGPVGFKPCUVQEJCUVKEEGNNWNCT CPFGXCNWCVGKVURTGFKEVKXGECRCDKNKVKGU RQVVUOQFGNYJKEJYKNNDGEQWRNGFVQVJG Research Focus Courses ■ *KIJRGTHQTOCPEGRCTCNNGNEQORWVKPI ■ 'PIKPGGTKPI/GEJCPKEU $CEJGNQT/5' CPFGHƄEKGPVCNIQTKVJOU ■ 'PIKPGGTKPI/GEJCPKEU $CEJGNQT/5' ■ 2CTCNNGNCNIQTKVJOUCPFUECNCDNG ■ #FXCPEGF2CTCNNGN%QORWVKPICPF UQHVYCTG 5QNXGTUKP'PIKPGGTKPI /CUVGT ■ +PXGTUGRTQDNGOU /CUEJKPGPYGUGP ■ 0WOGTKECNOQFGNUKPXCUEWNCTDKQ OGEJCPKEUCPFOGEJCPQDKQNQI[ Management 2TQH&T/KEJCGN9)GG Competence ■ %QORWVCVKQPCNEQPVKPWWOOGEJCPKEU Administrative Staff ■ &GUKIPCPFTGCNK\CVKQPQHRCTCNNGN %QTPGNKC-KTUVGP UQHVYCTG ■ %QWRNGFOWNVKƄGNFRTQDNGOU Research Scientists ■ #NIGDTCKEOWNVKITKFOGVJQFU &KRN+PI/CTE*KTUEJXQIGN ■ $KQOGEJCPKEUCPFOGEJCPQDKQNQI[ &KR2J[U.CUUG,CIUEJKGU ■ 5QHVKOCIGTGIKUVTCVKQPCPFKPXGTUG &KRN+PI5GDCUVKCP-GJN RTQDNGOU &KRN+PI/CVVJKCU/C[T /QTKV\6JQP/5E Infrastructure ■ .KPWZDCUGFOKFUK\G*2%U[UVGO 70 Mechanics & High Performance Computing Group Publications 2013-14 ■ $KGJNGT,)GG/99CNN9# 6QYCTFU ■ +UOCKN/9CNN9#)GG/9 #FLQKPV 'HƄEKGPV7PEGTVCKPV[3WCPVKƄECVKQPKP%QORNGZCPF $CUGF+PXGTUG#PCN[UKUQH9KPFMGUUGN2CTCOGVGTU .CTIG5ECNG$KQOGEJCPKECN2TQDNGOUDCUGFQP QH2CVKGPV5RGEKƄE8CUEWNCT/QFGNU,QWTPCNQH C$C[GUKCP/WNVK(KFGNKV[5EJGOG$KQOGEJCPKEU %QORWVCVKQPCN2J[UKEU /QFGNKPIKP/GEJCPQDKQNQI[RWDNKUJGFQPNKPG ■ 9KGUPGT66WOKPCTQ459CNN9#)GG/9 CJGCFQHRTKPV /WNVKITKF6TCPUHGTUHQT0QPU[OOGVTKE ■ /C[T/-NÒRRGN69CNN9#)GG/9 5[UVGOU$CUGFQP5EJWT%QORNGOGPVUCPF #6GORQTCN%QPUKUVGPV/QPQNKVJKE(NWKF5VTWEVWTG )CNGTMKP2TQLGEVKQPU0WOGTKECN.KPGCT#NIGDTCYKVJ +PVGTCEVKQP#RRTQCEJ'PCDNKPI5KPING(KGNF2TGFKE- #RRNKECVKQPU VQTU5+#/,5EKGPVKƄE%QORWVKPIKPRTGUU ■ 4GGRU%/CKGT#2GNKUGM,*CGTVN(9CNN ■ 4GGRU%-GJN56CPKQU(/CKGT#$KGJNGT, 9#)GG/9 /GCUWTKPICPF/QFGNKPI 2GNKUGM,9CNN9#'EMUVGKP**)GG/9 2CVKGPV5RGEKƄE&KUVTKDWVKQPUQH/CVGTKCN2TQRGTVKGU $KQOGEJCPKEUCPF)GPG'ZRTGUUKQPKP KP#DFQOKPCN#QTVKE#PGWT[UO9CNN%QORWVGT #DFQOKPCN#QTVKE#PGWT[UO,8CUEWNCT5WTIGT[KP $KQOGEJCPKEU/QFGNKPIKP/GEJCPQDKQNQI[ RTGUU ■ 2QRR#5GKV\#)GG/99CNN9# +ORTQXGFTQDWUVPGUUCPFEQPUKUVGPE[QH&EQP- VCEVCNIQTKVJOUDCUGFQPCFWCNOQTVCTCRRTQCEJ %QORWVGT/GVJQFUKP#RRNKGF/GEJCPKEUCPF 'PIKPGGTKPI Mechanics & High Performance Computing Group 71 Institute of Non-destructive Testing Quality control, non-destructive testing and structural health monitoring ■6JGHQEWUQHVJG+PUVKVWVGQH0QP&GUVTWEVKXG6GUVKPIKPVJGƄGNFQH OGEJCPKECNGPIKPGGTKPIKPYCUVQGUVCDNKUJ0&6OGVJQFUHQTVJG KPURGEVKQPQHƄDGTTGKPHQTEGFOCVGTKCNU %(4%CPF)(4% VQIGVJGTYKVJ RCTVPGTUKPVJGCWVQOQVKXGCPFCGTQPCWVKEKPFWUVT[ 1VJGTCRRNKECVKQPUCTGKPVJGƄGNFQHYKPF VWTDKPGU TQVQTDNCFGUVQYGTCPFDCUG- OGPV +PEKXKNGPIKPGGTKPIVJGHQEWUYCU on inspection techniques for constructions of the infrastructure, the development of self-healing techniques for concrete Prof. Dr.-Ing. habil. CPFHQTVJGFGVGEVKQPQHXGTVKECNETCEMUKP Christian U. Große EQPETGVGRCXGOGPVUQHJKIJYC[U UQNXKPI VJGDNQYWRRTQDNGO Contact 1RVKECNNQEMKPVJGTOQITCRJ[QHEQORQUKVGUKPCKTETCHV www.zfp.tum.de UVTWEVWTGU2JQVQ 9GTPGT$CEJOGKGT67/ØPEJGP [email protected] Phone +49.89.289.27221 Projects: MAI ZfP in the early stages. At the same time, requirements vary widely within the industrial sectors and therefore require new approaches to testing. Quantities, which the aerospace industry produces in a year, may be produced daily in automobile manufacturing. The objective of the MAI ZfP project is to investigate which testing methods are applicable in this context. Technical aspects as well as 1RVKECNNQEMKPVJGTOQITCRJ[QHCECTDQPEQORQUKVG GEQPQOKEHCEVQTUKPƅWGPEGVJGCUUGUU- HTQPVJQQF2JQVQ 9GTPGT$CEJOGKGT67/ØPEJGP ment. The overall goal is cost reduction in component production in order to further The leading edge cluster, MAI Carbon pro- increase the competitiveness of German vides the unique opportunity to promote companies. PQPFGUVTWEVKXGVGUVKPIQHƄDGTTGKPHQTEGF Numerous NDT techniques are applied polymers on a large scale and to establish during the project including ultrasound in them in an industrial environment. Within TGƅGEVKQP RJCUGFCTTC[ QRVKECNNQEMKP the aerospace context, non-destructive thermography, modal-analysis, video testing has already been used success- endoscopy, local acoustic resonance fully for years. However, its usage on spectroscopy, acoustic emission and eddy ƄDGTTGKPHQTEGFRQN[OGTUKPCWVQOQDKNG current. manufacturing and engineering is still 72 Institute of Non-destructive Testing Projects: HEALCON Since 2013 the project Healcon – Self- healing materials for prolonged lifetime – is sponsored by the European Commission KPVJGUGXGPVJHTCOGYQTMRTQITCOOG6JG aim is the development of structures made of self-healing concrete having an inherent healing mechanism that becomes active YJGPCETCEMCRRGCTUVJWUTGPFGTKPI OCPWCNETCEMTGRCKTEQORNGVGN[QDUQNGVG +PQTFGTVQQDVCKPUWEJCWVQOCVKEETCEM closure, HEALCON European Project #EQWUVKEGOKUUKQPCPCN[UKUQHCEQPETGVGDGCOFWTKPI Partners are investigating the use of CVJTGGRQKPVDGPFKPIVGUV2JQVQ 9GTPGT$CEJOGKGT 67/ØPEJGP PU-based polymer precursors, superab- sorbent polymers and bacteria. The role of FGTUVQRTQQHVJGUGNHJGCNKPIGHƄEKGPE[ the Institute of Non-destructive Testing is Methods used in this context are the the support of the design of such healing acoustic emission technique, ultrasound agents as well as the development of in through-transmission, vibration testing VGUVKPIOGVJQFUCUVQQNUHQTVJGUVCMGJQN- and microwave or RADAR techniques. Projects: MEMIN HWPFKPIQHVJKUTGUGCTEJWPKV (QTUEJGT- ITWRRG YCUGZVGPFGFKPHQTVJTGG more years. Experimental impact struc- tures are investigated using Non-Dest- ructive Testing methods on the laboratory scale that are comparable to geophysical prospection methods. Techniques using ultrasound or electromagnetic waves can help to characterize the damage zone underneath the crater structure and 6JTQWIJVTCPUOKUUKQPOGVJQFQHKORCEVFCOCIGUVQC determine its extent. The techniques also PCVWTCNUVQPGDNQEM2JQVQ *GKMG)GKINEDO JCXGVJGRQVGPVKCN VQIGVJGTYKVJOQFCN CPCN[UKU VQEJCTCEVGTK\GRGVTQRJ[UKECN The collision of solid bodies is one of the material properties or to determine the most fundamental geological processes in NC[GTUQHCUVTCVKƄGFVCTIGV6JGUGFCVCCTG our solar system. The research unit FOR KORQTVCPVHQTEQORCTKPIVJGKPƅWGPEGQH /'/+0 /WNVKFKUEKRNKPCT['ZRGTKOGP- FKHHGTGPVOCVGTKCN VCTIGV RCTCOGVGTUQP tal and Modeling Impact Crater Research the formation of craters, crater substruc- 0GVYQTM ƄPCPEGFD[VJG)GTOCP4G tures or damage zones. The experimen- UGCTEJ(QWPFCVKQP &() KUCKOGFCV tally gathered data will help further on understanding the dynamics of hypervelo- to both verify and constrain numerical city impact processes and the formation modeling results of crater formation, and of meteorite craters by means of exper- to determine input parameters for the imental and numerical techniques. The modeling. Institute of Non-destructive Testing 73 Research Focus Courses ■ Material testing using non-destructive ■ Material Science II techniques in mechanical and civil ■ Munich School of Engineering engineering, automotive, aeronautics, ■ Non-destructive Testing in Civil bio engineering Engineering ■ Development and improvement of NDT ■ Applications in Non-destructive Testing techniques ■ NDT Seminar ■ Structural health monitoring ■ Sensor characterization and sensor Management combinations Prof. Dr.-Ing. habil. Christian Große, Director Sonja Hafenmayer, Secretary Competence ■ Inspection techniques: ultrasound, Research Scientists RADAR, infrared thermography, micro Dipl.-Ing. Philipp Jatzlau waves, eddy current; video endoscopy, 5GDCUVKCP*GEMPGT/5EGZVGTPCN radiography, high speed camera Christian Geiss, M.Sc., external ■ Monitoring techniques: acoustic Dipl.-Geophys. Robin Groschup GOKUUKQPXKDTCVKQPVGEJPKSWGU NCUGT Denis Kiefel, M.Sc., external XKDTQOGVT[ OQFCNCPCN[UKUYKTGFCPF Fabian Malm, M.Sc. wireless monitoring Manuel Raith, M.Sc. ■ Simulation of non-destructive test Dipl.-Phys. Martin Radlmeier, external methods Technical Staff Infrastructure (TCP\KUMC)GOCPFGT ■ NDT laboratory with contemporary NDT Sebastian Münchmeyer equipment, sensors and cameras. Marina Nahm ■ Calibration facilities; modelling tools. ■ 14 different mechanical testing ma - chines, microscopes Publications 2013-14 ■ D. Moser, N. Güldemeister, K. Wünnemann, C.U. ■ C.U. Grosse, F. Malm: Development and testing Grosse: Acoustic Emission Analysis of Experimental of concrete with properties to repair itself. BFT Impact Processes in Comparison to Ultrasound +PVGTPCVKQPCN 0Q+550 Measurements and Numerical Modeling, J. of 20-24. #EQWUVKE'OKUUKQP0Ts ■ J. Ozbolt, C.U. Grosse R. Richter: Combined ■ A. Jüngert, C.U. Grosse, M. Krüger: Local Acoustic acoustic emission and simulation approach to study 4GUQPCPEG5RGEVTQUEQR[ .#45 HQT)NCUU HTCEVWTGDGJCXKQTQHEQPETGVGWPFGTƄTGNQCF8+++ Fiber-Reinforced Polymer Applications, Journal of International Conference on Fracture Mechanics 0QPFGUVTWEVKXG'XCNWCVKQP0Q of Concrete and Concrete Structures FraMCoS-8 ■ C.U. Grosse, K. Van Tittelboom, N. De Belie: JVVR HTCOEQUQTI(TC/%Q5RRFH Non-destructive testing techniques for the obser- ■ K. Van Tittelboom, N. De Belie, F. Lehmann, C.U. vation of healing effects in cementitious materials Grosse: Use of acoustic emission analysis to – an introduction. 4th International Conference on evaluate the self-healing capability of concrete. In Self-Healing Materials - ICSHM 2013, Abstract ID Non-destructive Testing of Materials and Structures, No: CM-02. +5$0 5RTKPIGT2WDN ■ C.U. Grosse, T. Schumacher: Anwendungen der 51-58. 5EJCNNGOKUUKQPUCPCN[UGCP$GVQPDCWYGTMGP$CWVGEJ- ■ /4CKVJ%7)TQUUG 5QPKƄECVKQPQHCEQWUVKE PKM +550# emission data. EGU General Assembly Conference ■ &/QUGT/*2QGNEJCW(5VCTM%7)TQUUG #DUVTCEVU Application of nondestructive testing methods to study the damage zone underneath impact craters of MEMIN laboratory experiments, Meteoritics & 2NCPGVCT[5EKGPEG0Ts 74 Institute of Non-destructive Testing Institute for Materials Handling, Material Flow, Logistics Basic and applied research in logistics engineering ■ The Institute for Materials Handling, Material Flow and Logistics perceives itself as an open research institution aiming to contribute to the UEKGPVKƄERTQITGUUKPVJGCTGCUQHOCVGTKCNƅQYVGEJPQNQI[CPFNQIKUVKEU engineering. KPICFCRVKXGƅGZKDNGUWUVCKPCDNGCPF JWOCPQTKGPVGFJWOCPGNQIKUVKEUU[UVGOU CPFVGEJPQNQI[ 1PGJKIJNKIJVYCUVJGNCWPEJQHVJG ƄTUVCWVQOCVGFUVQTCIGCPFTGVTKGXCN ETCPGOCPWHCEVWTGFCNOQUVGPVKTGN[HTQO ECTDQPƄDGTTGKPHQTEGFRNCUVKE7UKPI Prof. Dr.-Ing. Dipl.-Wi.-Ing. NKIJVYGKIJVOCVGTKCNUVJGYGKIJVQHVJG Willibald A. Günthner 5VCEMGTETCPGOCPWHCEVWTGFHTQOECTDQPƄDGT UVCEMGTETCPGOCUVYCUTGFWEGFD[ reinforced plastic EQORCTGFVQEQPXGPVKQPCNVGEJPQNQI[VJG Contact TCVKQQHNQCFECRCEKV[VQCEVWCNYGKIJVYCU YYYHONOYVWOFG 6CMKPIKPVQCEEQWPVEWTTGPVGEQPQOKE KORTQXGFUKIPKƄECPVN[+PEQODKPCVKQPYKVJ MQPVCMV"HONOYVWOFG GEQNQIKECNUQEKCNCPFVGEJPQNQIKECN KPVGNNKIGPVEQPEGRVUHQTGPGTI[TGEWRGT 2JQPG FGXGNQROGPVUUWEJCUEQPVKPWKPIXQNCVKNKV[ CVKQPVJKUNGCFUVQCTGFWEVKQPQHGPGTI[ QHVJGOCTMGVUEJCPIKPIFGOQITCRJ[CPF FGOCPFQHWRVQRGTEGPVCPFVJWU VGEJPQNQIKECNKPPQXCVKQPUVJGHQEWUQH UKIPKƄECPVUCXKPIUKPGPGTI[EQPUWORVKQP VJG+PUVKVWVGKPYCUQPFGUKIP Innovative Conveyor Technology FKURNC[KPCWVQOQDKNGUCUKPXGUVKICVGFKP VJGTGUGCTEJRTQLGEVn'KPUCV\FGT#WIOGP VGF4GCNKV[6GEJPQNQIKG\WT7PVGTUVØV\WPI FGU(CJTGTUXQP(NWTHÒTFGT\GWIGPo4GEGPV UVWFKGURGTHQTOGFCVVJG+PUKVWVGHONUJQY RQVGPVKCNHQTKPFWUVTKCNCRRNKECVKQPUGURG EKCNN[VQUKORNKH[HQTMNKHVVTWEMQRGTCVKQPUKP CTGCUVJCVCTGFKHƄEWNVVQQDUGTXGCPFHQT KPGZRGTKGPEGFFTKXGTU Projects &KURNC[KPIQHKPHQTOCVKQPQPHQTMNKHVVTWEMHTQPVRCPG ■ &CU5VCRNGTCWIG #+( ■ 7PVGTUWEJWPIWPF/QFGNNKGTWPIFGT High throughput, low energy consumption, 5EJYKPIWPIUØDGTVTCIWPIXQP(NWT JKIJƅGZKDKNKV[CPFGTIQPQOKEFGUKIP HÒTFGT\GWITGKHGP #+( CTGHWPFCOGPVCNTGSWKTGOGPVUHQTWRVQ ■ 'KPUCV\FGT#WIOGPVGF4GCNKV[6GEJ FCVGEQPXG[QTVGEJPQNQI[#PKORQTVCPV PQNQIKG\WT7PVGTUVØV\WPIFGU(CJTGTU TGUGCTEJCTGCKUVJGFGUKIPQHKPVWKVKXG XQP(NWTHÒTFGT\GWIGP #+( CUUKUVCPEGU[UVGOUCPFJWOCPOCEJKPG ■ *QEJIGUEJYKPFKIMGKVUHÒTFGTU[UVGOHØT KPVGTHCEGUHQTEQPXG[QTVGEJPQNQI[1PG )TQ»NCFWPIUVTÀIGT #+(<+/ GZCORNGKUVJGCRRNKECVKQPQHCWIOGPVGF ■ $KQ%JKR(GGFKPIs9QQFEJKRHGGFKPI TGCNKV[VGEJPQNQIKGUVQFKURNC[KPHQTOC VGEJPQNQI[QHVJGHWVWTGHQTUOCNNUECNG VKQPQPVJGHTQPVRCPGQHHQTMNKHVVTWEMU DKQOCUUDQKNGTU '7 CRRTQZKOCVGN[EQORCTCDNGVQCJGCFWR Institute for Materials Handling, Material Flow, Logistics 75 Sustainable Logistics Systems 5WUVCKPCDKNKV[KUQPGQHVJGDKIIGUVHWVWTG EJCNNGPIGUHQTEGFD[GPXKTQPOGPVCN GEQPQOKECPFUQEKCNFGXGNQROGPVU KVKU TCPMGFCOQPIVJGUQECNNGFOGICVTGPFU 6JKUCRRNKGUCNUQVQVJGƄGNFQHNQIKUVKEU #DQXGCNNKPVJGUVCIGUQHRNCPPKPICPF TWPPKPICNQIKUVKECNU[UVGOCURGEVUQH UWUVCKPCDKNKV[KGVJGGSWKROGPVoUGPGTI[ EQPUWORVKQPJCXGVQDGEQPUKFGTGF *KIJDC[YCTGJQWUGEQPUVTWEVGFHTQOYQQF #NPCVWTC (QTVJKUTGCUQPYGFGXGNQROQFGNUHQT Photographer Marc Doradzillo) RTGFKEVKPIVJGGPGTI[EQPUWORVKQPQH XCTKQWUOGCPUQHEQPXG[CPEG(WTVJGT Projects OQTGWREQOKPIEQPEGRVUCTGGXCNWCVGF ■ 9KTVUEJCHVNKEJGWPFÒMQNQIKUEJG TGICTFKPIVJGKTEJCTCEVGTKUVKEUKPVGTOUQH 2QVGP\KCNGXQP*QEJTGICNNCIGTPCWU UWUVCKPCDKNKV[+PVJKUEQPVGZVVJGKPXGUVKIC *QN\ #+( ■ VKQPQHHWGNEGNNFTKXGPITQWPFEQPXG[QTU &CU%1PGWVTCNG.QIKUVKM\GPVTWO KUQPGGZCORNG#PQVJGTTGUGCTEJRTQLGEV s'PVYKEMNWPIXQPICP\JGKVNKEJGP PCOGN[n9KTVUEJCHVNKEJGWPFÒMQNQIKUEJG *CPFNWPIUGORHGJNWPIGPHØTGPGTIKG 2QVGP\KCNGXQP*QEJTGICNNCIGTPCWU*QN\o GHƄ\KGPVG.QIKUVKM\GPVTGP #+( EQORCTGUVJGUWUVCKPCDKNKV[QHJKIJDC[ ■ 'TYGKVGTVG.QIKUVKMU[UVGORNCPWPIWPVGT YCTGJQWUGUDWKNVQHYQQFYKVJVTCFKVKQPCN 'KPDG\KGJWPIFGU'PGTIKGXGTDTCWEJU EQPUVTWEVKQPUOCFGQHUVGGN$CUGF #+( QPVJGTGUWNVUUVCPFCTFK\GFECNEWNCVKQP ■ *+PVTC&TKXGs'KPUCV\XQPYCUUGTUVQHH OQFGNUHQTEQPUVTWEVKPIYQQFGPJKIJDC[ DGVTKGDGPGP(NWTHÒTFGT\GWIGPKPFGT YCTGJQWUGUCTGFGTKXGF +PVTCNQIKUVKMWPVGT2TQFWMVKQPUDGFKP IWPIGP 019 Planning and Control of Material Flow Systems /CVGTKCNƅQYU[UVGOUCTGOQTGCPF OQTGEQORNGZFWGVQVJGPGEGUUKV[QH JKIJƅGZKDKNKV[CPFHCUVOQFKƄECVKQPCPF GZVGPUKQPQHVJGU[UVGOUCEEQTFKPI VQEJCPIKPIEWUVQOGTWUGTPGGFU+P EQPXGPVKQPCNOCVGTKCNƅQYU[UVGOUVJGUG OQFKƄECVKQPUOC[TGUWNVKPNQPIRGTKQFUQH WPRTQFWEVKXGTGEQPUVTWEVKQPCPFTGRTQ ITCOOKPI&GEGPVTCNK\GFEQPVTQNU[UVGOU CKOQPDTGCMKPIVJKURCTCFKIOCPFGPCDNG HCUVCPFUKORNGCFCRVCVKQPUQHOCVGTKCN ƅQYU[UVGOU+PVJG&()TGUGCTEJ RTQLGEVn&G\GPVTCNG.CIGTXGTYCNVWPIHØT YCPFNWPIUHÀJKIGNQIKUVKUEJG5[UVGOGoVJG FGEGPVTCNK\GFEQPVTQNNQIKEYCUVTCPUNCVGF VQJKIJGTNGXGNYCTGJQWUGOCPCIGOGPV U[UVGOU+PVGNNKIGPVEQPVCKPGTUMPQYEQO OWPKECVGKORQTVCPVKPHQTOCVKQPGIVJGKT 0GVYQTMVQRQNQI[QHCFGEGPVTCNYCTGJQWUGOCPCIG- RQUKVKQPCPFVTCPURQTVFGUVKPCVKQP+HKPHQT OGPVU[UVGOKPCUOCNNJGVGTQIGPQWUYCTGJQWUG OCVKQPEQPEGTPKPICURGEKƄECTGQHVJG 76 Institute for Materials Handling, Material Flow, Logistics YCTGJQWUGGIKPXGPVQT[FCVCKUPGGFGF ■ -GPP\CJNGPU[UVGO/CVGTKCNƅWUUGHƄ VJKUFCVCKUTGVTKGXGFCPFEQPUQNKFCVGF \KGP\KPFGT#WVQOQDKNNQIKUVKM 89 KPCPCFJQEOCPPGTHTQOVJGKPFKXKFWCN ■ (NGZKDKNKVÀVUUVGWGTWPIFGT+PDQWPF EQPVCKPGTU9CTGJQWUGOCPCIGOGPV .QIKUVKMKOXQNCVKNGP7OHGNFFGT0WV\ U[UVGOUVJWUCTGUECNCDNGCPFCFCRVCDNG HCJT\GWIKPFWUVTKG /#067/ YJGPYCTGJQWUGUCTGOQFKƄGFCPFECP ■ (QT(QQF62s5KEJGTGWPFGHƄ\KGPVG GCUKN[DGGZVGPFGFD[PGYHWPEVKQPU 5WRRN[%JCKPKPFGT.GDGPUOKVVGNKPFWU VTKGFWTEJGKPGPKPVGNNKIGPVGP$GJÀNVGT Projects $(5 ■ &G\GPVTCNG.CIGTXGTYCNVWPIHØTYCPF ■ 6TCKNGTMQP\GRVGHØT$WPF%6GKNGHCOK NWPIUHÀJKIGNQIKUVKUEJG5[UVGOG &() NKGP /#067/ ■ 'PVYKEMNWPIGKPGTCIGPVGPDCUKGTVGP ■ 4QWVGP\ØIGKO-QPVGZVJQJGT5CEJ /GVJQFKM\WT6GTOKPRNCPQRVKOKGTWPI PWOOGTPUEJYCPMWPIGP $/9 KO$CWYGUGPWPVGT$GTØEMUKEJVKIWPI ■ 1RVK/#.s1RVKOCNG2NCPWPIOCPWGNNGT TGUUQWTEGPCDJÀPIKIGT2TQ\GUUNÀPIGP .CIGTU[UVGOG #+( &() ■ +PVGI4QWVGs)CP\JGKVNKEJG-QP\GRV ■ (#756s(GTVKIWPIUU[PEJTQPG#DNCWH CWUYCJNHØT4QWVGP\WIU[UVGOG\WT UKOWNCVKQPXQP7PKMCVDCWUVGNNGPKO 2TQFWMVKQPUXGTUQTIWPIs+PVGITKGTVG 5RG\KCNVKGHDCW $(5 $GYGTVWPIXQP2TQ\GUUWPF6GEJPKM ■ 1RVKOKGTWPIXQP'PVNCFGUVTCVGIKGPDGK #+( FGT5EJØVVIWV5EJKHHUGPVNCFWPI #+( Industry 4.0 6JGKPETGCUKPIFGOCPFHQTJKIJN[EWUVQ OK\CDNGRTQFWEVURTGUGPVUPGYEJCNNGPIGU VQRTQFWEVKQPCPFOCVGTKCNJCPFNKPI U[UVGOUVJCVJCXGVQFGCNYKVJCNCTIGT PWODGTQHRTQFWEVXCTKCPVU6QTGURQPF VQVJGEJCNNGPIGQHVJGEQPUVCPVN[TKUKPI EQORNGZKV[QHVQFC[oUU[UVGOUVJGNCWPEJ QHVJG+PFWUVT[CKOUCVVJGFGRNQ[OGPV QHCWVQPQOQWUE[DGTRJ[UKECNU[UVGOU %25 6JGUGU[UVGOUGPCDNGVJGGHƄEKGPV Using Google Glass to support order picking proces- OCPCIGOGPVQHEQORNGZKV[YJKNGOCKP ses in a warehouse VCKPKPIVJGKTƅGZKDKNKV[CPFCFCRVCDKNKV[VQC HCUVEJCPIKPIRTQFWEVKQPGPXKTQPOGPV Projects 6JG+PUVKVWVGHONJCUFGXGNQRGFCTGUGCTEJ ■ -Q&G/CVs$GHÀJKIWPIXQP-/7\WT CTGCVJCVHQEWUGUQPUWRRQTVKPIVJG MQNNCDQTCVKXGP2NCPWPIWPF'PVYKEM FGUKIPQHUWEJKPPQXCVKXGUQNWVKQPUCPF NWPIJGVGTQIGPGTFG\GPVTCNIGUVGWGTVGT VJGKTKPVGITCVKQPVQGZKUVKPIEQORNGZ /CVGTKCNƅWUUU[UVGOG #+( U[UVGOU5RGEKCNHQEWUKUIKXGPVQVJG ■ 2KEMD[.QECN.KIJVs'KPUCV\XQP UVWF[QHVJGKORNKECVKQPUVJCVVJGKPVTQFWE &TCJVNQUUGPUQTPGV\GPKPFGT-QOOKUUK VKQPQH%25JCUVQVJGRNCPPKPIRTQEGUU QPKGTWPI #+( QHOQFGTPYCTGJQWUGHCEKNKVKGU+PVJKU ■ 6QQN%NQWFs7PVGTPGJOGPUØDGTITGK FKTGEVKQPCENQWFDCUGFUQHVYCTGRNCVHQTO HGPFGU.GDGPU\[MNWUOCPCIGOGPVHØT YCUFGXGNQRGFVJCVGPCDNGUEQNNCDQTCVKQP 9GTM\GWIGKPFGT%NQWFOKVVGNUGKPFGW DGVYGGPOCPWHCEVWTGTUCVFGUKIPKPICPF VKIGT-GPP\GKEJPWPIWPF+FGPVKƄMCVKQP VGUVKPIQHJGVGTQIGPGQWUFGEGPVTCNK\GF $/$( EQPVTQNNGFU[UVGOURTKQTVQVJGKTFGRNQ[ ■ 4(+&/QDK8KUs/QDKNG4(+&.GUGHGN OGPV FGTHCUUWPI #+( Institute for Materials Handling, Material Flow, Logistics 77 Humans in Logistics &GOQITCRJKEEJCPIGUCPFƅWEVWCVKQPQH GORNQ[GGUNGCFVQPGYEJCNNGPIGUKPVJG FGUKIPQHNQIKUVKEUYQTMRNCEGU9QTMƅQYU OWUVDGHCKNRTQQHOQVKXCVKPICPFGHƄEKGPV YJKNGCVVJGUCOGVKOGGORNQ[GGUo RJ[UKECNCPFOGPVCNUVTGUUOWUVDG TGFWEGF4GUGCTEJVQRKEUCVVJG+PUVKVWVG HONHQEWUQPVJGCUUGUUOGPVQHRJ[UKECN NQCFCVNQIKUVKEUYQTMRNCEGUWUKPIFKHHGTGPV Game characters in order-picking game CRRTQCEJGUCPFQPVJGKTGTIQPQOKE FGUKIPQPVJGQPGJCPF+PCUGEQPFNKPG Projects QHTGUGCTEJPCOGN[KPVJGLQKPVTGUGCTEJ ■ 'TIQ,QDTQVCVKQPs2NCPWPIUOGVJQFKM RTQLGEVn)COG.QIs)COKƄECVKQPKPFGT HØTGKPGGTIQPQOKUEJQRVKOCNG,QDTQVC +PVTCNQIKUVKMoYKVJVJG%JCKTQH'FWECVKQP VKQPKPFGT+PVTCNQIKUVKM #+( CPF'FWECVKQPCN2U[EJQNQI[QHVJG ■ 'TYGKVGTWPI5[UVGOXQTDGUVKOOVGT .WFYKI/CZKOKNKCPU7PKXGTUKV[QH/WPKEJ Crane Engineering and Design of Load-supporting Structures 4GUGCTEJKPVJGƄGNFUQHETCPGGPIKPGGTKPI CPFFGUKIPQHNQCFUWRRQTVKPIUVTWEVWTGU JCUCNQPIVTCFKVKQPCVVJG+PUVKVWVGHON 1PGTGEGPVTGUGCTEJVQRKEKUKPXGUVKICVGF KPVJG&()RTQLGEVn5[UVGOCVKUEJGT 8GTINGKEJFGTF[PCOKUEJGP$GCPURTW EJWPIGPXQP)KVVGTOCUV(CJT\GWIMTCPGP OKVFGP'TIGDPKUUGPFGTSWCUKUVCVKUEJGP #WUNGIWPIPCEJ&+0'0o 6JGRTQLGEVCKOGFQPFGVGTOKPKPIVJG OCZKOWOF[PCOKEUVTGUUGUKPVJG QRGTCVKQPUJQUVKPINWHƄPICPFUNGYKPI HQTCTGRTGUGPVCVKXGUGNGEVKQPQHDQQO EQODKPCVKQPUCPFDQQORQUKVKQPUQH Finite element model of a lattice boom crawler crane NCVVKEGDQQOETCPGUWUKPIF[PCOKEƄPKVG GNGOGPVECNEWNCVKQPU6JGUGTGUWNVUCTG 78 Institute for Materials Handling, Material Flow, Logistics EQORCTGFYKVJVJGTGUWNVUECNEWNCVGF 6JKUCNNQYGFVJGFGRCTVOGPVHONQHVJG CEEQTFKPIVQVJGTGNGXCPVUVCPFCTFU 67/VQETGCVGPGYCRRTQCEJGUYJKEJ 6JGGXCNWCVKQPQHEQORQPGPVWVKNK\CVKQPU CTGGZRGEVGFVQUKIPKƄECPVN[KPETGCUG CPFUVTGUUGUQHVJGF[PCOKECPFSWCUK VJGCEEWTCE[QHVJGECNEWNCVKQPQHNCVVKEG UVCVKEECNEWNCVKQPUUJQYGFRCTVN[NCTIG DQQOETCPGU FKHHGTGPEGUDGVYGGPVJGVYQV[RGUQHECN EWNCVKQP6JGUNGYKPIRTQEGUUTGXGCNGFVJG Projects DKIIGUVFKHHGTGPEGUHQNNQYGFD[JQKUVKPI ■ 5[UVGOCVKUEJGT8GTINGKEJFGTF[PC CPFNWHƄPI OKUEJGP$GCPURTWEJWPIGPXQP 6JKUNGFVQVJGFGXGNQROGPVQHQUEKNNCVKQP )KVVGTOCUV(CJT\GWIMTCPGPOKVFGP OQFGNUVQFGVGTOKPGVJGF[PCOKEHCEVQTU 'TIGDPKUUGPFGTSWCUKUVCVKUEJGP YJKEJGPCDNGQRVKOK\GFSWCUKUVCVKE #WUNGIWPIPCEJ&+0'0 &() ECNEWNCVKQPU6JGF[PCOKENQCFUFWTKPI ■ -#.15s+PVGITCN*GDGU[UVGO\WT UNGYKPICPFNWHƄPICTGOQFGNNGFUKIPKƄ MTCPNQUGP'TTKEJVWPIWPF9CTVWPIU ECPVN[DGVVGTVJCPWUKPIVJGCRRTQCEJGUQH CDUGPMWPIGKPGT9KPFGPGTIKGCPNCIG VJGEWTTGPVUVCPFCTFU $/7 Research Focus Courses ■ +PPQXCVKXGEQPXG[QTVGEJPQNQI[ ■ %#&CPF/CEJKPG&TCYKPI+ ++ ■ 5WUVCKPCDNGNQIKUVKEUU[UVGOU ■ /CVGTKCNU*CPFNKPICPF/CVGTKCN(NQY ■ 2NCPPKPICPFEQPVTQNQHOCVGTKCNƅQY 6GEJPQNQI[ systems ■ 2NCPPKPIQH6GEJPKECN.QIKUVKEU5[UVGOU ■ +PFWUVT[ ■ /CEJKPG5[UVGO6GEJPQNQI[ ■ *WOCPUKPNQIKUVKEU ■ /CVGTKCN(NQYCPF.QIKUVKEU ■ %TCPGGPIKPGGTKPICPFFGUKIPQH ■ .QIKUVKEUKPVJG#WVQOQVKXG+PFWUVT[ NQCFUWRRQTVKPIUVTWEVWTGU ■ 4QRGYC[6GEJPQNQI[ ■ &GXGNQROGPV2TQEGUUHQT/QDKNG Competence /CEJKPG6QQNU ■ .QIKUVKEURNCPPKPI ■ %QPXG[KPIQH$WNM)QQFU ■ 4(+&U[UVGOU ■ 8KTVWCNCPFCWIOGPVGFTGCNKV[ ■ 4GCNVKOGNQECVKQPU[UVGOU ■ ('/CPF/-5 ■ 5KOWNCVKQPQHNQIKUVKEUU[UVGOU Infrastructure ■ #WIOGPVGFTGCNKV[RKEMKPI\QPG ■ #WVQOCVKEUOCNNRCTVUUVQTCIGU[UVGO ■ 'NGEVTKEOQPQTCKN ■ +PFWUVTKCNTQDQV ■ -CTFGZUJWVVNG:2 ■ /GEJCPKEYQTMUJQR ■ 4(+&VGUVKPIGSWKROGPV ■ 6GUVKPIHCEKNKV[HQTJKIJRGTHQTOCPEG UETGYEQPXG[QTU ■ 8KTVWCNTGCNKV[NCDQTCVQT[ Institute for Materials Handling, Material Flow, Logistics 79 Management /KEJCGN-GNVGTDQTP/5E 2TQH&T+PI&KRN9K+PI9KNNKDCNF# %JTKUVQRJGT-GWPVLG/5E )ØPVJPGT &KRN9KTV+PI/CTMWU-NGXGTU &KRN+PI5VGRJCP-GUUNGT &KRN9K+PI/[TKCO-QEJ &T+PI/KEJCGN-NGGDGTIGT &KRN+PI$CMKT-TGUQ 6JQOCU#V\/5E #TOKP.CPI/5E &KRN+PI)CDTKGN(KUEJGT &KRN+PI,QJCPPGU.GEJPGT &KRN9KTVUEJ+PI5VGHCP)CNMC 6JQOCU.KGPGTV/5E &KRN+PI5GDCUVKCP*CDGPKEJV &KRN+PI%JTKUVQRJGT.WFYKI &KRN9K+PI'XC-NGPM &KRN-HHT%QTKPPC/CCU/5E &KRN+PI6QDKCU5VCCD 4QDGTV/KEJGNK/5E &KRN+PI5GWPI[QPI1J Adjunct Professors &KRN+PI,WNKCP2TQHCPVGT 2TQH0KMQNCWU$CWGT /KEJCGN4CEMN/5E 2TQH&TTGTPCV'TKEJ-KTUEJPGEM &KRN+PI6QDKCU4COOGNOGKGT (TKGFGTKMG4GEJN/5E Administrative Staff &KRN+PI5WUCPPG4KPPGDGTI %NCWFKC%QOOQP ,CP4QVCTF/5E $TKIKVVG5VGRJCPK &KRN+PI/CTEWU4ÒUEJKPIGT 6QDKCU*GOOCWGT &KRN+PI/CTMWU5RKPFNGT 5WUCPPG*ÒEJV$'PI &KRN+PI/CVVJKCUXQO5VGKP &T+PI4WK9CPI Research Scientists ;WCP6CP/5E &KRN+PI/CVVJKCU#ODGTIGT &KRN+PI(NQTKCP9GP\NGT &KRN+PI/CTEQ&GYKV\ ;KRGPI 80 Institute for Materials Handling, Material Flow, Logistics Publications 2013-14 ■ -GNVGTDQTP/ $WTIJCTV% -TCWN4 +PVTC% ■ -NGGDGTIGT/ 5EJPGKFNGT5 )ØPVJPGT9# )ØPVJPGT9# Institute for Materials Handling, Material Flow, Logistics 81 ■ -NGXGTU/ .GJTUVWJNHONs5EJWNWPIU#RR ■ 5CKNGT/ -NGXGTU/ *GPUG, /CPFN* *GDG\GWIG(ÒTFGTOKVVGN +550 (ÒTFGTWPIXQP/QVKXCVKQPFWTEJ)COKƄECVKQPKP R #TDGKVUMQPVGZVGP6CIWPIFGT#TDGKVUITWRRGHØT ■ 5CKNGT/ *GPUG, /CPFN, -NGXGTU/ 'OKTKUEJG2ÀFCIQIKUEJG(QTUEJWPI 2U[EJQNQIKECN2GTURGEVKXGUQP/QVKXCVKQPVJTQWIJ ■ /KTNCEJ/ )ØPVJPGT9# 7NDTKEJ# $GEMJCWU )COKƄECVKQP+PVGTCEVKQP&GUKIPCPF#TEJKVGEVWTG - #WHVTCIU\WVGKNWPIUXGTHCJTGPHØT5VCRNGTNGKVU[U ,QWTPCN9KPVGT R VGOG+P 8&+9KUUGPUHQTWO)OD*(NWTHÒTFGT ■ )ØPVJPGT9# *CDGPKEJV5 .WDGT/ 5VTQO \GWIVCIWPI8&+8GTNCI)OD*&ØUUGNFQTH HTGUUGTPCWHFGT5RWT.1)+56+-*'76' 8&+$GTKEJVG+5$0 +550RR RR ■ 4COOGNOGKGT6 )ØPVJPGT9# +PHQTOCVQTKUEJG ■ 1J5 &CPKNQX' (KUEJGT) )ØPVJPGT9# 2TQ\GUUGKPFGTOCPWGNNGP-QOOKUUKQPKGTWPIs $TWPU4 7PVGTUWEJWPIWPF/QFGNNKGTWPIFGT &WTEJDNKEMOKV&CVGPDTKNNG*GDG\GWIG(ÒTFGTOKVVGN 5EJYKPIWPIUØDGTVTCIWPIXQP(NWTHÒTFGT\GWITGKHGP +550RR 6CIWPIUDCPF9)6.-QNNQSWKWO+5$0 ■ -CTIWN# $ØINGT/ -GUUNGT5 $QTTOCPP# )ØPVJPGT9 (GTVKIWPIUU[PEJTQPG#DNCWHUKOWNC ■ (TGKU, 8QJNKFMC2 82 Institute for Materials Handling, Material Flow, Logistics ■ )CNMC5 -NGPM' )ØPVJPGT9# 2NCPPKPIQH ■ )CNMC5 &GYKV\/ )ØPVJPGT9# &TKXG6JTW RTQFWEVKQPUWRGTOCTMGVUHQTRTQFWEVKQPUWRRN[ HØT4QWVGP\ØIG'HƄ\KGP\UVGKIGTWPIDGKFGT +'''+PVGTPCVKQPCN%QPHGTGPEGQP5GTXKEG $GNCFWPIXQP4QWVGP\ØIGPOKV-NGKPNCFWPIUVTÀ 1RGTCVKQPUCPF.QIKUVKEUCPF+PHQTOCVKEU 51.+ IGTP,CJTDWEJ.QIKUVKMHTGGDGTCVWPI)OD* +'''&QPIIWCP+5$0 -QTUEJGPDTQKEJ+5$0 RR RR| ■ 'TVN4 )ØPVJPGT9# 5EJPGNN\WCWUUCIG ■ -NGPM' )CNMC5 )ØPVJPGT9# (ØTUEJNCPMG MTÀHVKIGP9GTVGPIGNCPIGP6GKN#PCN[VKUEJG 8GTUQTIWPI.QIKUVKMJGWVG #WUICDG $GTGEJPWPIFGUOKVVNGTGP'PGTIKGDGFCTHUXQP RH 4GICNDGFKGPIGTÀVGPOKV'PGTIKGTØEMURGKUWPI( * ■ *CDGPKEJV5 )ØPVJPGT9# 'PGTIKGDGFCTH s(ÒTFGTPWPF*GDGP+550 UGTOKVVNWPIKPFGT)TQDRNCPWPIURJCUGs9GNEJG RR| #PUÀV\GGKIPGPUKEJ!*GDG\GWIG(ÒTFGTOKVVGN ■ (TGKU, 8QJNKFMC2 Institute for Materials Handling, Material Flow, Logistics 83 Institute of Flight Propulsion 'ZRGTKOGPVCNKPXGUVKICVKQPCPFPWOGTKECNUKOWNCVKQPQHƅKIJVRTQRWNUKQPU[UVGOUCPFVWTDQOCEJKPGT[EQORQPGPVU ■ Research activities of the Institute of Flight Propulsion in 2013-14 EQXGTGFVQRKEUKPVJGƄGNFUQHƅKIJVRTQRWNUKQPICUVWTDKPGUCPFVJGTOCN VWTDQOCEJKPGT[$CUGFQPCNQPIVTCFKVKQPVJGKPUVKVWVGFGXGNQRUVJGTOQ- F[PCOKEGPIKPGOQFGNUKPQTFGTVQKPXGUVKICVGUVGCF[CPFWPUVGCF[ICU VWTDKPGGPIKPGCPFVWTDQOCEJKPGT[DGJCXKQT (KHV[[GCTUQHVJG+PUVKVWVGQH(NKIJV OQUVCFXCPEGFJKIJURGGFTGUGCTEJEQO 2TQRWNUKQPsHQWPFGFKPVJGKPUVKVWVG RTGUUQTNCDQTCVQTKGUHQEWUGFQPFGXGNQ EGNGDTCVGFKPCUWEEGUUUVQT[FWTKPI RKPIVQOQTTQYoUCKTETCHVGPIKPGUCPF VJGRCUVJCNHEGPVWT[#PQVJGTJKIJNKIJV ICUVWTDKPGU5VCTVKPIYKVJRNCPPKPIVJG YCUVJGPGYHTCOGYQTMCITGGOGPV NCDQTCVQTKGUVJGƄTUVTGUWNVUCTGCNTGCF[ Prof. Dr.-Ing. DGVYGGPVJG+PUVKVWVGQH(NKIJV2TQRWNUKQP XKUKDNG+POKFVJGEQORTGUUQTUVCIG Oskar J. Haidn 67/VJG$CXCTKCP)QXGTPOGPVCPF)' KVUGNHYKNNCTTKXGKP)CTEJKPI6JGEQOOKU (Acting Head) )NQDCN4GUGCTEJ'WTQRG6JGEQQRGTCVKQP UKQPKPIQHVJGGPVKTGTKIYKNNDGƄPKUJGFD[ KPENWFGUVJGFGXGNQROGPVQHVJGYQTNFoU VJGGPFQH Contact YYYNHCOYVWOFG UGMTGVCTKCV"NHCOYVWOFG %QORTGUUQT#GTQF[PCOKEU2GTHQTOCPEG 2JQPG and Operating Range Extension The achievement of a high level of GHƄEKGPE[KPEQODKPCVKQPYKVJVJGIWCT CPVGGQHCGTQF[PCOKEUVCDKNKV[KUCOCKP QDLGEVKXGKPVJGFGUKIPQHJKIJN[NQCFGF EQORTGUUQTU5KPEGVJGUVCDKNKV[OCTIKP FTQRUETKVKECNN[YKVJKPETGCUGFUVCIG NQCFKPICPFVTCPUKGPVQRGTCVKQPKFGPVKH[KPI CPFWPFGTUVCPFKPIVJGOGEJCPKUOUHQT UVCNNKPEGRVKQPKUVJGMG[VQKPETGCUKPIVJG TCPIGQHUVCDNGQRGTCVKQP 7PUVGCF[ƅQYUKOWNCVKQPUCTGCRRNKGFVQ KPXGUVKICVGVJGRJGPQOGPCKPJGTGPVVQ VJGFGXGNQROGPVQHCGTQF[PCOKEKPUVC DKNKVKGU(QTCPKPXGUVKICVGFEGPVTKHWICN EQORTGUUQTVJGKORCEVQHPGYN[FGUKIPGF 6KRDNQYKPIECUKPIVTGCVOGPVCRRNKGFVQCPCZKCN EKTEWOHGTGPVKCNN[PQPWPKHQTOKPNGVIWKFG EQORTGUUQTKPENWFKPIUVTGCONKPGU XCPGUKUUVWFKGF6JGUKOWNCVKQPTGUWNVU CTGXCNKFCVGFCICKPUVOGCUWTGOGPVFCVC WPUVGCF[KPVGTCEVKQPDGVYGGPOCKPƅQY EWTTGPVN[CESWKTGFHTQOVJGKPUVKVWVGoU CPFVJGGZKVKPICPFTGGPVGTKPIVTGCVOGPV JKIJURGGFEGPVTKHWICNEQORTGUUQTVGUV ƅQYKUKPXGUVKICVGFWUKPIUVCVGQHVJG TKI(WTVJGTOQTGECUKPIVTGCVOGPVUHQT CTVRJCUGNCIUKOWNCVKQPU'ZRGTKOGPVCN OWNVKUVCIGCZKCNEQORTGUUQTUCTGFGUKIP XCNKFCVKQPKURGTHQTOGFKPENQUGEQQRGT GFPWOGTKECNN[CUCOGCPUVQRCUUKXGN[ CVKQPYKVJCUUQEKCVGFPCVKQPCNTGUGCTEJ GZVGPFVJGUVCDNGQRGTCVKPITCPIG6JG KPUVKVWVGU 84 Institute of Flight Propulsion Computational Aeroacoustics for Ducted CPF7PFWEVGF6WTDQOCEJKPGT[ )TQYKPIGPXKTQPOGPVCNCYCTGPGUUTCKUGU FGOCPFHQTJKIJN[GHƄEKGPVCPFNQYPQKUG GOKVVKPIVWTDQOCEJKPGT[IWCTCPVGGKPI UVCDNGQRGTCVKQPWPFGTCNCTIGTCPIGQH QRGTCVKPIEQPFKVKQPU+PQTFGTVQKORTQXG UVCVGQHVJGCTVVWTDQOCEJKPGT[OQFGTP PWOGTKECNOGVJQFUCTGCRRNKGFVQRTGFKEV ƅWKFƅQYUCPFCEQWUVKEUKIPCVWTGUUKOWN 5QWPFGOKUUKQPUHTQOCEQWPVGT VCPGQWUN[6JGTGHQTGEQORWVCVKQPCNƅWKF TQVCVKPIQRGPTQVQTGZRTGUUGFCU VKOGKPUVCPVRTGUUWTGFKUVWTDCPEGU F[PCOKEUUQNXGTUCTGCRRNKGFVQUKOWNCVG TCFKCVGFHTQOVJGCGTQF[PCOKE VJGVKOGTGUQNXGFƅQYTGIKOGYKVJKPCP UQWTEGFQOCKP CGTQF[PCOKEUQWTEGFQOCKPCPFVJWUVQ FGFWEGVJGUQWTEGUHQTCGTQF[PCOKECNN[ IGPGTCVGFUQWPF CFXGEVKQPCNN[VTCPURQTVGFFKUVWTDCPEGU 2TGUGPVTGUGCTEJCEVKXKVKGUCTGHQEWUGF CPFOWVWCNRQVGPVKCNƄGNFKPVGTHGTGPEGU QPKFGPVKH[KPIVJGUQWPFUQWTEGUHTQO JCXGUJQYPJKIJRQVGPVKCNHQTTGFWEKPI WPFWEVGFRTQRWNUQTUYKVJEQWPVGTTQVCVKPI PQKUGGOKUUKQPU%QPUGSWGPVN[OGVJQFU DNCFGTQYU QRGPTQVQTU CUYGNNCUFWEVGF HQTRCUUKXGPQKUGEQPVTQNCTGFGTKXGFYJKEJ JGNKEQRVGTVCKNTQVQTU2CTVKEWNCTN[WPUVGCF[ TGN[QPCFXCPEGFVWTDQOCEJKPGT[FGUKIPU DNCFGTQYKPVGTCEVKQPUKPENWFKPIDQVJ DWKNVVQOKPKOK\GDNCFGTQYKPVGTCEVKQPU 5WRGTUQPKE%QODWUVKQP4GUGCTEJHQT Scramjet Applications (GRK 1095 1/2) #UETCOLGV UWRGTUQPKEEQODWUVKQP TCOLGV KUCHWVWTGCKTDTGCVJKPIRTQRWNUKQP EQPEGRVHQTJKIJURGGFXGJKENGUVTCXGNKPI HCUVGTVJCP/CEJ+VKUQPGQHVJGOQUV RTQOKUKPIRTQRWNUKQPEQPEGRVUHQTHWVWTG URCEGVTCPURQTVCVKQPU[UVGOUCPFJ[RGT UQPKEƅKIJVXGJKENGU &GURKVGFGECFGUQHTGUGCTEJKPVJKUCTGC UETCOLGVUUVKNNQHHGTUGXGTCNWPTGUQNXGF EJCNNGPIGU6QCEJKGXGCPCKTDTGCVJKPI J[RGTUQPKEƅKIJVQPGQHVJGMG[VGEJPQNQ IKGUKUUWRGTUQPKEEQODWUVKQP#VVJGUG URGGFUVJGTGUKFGPEGVKOGQHCKTKPUKFG %WTTGPVTGUGCTEJVQRKEUCTGTGNCVGFVQ 5WRGTUQPKEEQODWUVKQPVGUVDGF VJGGPIKPGKUQHVJGQTFGTQHOKNNKUGEQPFU KORTQXKPIEQODWUVKQPUVCDKNKV[TGFWEKPI at the Institute of Flight Propulsion 6JGTGHQTGOKZKPICPFTGCEVKQPRTQEGUUGU CWVQKIPKVKQPVGORGTCVWTGUCPFKPETGCUKPI KPVJGEQODWUVQTOWUVDGGHƄEKGPVCPF EQODWUVQTGHƄEKGPE[WUKPIECVCN[VKE XGT[HCUV TCFKECNHCTOKPICPFVJGKPXGUVKICVKQPQH 6JGKPVGTPCNƅQYQHCUETCOLGVEQODWUVQT VJGPQPTGCEVKPICPFTGCEVKPIKPVGTPCNƅQY KUUVWFKGFKPCUWRGTUQPKEEQODWUVKQPVGUV RJGPQOGPCWUKPIQRVKECNOGCUWTGOGPV DGFCVVJG+PUVKVWVGQH(NKIJV2TQRWNUKQP VGEJPKSWGU Institute of Flight Propulsion 85 %QORCEV6WTDQUJCHV'PIKPG3WKEM5VCTV5[UVGO for Rotorcraft Applications GPIKPGJCUVQDGSWKEMUVCTVECRCDNGFWG VQƅKIJVUCHGV[TGCUQPU3WCPVKƄECVKQPQH VJGHWGNUCXKPIUKUCHQECNRQKPVQHTGUGCTEJ QPKPVGPFGFUKPINGGPIKPGQRGTCVKQP 5KPEGVJKUGPIKPGWUCIGUVTCVGI[KUNKOKVGF VQEGTVCKPCTGCUQHVJGJGNKEQRVGTƅKIJV GPXGNQRGƅKIJVRGTHQTOCPEGCPCN[UKUQH VJGJGNKEQRVGTJCXGVQDGRGTHQTOGFKP CFXCPEG6JGPTGCNKUVKEƅKIJVOKUUKQPU CTGEJQUGPHQTUWDUGSWGPVƅKIJVOKUUKQP 6WTDQUJCHVGPIKPGVGUVDGF UKOWNCVKQPCPFGXCNWCVKQPTGICTFKPIC WUGHWNQRGTCVKQPCNUVTCVGI[(QTTGCNK\CVKQP %WTTGPVJGNKEQRVGTUQHVJGNKIJVCPF QHGPIKPGSWKEMUVCTVUCPGYU[UVGOYCU OGFKWOENCUUJCXGVYQGPIKPGUKPUVCNNGF FGXGNQRGFCPFGXCNWCVGFCVVJGVWTDQUJCHV FWGVQUCHGV[TGCUQPU*QYGXGTVJKU GPIKPGVGUVDGF+VUYQTMKPIRTKPEKRNG KPUVCNNGFRQYGTKUTCTGN[PGGFGFFWTKPIC KUDCUGFQPCKTKPLGEVKQPVJTQWIJ.CXCN ƅKIJVOKUUKQPCPFVJGGPIKPGUCTGQRGTC PQ\\NGUKPUKFGVJGEQORTGUUQTUGEVKQP VKPIOCKPN[KPRCTVNQCFNGCFKPIVQRQQT 6JGTGYKVJCUKIPKƄECPVUVCTVWRVKOG URGEKƄEHWGNEQPUWORVKQP#PQRGTCVKQPCN TGFWEVKQPECPDGCEJKGXGF5KPEGUJQRCKT UVTCVGI[FWTKPIƅKIJVECPDGCPKPVGPFGF KUCEVWCNN[WUGFHQTVJGSWKEMUVCTVU[UVGO UJWVFQYPQHQPGGPIKPG6JGTGSWKTGF CPCFFKVKQPCNU[UVGOKUFGUKIPGFHQTKPFG RQYGTKUVJGPEQXGTGFD[VJGTGOCKPKPI RGPFGPVCKTUWRRN[CPFHQTKPVGITCVKQPKPVQ GPIKPGYJKEJVJWUTWPUCVJKIJGTNQCFU CJGNKEQRVGTCKTHTCOG(QTHWTVJGTKPXGUVK CVGPJCPEGFURGEKƄEHWGNEQPUWORVKQP ICVKQPQHVJGKPƅWGPEGQPVJGJGNKEQRVGT 6JGTGYKVJHWGNECPDGUCXGFVJGOKUUKQP FTKXGRQYGTVTCKPVJGVGUVDGFGPIKPGYCU TCPIGECPDGGPJCPEGFCPFGOKUUKQPU UWEEGUUHWNN[EQWRNGFYKVJVJGTGUGCTEJ ECPDGTGFWEGF+PECUGQHCHCKNWTGQHVJG UKOWNCVQTQHVJG+PUVKVWVGHQT*GNKEQRVGT TGOCKPKPITWPPKPIGPIKPGVJGUJWVQHH 6GEJPQNQI[ Structural Design and Optimization of Aircraft Engine Components #JKIJGTVWTDKPGKPNGVVGORGTCVWTGCPFVJG CFFKVKXGOCPWHCEVWTKPI #/ VGEJPQNQIKGU TGFWEVKQPQHEQORQPGPVYGKIJVCTGMG[ GPCDNGPQXGNNKIJVYGKIJVUVTWEVWTGU7UKPI RCTCOGVGTUHQTCDGVVGTQXGTCNNGHƄEKGPE[ VJGƄPKVGGNGOGPVOGVJQF ('/ CPGY QHHWVWTGRTQRWNUKQPU[UVGOU6JKUTGSWKTGU FGUKIPOGVJQFHQTCFFKVKXGN[OCPWHCE PGYFGUKIPEQPEGRVUHQTVWTDKPGEQO VWTGFVWTDKPGIWKFGXCPGUYKVJTGFWEGF RQPGPVU6JGPGYFGUKIPUJQWNFOGGV YGKIJVCPFWPEJCPIGFHWPEVKQPCNKV[CPF QTGZEGGFVJGTGNKCDKNKV[TGSWKTGOGPVUQH NKHGURCPKUKPXGUVKICVGF1PVJGQVJGT EQPXGPVKQPCNFGUKIPU(QTVJGKTNKHGURCP JCPFKPQTFGTVQEQQNCPFTGFWEGVJG VJGFKOGPUKQPKPIFCOCIGOGEJCPKUOUQH OCZKOWOOCVGTKCNVGORGTCVWTGCVVJGTKO 5VTGUUFKUVTKDWVKQPKPCIGPGTKE VWTDKPGEQORQPGPVUCTGNQPIVGTOETGGR QHVWTDKPGFKUMUVJGWUGQHJKIJVGORGTC FKUMC YKVJQWVCPFD YKVJJGCV CPFVJGTOQOGEJCPKECNHCVKIWG6QOGGV VWTGJGCVRKRGUKPUGTVGFKPVQVJGFKUM pipe VJGUGTGSWKTGOGPVUVYQFGUKIPEQPEGRVU OCVGTKCNKUKPXGUVKICVGF CTGKPXGUVKICVGF1PVJGQPGJCPF 86 Institute of Flight Propulsion Centrifugal Compressor Test Rig GHƄEKGPE[CPFQRGTCVKQPTCPIG4GUGCTEJ VQRKEUNKMGQRGTCVKQPTCPIGGZRCPUKQPD[ ƅQYEQPVTQNKORCEVQHKORGNNGTUWTHCEG TQWIJPGUURGTHQTOCPEGXCNKFCVKQPQH& KPFWUVTKCNEQORTGUUQTFGUKIPCPFXCTK CDNGKPNGVIWKFGXCPGU +)8U JCXGDGGP EQPFWEVGF .(#YKNNEQPVKPWQWUN[GZRCPFKVUTGUGCTEJ ECRCEKV[KPVJGCTGCQHEGPVTKHWICNEQO RTGUUQTUVQCEJKGXGKPFGRVJWPFGTUVCP FKPIQHVJGHQNNQYKPIVQRKEU %GPVTKHWICNEQORTGUUQTVGUVTKI ■ 2GTHQTOCPEGEJCTCEVGTKUVKEUQHUJTQWF GFCPFWPUJTQWFGFKORGNNGTUYKVJ +PVJG[GCTCPGYJKIJURGGFTCFKCN CRRNKECVKQPUKPRGVTQEJGOKECNKPFWUVTKGU EQORTGUUQTVGUVTKIYCUEQOOKUUKQPGF CPFCXKCVKQPDWUKPGUUGU KPEQQRGTCVKQPYKVJ)')NQDCN4GUGCTEJ ■ 6GUVKPIQHXCTKQWUKPNGVEQPƄIWTCVKQP 6JGNCVVGTOGGVUVJGKPFWUVTKCNUVCPFCTFU RQUUKDKNKVKGU HQTFGUKIPVGUVKPICPFGPCDNGUGZRGTK ■ +ORNGOGPVCVKQPQHCFXCPEGFFKHHWUKQP OGPVCNVGUVKPIQHFKHHGTGPVV[RGUQHOQFGTP U[UVGOU YKVJNQYFKHHWUGTTCVKQUPGY EGPVTKHWICNEQORTGUUQTUYKVJFTKXGRQYGT TGVWTPEJCPPGNXCPGUGVE WRVQM9CPFCOCZKOWOURGGFQH ■ 0WOGTKECNKPXGUVKICVKQPUKPRCTCNNGNVQ TRO6JGVGUVHCEKNKV[ECPDGQRGT GZRGTKOGPVCNUVWFKGU CVGFGKVJGTKPQRGPNQQRQTENQUGFNQQR EQPƄIWTCVKQP 6JGRTQLGEVKUHWPFGFD[VJG$CXCTKCP 6JGTGUGCTEJCEVKXKV[HQEWUGUQPVJGQRVK /KPKUVT[QH'EQPQOKE#HHCKTUCPF)')NQ OK\CVKQPQHEGPVTKHWICNUVCIGEQORQPGPVU DCN4GUGCTEJKP)CTEJKPIKPEQNNCDQTCVKQP CPFVJGKTOWVWCNKPVGTCEVKQPUKPVGTOUQH YKVJ)'1KN)CUCPF)'#XKCVKQP Competence Courses ■ 0WOGTKECNCPFGZRGTKOGPVCNKPXGUVKIC ■ (NKIJV2TQRWNUKQP+++ VKQPKPICUVWTDKPGUCPFVWTDQOCEJKPGT[ ■ 6WTDQOCEJKPGT[ $CUKECPF#FXCPEGF EQORQPGPVU ■ /GEJCPKECN&GUKIPQH,GV'PIKPGU ■ )CUVWTDKPGRGTHQTOCPEGUKOWNCVKQP ■ #GTQF[PCOKE&GUKIPQH6WTDQOCEJKP ■ (NWKFF[PCOKEUCPFUVTWEVWTCNOGEJC GT[ PKEUQHVWTDQOCEJKPGT[EQORQPGPVU ■ #RRNKECVKQPQH(NWKFOGEJCPKE%CNEWNC VKQP/GVJQFUHQT(NKIJV2TQRWNUKQP Infrastructure ■ ('/CPF%(&&GUKIPQH6WTDQOCEJKP ■ *GNKEQRVGTGPIKPGVGUVDGF GT[ ■ 6GUVTKIHQTEGPVTKHWICNEQORTGUUQTU ■ 6GUVTKIHQTCZKCNEQORTGUUQT WPFGT EQPUVTWEVKQP ■ 5WDUQPKECPFUWRGTUQPKEEQODWUVKQP VGUVDGF ■ 6GUVDGFUHQTXGT[UOCNNICUVWTDKPG GPIKPGU ■ +PUVKVWVGoUQYPEQORWVGTENWUVGTYKVJ OQTGVJCPEQTGU Institute of Flight Propulsion 87 Management #PFTÅ+P\GPJQHGT/5E 2TQH&T+PI1UMCT,*CKFP #EVKPI*GCF &KRN+PI/CTE-CKP\ &T+PI9QNHICPI'TJCTF %JTKUVQHGT-GPFCNN6QTT[/5E &T+PI#PFTGCU*WRHGT &KRN+PI (* 5GDCUVKCP.CPI/5E .KP[WCP.KC/5E Adjunct Professors &KRN+PI#PFTGCU.QQU 2TQH&T+PI*CPPU,ØTIGP.KEJVHW» &KRN+PI6QDKCU/C[GPDGTIGT &T+PI,ÒTI*GPPG/67#GTQ'PIKPGU &KRN+PI/CTEQ0CWDGTV 2TQH&T+PI*CPU4KEM &KRN+PI&CPKGN2CWMPGT 2TQH&T+PI&TJEOWNV)ØPVGT-CRRNGT &KRN+PI&CXKF4QEMGN &KRN+PI/CTEGN5EJOKGFGT Administrative Staff ,QQPC5GRRÀNÀ/5E #PIGNKMC*GKPKPIGT &KRN+PI#PVQP5VTGKV &KRN+PI (* 5VGHCP9GKJCTF Research Scientists -WP;CPI/5E 0CP%JGP/5E &KRN+PI(NQTKCP&CPPGT Technical Staff &KRN+PI5KPC'KUGPOCPP 7FQ$WUUG &KRN+PI%[TKN)WKPGV 2WDNKECVKQPU ■ #*WRHGT 'ZRGTKOGPVCN+PXGUVKICVKQPQH2GT ■ %)WKPGV,#5VTGKV8)ØOOGT*2-CW 6KR HQTOCPEG2CTCOGVGTUQH8GT[5OCNN,GV'PIKPG )CR8CTKCVKQPQPC6TCPUQPKE4QVQTKPVJG2TGUGPEG %QODWUVQTU6JGVJ+PVGTPCVKQPCN5[ORQUKWOQP QH6KR$NQYKPI)6#5/'6WTDQ'ZRQ 6TCPURQTV2JGPQOGPC0QXGODGT-TCDK &ØUUGNFQTH)GTOCP[,WPG 6JCKNCPF ■ ,5GRRÀNÀ#*WRHGT 6QRQNQI[1RVKOK\CVKQPKP ■ 5'KUGPOCPP#*WRHGT 5VTWMVWTOGEJCPKUEJG 5VTWEVWTCN&GUKIPQHC.26WTDKPG)WKFG8CPG #PCN[UGGKPGT)CUVWTDKPGPUEJGKDGOKVKPVGITKGTVGP 2QVGPVKCNQH#FFKVKXG/CPWHCEVWTKPIHQT9GKIJV *GCVRKRGU&GWVUEJG5+/7.+#-QPHGTGP\ 4GFWEVKQP)6#5/'6WTDQ'ZRQ 5GRVGODGT&TGUFGP &ØUUGNFQTH)GTOCP[,WPG ■ %5RKG»/-GTNGT/*CLGM 'HHGEVUQP*GNKEQRVGT ■ ,5GRRÀNÀ&-TCWU#*WRHGT 6JGTOQGNCUVKE &[PCOKEUKP%CUGQH'PIKPG(CKNWTG&WTKPI+PVGPFGF QRVKOK\CVKQPHQTCFFKVKXGN[OCPWHCEVWTGFVWTDQ 5KPING'PIKPG1RGTCVKQPVJ'WTQRGCP4QVQTETCHV OCEJKPGT[EQORQPGPVU2TGUGPVCVKQPKP'WTQRGCP (QTWO5QWVJCORVQP'PINCPF5GRVGODGT #NVCKT6GEJPQNQI[%QPHGTGPEG/WPKEJ,WPG ■ /-GTNGT9'TJCTF 'XCNWCVKQPQH*GNKEQRVGT(NKIJV ■ ,5GRRÀNÀ&4QEMGN#*WRHGT 0GY2QUUKDKNKVKGU /KUUKQPUYKVJ+PVGPFGF5KPING'PIKPG1RGTCVKQP QH#FFKVKXG/CPWHCEVWTKPIKP#GTQ'PIKPG%QORQ VJ'WTQRGCP4QVQTETCHV(QTWO5QWVJCORVQP PGPV&GUKIPs6QRQNQI[1RVKOK\GF6WTDKPG5VCVQT 'PINCPF5GRVGODGT (TCWPJQHGT&KTGEV&KIKVCN/CPWHCEVWTKPI%QPHGTGPEG ■ /-GTNGT5.CPI6(CWPGT9'TJCTF 'ZRGTKOGP /CTEJ$GTNKP)GTOCP[ VCN+PXGUVKICVKQPQH4QVCVKPI5VCNNCPF5WTIGKPVJG ■ #*WRHGT&*KTPFQTH +PXGUVKICVKQPQH2CTCOGVGTU %QORTGUUQT5[UVGOQHC*KIJ5RGGF6WTDQUJCHV #HHGEVKPIVJG6JGTOQF[PCOKE%[ENGQH8GT[5OCNN 'PIKPG,CJTGUVCIWPIFGT&GWVUEJGP)GUGNNUEJCHV ,GV'PIKPGUVJ+PVGTPCVKQPCN5[ORQUKWOQP HØT.WHV4CWOHCJTV#WIUDWTI5GRVGODGT 6TCPURQTV2JGPQOGPCCPF&[PCOKEUQH4QVCVKPI ■ ,5GRRÀNÀ&4QEMGN#*WRHGT 2GTHQTOCPEGCPF /CEJKPGT[+541/#%(GDTWCT[ (WPEVKQPCNKV[$CUGF&GUKIP/GVJQFUHQT+ORTQXGF *QPQNWNW*+75# CPF0QXGN#KTETCHV'PIKPG%QORQPGPVUHQT#FFKVKXG ■ (&CPPGT%-GPFCNN6QTT[*2-CW 6CKNQTKPI /CPWHCEVWTKPI5QNKF(TGGHQTO(CDTKECVKQP5[ORQ 4QVQT4QVQT+PVGTCEVKQPU7UKPI$NCFG4QY5RCEKPI UKWO#WUVKP6:#WIWUV HQT'HHGEVUQH&GUVTWEVKXG#EQWUVKE+PVGTHGTGPEGVJ ■ %)WKPGV8$GVVTKEJ8)ØOOGT 2CTCOGVTKE +PVGTPCVKQPCN5[ORQUKWOQP6TCPURQTV2JGPQOGPC 5VWF[QHVJG$NGGF2QUKVKQPKPC6KR$NQYKPI%CUKPI CPF&[PCOKEUQH4QVCVKPI/CEJKPGT[+541/#% 6TGCVOGPVVJ#+###5/'5#'#5'',QKPV (GDTWCT[*QPQNWNW*+75# 2TQRWNUKQP%QPHGTGPEG#+## ■ .CPI5'TJCTF9-CWGVCN #RRNKECVKQPQH ■ 5'KUGPOCPP//CKT#*WRHGT 5VTWEVWTCN (NQY%QPVTQNQPC4CFKCN%QORTGUUQTHQT1RGTCVKPI #PCN[UKUQHC)CU6WTDKPG&KUM%QPVCKPKPI*GCV 4CPIG'ZVGPUKQPVJ+PVGTPCVKQPCN5[ORQUKWOQP 2KRGU7UKPI(KPKVG'NGOGPV#PCN[UKUVJ#+## 6TCPURQTV2JGPQOGPCCPF&[PCOKEUQH4QVCVKPI #5/'5#'#5'',QKPV2TQRWNUKQP%QPHGTGPEG /CEJKPGT[+541/#%(GDTWCT[ #+## *QPQNWNW*+75# 88 Institute of Flight Propulsion ■ #.QQU*2-CW 0WOGTKECN+PXGUVKICVKQPUQH*WD ■ ,#5VTGKV(*GKPKEJGP*2-CW #ZKCN5NQV 6TGCVOGPVUHQT%CPVKNGXGT5VCVQTUVJ+PVGTPC %CUKPI6TGCVOGPVU+ORTQXGVJG'HƄEKGPE[QH#ZKCN VKQPCN5[ORQUKWOQP6TCPURQTV2JGPQOGPCCPF (NQY%QORTGUUQTU #GTQF[PCOKE'HHGEVUQHC4QVQT &[PCOKEUQH4QVCVKPI/CEJKPGT[+541/#% 4GFGUKIP)6#5/'6WTDQ'ZRQ (GDTWCT[*QPQNWNW*+75# 5CP#PVQPKQ6GZCU75#,WPG ■ &4QEMGN#*WRHGT*2-CW &GUKIP5VWF[QPCP ■ 6/C[GPDGTIGT)$TKIPQNG*2-CW #GTQF[ #FFKVKXGN[/CPWHCEVWTGF%QORTGUUQT%CUKPIEQP PCOKE&GUKIPQH#DTCFCDNG.KPGTUYKVJ+PVGITCVGF VCKPKPI#WZGVKE5VTWEVWTGU5QEKGV[QH/CPWHCEVWTKPI 'PFYCNN6TGCVOGPVUHQT#ZKCN%QORTGUUQT4QVQTU 'PIKPGGTU 5/' 4#2+&2KVVUDWTIJ75# )6#5/'6WTDQ'ZRQ5CP #PVQPKQ6GZCU75#,WPG ■ &4QEMGN#*WRHGT*2-CW #P'XCNWCVKQPQHVJG ■ #.QQU6/C[GPDGTIGT(&CPPGT*2-CW 2QVGPVKCNQH#FFKVKXG/CPWHCEVWTKPI6GEJPQNQIKGUKP 'XQNWVKQPQH)GPGTKE8CPGNGVU#RRNKGFVQC*KIJ (WVWTG#GTQ'PIKPG&GUKIPVJ#+###5/'5#' 2TGUUWTG%QORTGUUQT)6#5/'6WTDQ #5'',QKPV2TQRWNUKQP%QPHGTGPEG'ZJKDKV5CP 'ZRQ5CP#PVQPKQ6GZCU75#,WPG ,QUG75# ■ ,#5VTGKV%$TCPFUVGVVGT(*GKPKEJGP*2 ■ (&CPPGT%-GPFCNN6QTT[*2-CW #GTQF[PCOKE -CW #PCFXCPEGFCZKCNUNQVECUKPIVTGCVOGPVQPC 1TKIKPQH4QVQT4QVQT+PVGTCEVKQP0QKUGHTQO7PFWE VTCPUQPKEEQORTGUUQT #ENQUGNQQMYKVJEQORWVC VGF2TQRWNUQTU)6#5/'6WTDQ'ZRQ VKQPCNƅWKFF[PCOKEUCPFGZRGTKOGPVCNXCNKFCVKQP 5CP#PVQPKQ6GZCU75#,WPG 2TQEGGFKPIUQHVJG+PUVKVWVKQPQH/GEJCPKECN ■ &2CWMPGT/)WTVPGT*2-CW 2TGNKOKPCT[ 'PIKPGGTU2CTV# ,QWTPCNQH2QYGTCPF'PGTI[ KPXGUVKICVKQPQHKIPKVKQPCPFƅCOGUVCDKNK\CVKQPWUKPI 5GRVGODGT ECVCN[VKEVTGCVOGPVQHRTQRGNNCPVUHQTUETCOLGVU ■ &4QEMGN#*WRHGT*2-CW #FFKVKXG/CPW 'WTQRGCP%QPHGTGPEGHQT#GTQ5RCEG5EKGPEGU HCEVWTKPI6GEJPQNQIKGU #P1RVKQPKP(WVWTG#GTQ '7%#55 /WPKEJ,WN[ 'PIKPG%QORTGUUQT&GUKIP6TCPURQTVCVKQP4CRKF ■ &*KTPFQTH/'-ØINGT,*GKFGPHGNFGT# #FFKVKXG/CPWHCEVWTKPI5WOOKV 64#/5 *WRHGT 0WOGTKECN+PXGUVKICVKQPQH2GTHQTOCPEG 5JCPIJCK%JKPCVJ+PVGTPCVKQPCN 2CTCOGVGTUQH8GT[5OCNN,GV'PIKPG%QODWUVQTU 5[ORQUKWOQP5RCEG6GEJPQNQI[CPF5EKGPEG VJ+PVGTPCVKQPCN5[ORQUKWOQP6TCPURQTV 0CIQ[C#KEJK,CRCP,WPG 2JGPQOGPC +562 ;COCIWEJK,200QXGODGT ■ 59GKJCTF#*WRHGT,9KVVOGT*2-CW 7PVGT UWEJWPIGPFGT'Z\GPVTK\KVÀVXQP)GJÀWUGTKPIGP ■ -/CMQYMC65CVVGNOC[GT/)WTVPGT&2CWMPGT KPHQNIGUVCVKUVKUEJXGTVGKNVGT(GTVKIWPIUCDYGKEJWP *2-CW 0WOGTKECNCPF'ZRGTKOGPVCN+PXGUVKICVKQP IGP,CJTGUVCIWPIFGT&GWVUEJGP)GUGNNUEJCHVHØT QHC%GPVTCN5VTWV+PLGEVQTYKVJ2GTRGPFKEWNCT .WHV4CWOHCJTV5VWVVICTV5GRVGODGT +PLGEVKQPHQT5ETCOLGV#RRNKECVKQPU'WTQRGCP ■ 59GKJCTF#*WRHGT,9KVVOGT*2-CW 4GFWE %QPHGTGPEGHQT#GTQ5RCEG5EKGPEGU '7%#55 VKQPQH4QVQT'EEGPVTKEKV[7UKPI+ORTQXGF#UUGODN[ /ØPEJGP,WN[ 2TQEGUUGU+5#$'UV+5#$' ■ &*KTPFQTH#*WRHGT9'TJCTFCPF*2-CW %QPHGTGPEG+PVGTPCVKQPCN5QEKGV[HQT#KTDTGCVJKPI 8GT[5OCNN)CU6WTDKPG,GV'PIKPGUs%WTTGPV 'PIKPGU$WUCP5QWVJ-QTGC5GRVGODGT .KOKVUCPF2QVGPVKCNHQT+ORTQXGOGPV'WTQRGCP %QPHGTGPEGHQT#GTQ5RCEG5EKGPEGU '7%#55 ■ ,*ÒPNG/-GTNGT*0CEJVKICNN9'TJCTF*2 /WPKEJ,WN[ -CW 'ZRGTKOGPVCN8CNKFCVKQPQHC5WD+FNG%QO ■ /-GTNGT,*ÒPNG9'TJCTF*2-CW *GNKEQRVGT RTGUUQT/CR'ZVTCRQNCVKQP+5#$' 'PIKPGKPVJG.QQR6GUV5GVWRVJ'WTQRGCP UV+5#$'%QPHGTGPEG+PVGTPCVKQPCN5QEKGV[HQT 4QVQTETCHV(QTWO/QUEQY4WUUKC5GRVGODGT #KTDTGCVJKPI'PIKPGU$WUCP5QWVJ-QTGC 5GRVGODGT ■ ,#5VTGKV.8GIIK',QJCPP*2-CW #%(& ■ (&CPPGT%-GPFCNN6QTT[*2-CW 1PVJG +PXGUVKICVKQPQH6KR%NGCTCPEG'HHGEVUQPC6TCPUQ %CRCDKNKV[QH7PUVGCF[4#05%QORWVCVKQPUVQ PKE%QORTGUUQT4QVQTYKVJCP#FXCPEGF#ZKCN5NQV 4GRTQFWEG0QP&GVGTOKPKUVKE2TGUUWTG&KUVWT %CUKPI6TGCVOGPV+PVGTPCVKQPCN5[ORQUKWOQP DCPEGUHQT0QKUG2TGFKEVKQPU+5#$' 'ZRGTKOGPVCNCPF%QORWVCVKQPCN#GTQVJGTOQF[PC UV+5#$'%QPHGTGPEG+PVGTPCVKQPCN5QEKGV[HQT OKEUQH+PVGTPCN(NQYU+5#+(5JGP\JGP%JKPC #KTDTGCVJKPI'PIKPGU$WUCP5QWVJ-QTGC 5GRVGODGT ■ %$TCPFUVGVVGT,#5VTGKV(9CTV\GM(*GKPK ■ &4QEMGN59GKJCTF#*CEJOCPP#*WRHGT EJGP*25EJKHHGT #P#FXCPEGF#ZKCN5NQV%CUKPI *2-CW 0WOGTKECN+PXGUVKICVKQPQHCP#FFKVKXGN[ 6TGCVOGPVQPC6KR%TKVKECN6TCPUQPKE%QORTGUUQT /CPWHCEVWTGF%QORTGUUQT%CUKPI 6JG'HHGEVQH 4QVQTs2CTV 7PUVGCF[9CNN2TGUUWTGCPF*QV #WZGVKE5VTWEVWTGUQPVJG6KR%NGCTCPEGU)6 9KTG/GCUWTGOGPVU'WTQRGCP6WTDQOCEJKPGT[ #5/'6WTDQ'ZRQ5CP#PVQPKQ %QPHGTGPEG'6%.CRRGGPTCPVC(KPPNCPF 6GZCU75#,WPG ■ ,#5VTGKV%$TCPFUVGVVGT(*GKPKEJGP*2 ■ 59GKJCTF#*WRHGT*2-CW 5VCVKUVKECN -CW #P#FXCPEGF#ZKCN5NQV%CUKPI6TGCVOGPVQP +ORCEVQH/CPWHCEVWTKPI6QNGTCPEGUQP#ZKCN)CRU C6KR%TKVKECN6TCPUQPKE%QORTGUUQT4QVQTs2CTV $GVYGGP8CPG5GIOGPVUCPFVJG4QVQTQH#ZKCN 6CMKPIC%NQUGT.QQMYKVJ%(&'WTQRGCP (NQY6WTDQ%QORTGUUQTU)6#5/' 6WTDQOCEJKPGT[%QPHGTGPEG'6%.CRRGGPTCPVC 6WTDQ'ZRQ5CP#PVQPKQ6GZCU75# (KPPNCPF ,WPG Institute of Flight Propulsion 89 Space Propulsion Group Liquid propellant rocket engine technologies ■ The Space Propulsion Group, established in October 2011, has put its emphasis from the beginning on experimental activities around different aspects of injection, igni- tion, combustion, heat transfer and cooling in oxygen/kerosene, oxy- gen/methane model combustors operating at various propellant temperature, combustion chamber Prof. Dr.-Ing. pressure and operational boundary Oskar J. Haidn conditions. Since last year, these experimental activities are accom- Contact panied by a second working group www.lfa.mw.tum.de which has its main focus on model- [email protected] ling and simulation in all areas of Phone +49.89.289.16138 liquid propellant rocket engines Vulcain 2 engine during testing at P5 facilty in Lampoldshausen. Photo: DLR technologies. The Liquid Propulsion Technical Com- entitled, ‘Investigation of the API-Injection mittee of the American Institute of Concept in a LOX/LH2 Combustion Aeronautics and Astronautics bestowed Chamber at GG/PB Operation Condi- their best paper award 2013 to Prof. Haidn tions’. and his coworkers for the technical paper Rocket Propulsion The main focus of the space propulsion group lays currently on experimental and numerical studies on injector/injector and injector/wall interaction on combustion performance and heat loads to the combustor liner in model rocket engines operating with methane and oxygen within 10 kN GOX/kerosene model the DFG funded SFB TRR 40. combustor in operation. Photo: Institute of Space Propulsion Technologies for Green In-Space Propulsion Within a project funded by Munich Aerospace, the Chinese CSC and the Brazilian CSF on environmentally benign propellants for space-craft propulsion, VJGITQWRKPXGUVKICVGUƅCUJKPIQHET[Q- IGPKEƅWKFUWPFGTXCEWWOEQPFKVKQPU resonance ignition and injectors for thrust *KIJURGGFƅQYXKUWCNK\CVKQP variation. picture of a cryogenic jet at PGCTƅCUJKPIEQPFKVKQPU2JQVQ Institute of Space Propulsion 90 Space Propulsion Group Turbo-Pump Technologies With a new project on experimental and numerical investigation of critical areas of a LOX turbopump, turbo-pump technolo- gies of liquid propellant rocket engines will DGCFFGFVQVJGƄGNFQHCEVKXKVKGUQHVJG Space Propulsion Group. LOX-Turbopump of Vulcain 2 engine. Photo: ESA Research Focus Management Prof. Haidn’s research focuses on rocket Prof. Dr.-Ing. Oskar J. Haidn propulsion with the main emphasis on technologies for liquid propellant rocket Adjunct Professors engines: propellant injection, ignition, Dr.-Ing. Gerald Hagemann, combustion stability, heat transfer, Airbus Defence & Space EQQNKPICPFNKHGE[ENGCPCN[UKUPQ\\NGƅQY Dr.-Ing. Oliver Knab, phenomena, turbopump seals, bearings Airbus Defence & Space CPFNKƄPICPFGPXKTQPOGPVCNN[DGPKIP propellants and in particular on dynamic Administrative Staff processes. Angelika Heininger Competence Research Scientists The publications of the Space Propulsion Dipl-Ing. Christian Bauer Group clearly demonstrate the compe- Maria Palma Celano, M.Sc. VGPEGQHVJGITQWRKPVJGƄGNFQHTQEMGV Chiara Boffa, M.Sc. engine technology. Dipl.-Ing. Christoph Kirchberger Meng Luo, M.Sc. Infrastructure Fernanda Maia, M.Sc. ■ CH4/O2/kerosene test facility Dipl.-Ing. Yuriy Metsker (~ 100 bar, ~ 1.5 kg/s) Dipl.-Ing. Christof Roth ■ Multi-propellant test facility Dipl.-Ing. Gregor Schlieben (~ 20 bar, 0.5 kg/s) Simona Silvestri, M.Sc. ■ Scramjet facility Brunno Vasques, M.Sc. Hong Ye, M.Sc. Courses Kendong Yu, M.Sc. ■ Raumfahrtantriebe 1 (Grundlagen) Dipl.-Ing. Julian Zips ■ ZÜ Raumfahrtantriebe 1 ■ Selected Topics on Launcher Propulsion ■ Heat Transfer (MSE) ■ ZÜ Heat Transfer (MSE) Space Propulsion Group 91 Publications 2013-14 Journals Conference Papers ■ Abu-Farah, L. Haidn, O.J., Kau, H.-P., Numerical ■ Schlieben, G., Kirchberger, C., Haidn, O.J., simulations of single and multi-staged injection Höglauer, C., Kniesner, B., Knab, O., ‘Experimental of H2 in a supersonic scramjet combustor, and Numerical Film Cooling Investigations in a DOI:10.1016/j.jppr.2014.12.001, Propulsion and GOX/Kerosene Rocket Combustion Chamber’, Power Research, Vol.3, Issue 4, 2014 AIAA-2014-4008, Cleveland, USA, 2014 ■ Verma, S.B., Haidn O.J., ‘Unsteady Shock Motions ■ Makowka, K., Gurtner, M., Paukner, D., Sattelmayer, in an Over-Expanded Parabolic Rocket Nozzle’, T., Haidn, O.J., ‘Semi-Zonal Hybrid RANS/LES Aerospace Science and Technology, Vol. 39, pp. Turbulence Modeling with RANS Sensor Based 48-71, 2014 Interfacing Applied to Supersonic Flows’, AIAA- ■ Verma, S.B., Stark, R., Haidn, O.J., ‘Effect of Ambi- 2014-3087, Atlanta, USA, 2014 ent Pressure Fluctuations on Dual-Bell Transition ■ Paukner, D., Gurtner, M., Haidn, O.J., ‘Pre-Injection Behavior’, Journal of Propulsion and Power, Vol. Radical Production using Catalytic Fuel Treatment 30 (no.5), pp. 1192-1198, DOI: 10.2514/1.B35067, for Scramjet Applications’, AIAA-2014-3218, 2014 Atlanta, USA, 2014 ■ Verma, S.B., Stark, R., Haidn, O.J., Reynolds Num- ■ Silvestri, S., Celano, M.P., Schlieben, G., Kirch- DGT+PƅWGPEGQP&WCN$GNN6TCPUKVKQP2JGPQOGPC berger, C., Haidn, O.J., Characterization of a DOI:10.2514/1.B34734, Journal of Propulsion and GOX-GCH4 Single Element Combustion Chamber, Power, Vol. 29, No. 3, pp. 602-609, 2013 Space Propulsion 2014, 19-22 May 2014, Cologne, Germany ■ Celano, M.P., Silvestri, S., Schlieben, G., Kirch- berger, C., Haidn, O.J., Menon, S., Numerical Chapters in Books and experimental investigation for a GOX-GCH4 ■ Bonnal, C., Ciucci, A., Obersteiner, M.H., Haidn, shear-coaxial injector element, Space Propulsion O.J., ‘Launch Systems’, in ‘The International Hand- 2014, 19-22 May 2014, Cologne, Germany book of Space Technology’, edited by Malcolm ■ Höglauer, C., Kniesner, B., Knab, O., Schlieben, G., Macdonald and Viorel Badescu, Springer Verlag, *CKFP1,8CNKFCVKQPQHEQQNKPIƄNOOQFGNNKPIKP DOI 10.1007/978-3-642-41101-4, pp. 191-221, rocket combustion chambers, Space Propulsion 2014 2014, 19-22 May 2014, Cologne, Germany ■ Génin, C., Stark, R., Haidn, O.J., Quering, K., Frey, ■ Kirchberger, C., Schlieben, G., Haidn, O.J., M., ‘Experimental and Numerical Study of Dual Bell ‘Assessment of Film Cooling Characteristics in a Nozzle Flow’, in EUCASS Advances in Aerospace GOX/ Kerosene Rocket Combustion Chamber’, Sciences, Progress in Propulsion Physics Vol. 5, AIAA-2013-4144, San Jose, CA, USA, 15-17 July edited by Ph. Rejasse, D. Knight, M. Ivanov, I. 2013 Lipatov, ISBN 978-2-7598-0877-9, EDP Sciences, ■ Celano, M.P., Silvestri, S., Schlieben, G., Kirchber- Les Ulis, Torus Press, Moscow, 2013 ger, C., Haidn, O.J., ‘Injector Characterization for a ■ Deeken, J., Suslov, D., Haidn, O.J., Schlechtriem, GOX-GCH4 Single Element Combustion Chamber’, S., ‘Impact of Injection Distribution on Cryogenic 5th EUCASS Symposium, Munich, Germany, 1-5 Rocket Engine Stability’, in EUCASS Advances July 2013 in Aerospace Sciences, Progress in Propulsion ■ Kirchberger, C., Schlieben, G., Haidn, O.J., Physics Vol. 4, edited by Luigi T. DeLuca, Chris- n'ZRGTKOGPVCNKPXGUVKICVKQPUQPNKSWKFƄNOEQQNKPIKP tophe Bonnal, Oskar Haidn, Sergey M. Frolov, ISBN a GOX/kerosene rocket combustion chamber’, 5th 978-2-7598-0876-2, EDP Sciences Les Ulis, Torus EUCASS Symposium, Munich, Germany, 1-5 July Press, Moscow, pp. 149-165, 2013 2013 ■ Slavinskaya, N.A., Wiegand, M.A., Starcke, J.H., ■ Höglauer, C., Kniesner, B., Knab, O., Schlieben, G., Riedel, U., Haidn, O.J., ‘Kinetic Mechanism Haidn, O.J., ‘Simulation of liquid, trans-critical and for Low-Pressure Methane/Air Combustion’, in ICUGQWUEQQNKPIƄNOUoVJ'7%#555[ORQUKWO EUCASS Advances in Aerospace Sciences, Pro- Munich, Germany, 1-5 July 2013 gress in Propulsion Physics Vol. 4, edited by Luigi ■ Bauer, C., Schlieben, G., Eiringhaus, D., Haidn, T. DeLuca, Christophe Bonnal, Oskar Haidn, Sergey O.J., ‘Design and Commission of a mobile GOX/ M. Frolov, ISBN 978-2-7598-0876-2, EDP Sciences CH4 rocket combustion test bed for education Les Ulis, Torus Press, Moscow, pp. 701-749, 2013 and collegiate research’, 29th ISTS, Nagoya-Aichi, Japan, 2-9 June 2013 ■ Kirchberger, C., Schlieben, G., Haidn, O.J., ‘Investigation on Film Cooling in a GOX/Kerosene Rocket Combustion Chamber’, 29th International Symposium on Space Technology and Science, Nagoya-Aichi, Japan, 2-9 June 2013 92 Space Propulsion Group Invited Presentations Conferences ■ Current Trends in Liquid Propulsion Research in ■ Haidn, O.J., ‘Research Trends in Liquid Space Pro- Europe, Konkuk University, Seoul, Korea March pulsion’, Development Trends in Space Propulsion 2014 ■ Systems, Warsaw, October 18-19, 2013 Europe’s Access to Space: Past, Present and ■ Haidn, O.J., ‘Europe’s Access to Space: Past, Pre- Future, Xi’an Aerospace Propulsion Institute, Xi’an, sent & Future’, Workshop on Numerical Modelling of March 2014 ■ Rockets and Satellites, Tokyo, September 20, 2013 Concept and Operation of the Collaborative ■ Haidn, O.J., ‘Russian Rocketry Heritage’, Propul- Research Center TRR 40 on Fundamental Technolo- sion for Space Exploration, Milan, June 28-29, 2013 gies of Liquid Rocket Propulsion, Northwestern Polytechnical University, Xi’an, March, 2014 ■ Europe’s Access to Space: Past, Present and Future, Beijing Institute of Technology, Beijing, Other Invited Lectures March 2014 ■ Fundamentals of Solid Propulsion Technologies, ■ Current Trends in Liquid Propulsion Research in DLR Lampoldshausen, April 2014 Europe, Beijing Aerospace Propulsion Institute, ■ Russian Heritage in Liquid Propellant Rocket Engine Beijing, March 2014 Technologies, DLR, Lampoldshausen, April 2014 ■ Research Needs in Liquid Propellant Engines, ■ Research Needs in Liquid Propellant Engines, INPE, University of Tokyo, Tokyo, September 2013 Sao Jose dos Campos, March 2014 ■ European Space Transportation: Lessons Learnt, ■ Current Trends in Liquid Propulsion Research in JAXA, Tokyo, September 2013 Europe, Universidade Federal do Norte, Natal, March 2014 ■ Europe’s Access to Space: Past, Present and Future, Korean Aerospace Institute, Daejon, March 2014 Space Propulsion Group 93 Institute for Helicopter Technology 2GTHQTOCPEGGHƄEKGPE[CPFUCHGV[HQTTQVQTETCHV ■ The Institute of Helicopter Technology centered its activities in 2013-14 QPXCTKQWUCURGEVUQHTQVQTETCHVGPIKPGGTKPI*KIJNGXGNUQHƅKIJVUCHGV[CV achievable cost and competitive performance are a permanent motivation HQTNGCFKPIGFIGTGUGCTEJ6JGTQVQTYKVJKVUƅGZKDNGDNCFGUFGOCPFUHQT simulation models in rotor aeromechanics – characterized by a strong EQWRNKPIQHGNCUVKEDNCFGOQVKQPCPFPQPUVCVKQPCT[ƅQYRJGPQOGPC Modelling of dynamic blade stall or discontinuous structural properties are among the key areas of to-date rotor analysis. Often enough, technical RTQDNGOUCUMHQTKPVGTFKUEKRNKPCT[TGUGCTEJKPQTFGTVQGZRNQTGUQNWVKQPU as it is the case for engine integration. Prof. Dr.-Ing. /CPHTGF*CLGM 'CTN[VJGTGUGCTEJUKOWNCVQTCVVJG DWVUVKNNUQOGCNVKVWFGNQUUYQWNFQEEWT +PUVKVWVGYCUEQWRNGFYKVJVJGGPIKPGVGUV 6JGTGHQTGGPIKPGVGUVDGFCPFUKOWNCVQT Contact DGFHTQOVJG+PUVKVWVGQH(NKIJV2TQRWNUKQP YGTGEQWRNGF n*CTFYCTGKPVJGNQQRo HQTCWPKSWGUKOWNCVKQPECORCKIP# CPFVGUVECORCKIPYGTGƅQYPD[CHQTOGT YYYJVOYVWOFG QHƄEG"JVOYVWOFG JGNKEQRVGTVWTDKPGGPIKPGYKVJCOQFKƄGF helicopter test pilot. 2JQPG EQORTGUUQTUGEVKQPYCUCDNGVQTWPWR 6JKUHCKNWTGECUGFGOQPUVTCVKQPsCWPKSWG YKVJKPKPUVGCFQHRTGXKQWUN[UGE6JKU GXGPVYKVJKPVJGTQVQTETCHVEQOOWPKV[ YQWNFCNNQYVQUJWVFQYPQPGGPIKPG sYCURTGUGPVGFCVVJG'WTQRGCP FWTKPIETWKUGƅKIJVCPFUCXGWRVQQH 4QVQTETCHV(QTWOKP5QWVJCORVQP 7- HWGN+PECUGQHCPGPIKPGHCKNWTGVJKUSWKEM CPFVJG'#5#4QVQTETCHV5[ORQUKWOKP UVCTVYQWNFJGNRVQCXQKFETKVKECNUKVWCVKQPU Cologne. #GTQOGEJCPKECN/QFGNNKPIQH*GNKEQRVGT4QVQTU Helicopter rotors have to be compromise UQNWVKQPU6JGƅQYUKVWCVKQPXCTKGUHTQO PGCTN[UVCVKQPCT[FWTKPIJQXGTƅKIJVVQ JKIJN[PQPNKPGCTKPHCUVHQTYCTFƅKIJV Blades can be under extreme bending (on ground!) or tension loads (high rpm). The QRVKOCNFGUKIPJCUVQUCVKUH[RGTHQTOCPEG TGSWKTGOGPVUKVUJQWNFJCXGUWHƄEKGPVUVCVKE CPFF[PCOKEUVCDKNKV[CPFKVUGORV[YGKIJV contribution should be minimal. Adequate OQFGNNKPIQHVJGTQVQTDGJCXKQTKUPGEGUUCT[ including several highly unsteady and PQPNKPGCTRJGPQOGPCYJKEJPGGFVQDG EQPUKFGTGFHQTFGUKIPQRVKOK\CVKQP GPCKUUVKNNCEJCNNGPIKPIVCUMGXGPYKVJ &WTKPIHCUVHQTYCTFƅKIJVQTCVOCPGWXGTU today’s computational capabilities. YKVJCJKIJNQCFHCEVQTF[PCOKEUVCNNQEEWTU #FXCPEGFPWOGTKECNOGVJQFUHQTVJG at the rotor blades, resulting in a tremen- UKOWNCVKQPQHKPVGTCEVKQPCNCGTQF[PCOKEU FQWUKPETGCUGQHNQCFUCPFXKDTCVKQPU are developed and evaluated, aiming at 0WOGTKECNOQFGNNKPIQHVJKUF[PCOKEƅQY VJGOKVKICVKQPQHWPEGTVCKPVKGUFWTKPIVJG separation is computationally expensive helicopter development process. CPFVJGTGHQTGTGFWEGFQTFGTOGVJQFUCTG FGXGNQRGFVQCNNQYEQPUKFGTCVKQPFWTKPI 2TQLGEVU early design phase. ■ $/9K .W(Q RTQLGEVnTQVQTHWUGNCIG %NQUGXKEKPKV[QHTQVQTUHWUGNCIGGORGP- KPVGTHGTGPEGOQFGNUo PCIGGVENGCFUVQCUGTKGUQHKPVGTCEVKQP ■ BMWi (LuFo) project ‘dynamic stall GHHGEVU6JGRTGFKEVKQPQHVJGUGRJGPQO OQFGNUHQT$'/KORNGOGPVCVKQPUo 94 Institute for Helicopter Technology %GTVKƄCDKNKV[QH'NGEVTQ/GEJCPKECN#EVWCVQTU in Primary Flight Controls 6JGTGEGPVVTGPFVQYCTFUVJGGNGEVTKƄEC- VKQPQHOQFGTPCKTETCHVCPFJGNKEQRVGTUNGF VQVJGFGXGNQROGPVQHGNGEVTQOGEJCPKECN CEVWCVQTU '/# '/#UUJCNNTGRNCEGUVCVG QHVJGCTVJ[FTCWNKECEVWCVQTUKPRTKOCT[ CPFUGEQPFCT[ƅKIJVEQPVTQNUTGUWNVKPIKPC NQYGTVQVCNYGKIJVQHVJGCKTETCHVCPFNQYGT EQUVHQTOCKPVGPCPEG2CTVKEWNCTN[UCHGV[ ETKVKECNCRRNKECVKQPUNKMGVJGCEVWCVKQPQH VJGUYCUJRNCVGQHCJGNKEQRVGTRQUGC EJCNNGPIGKPVGTOUQHEGTVKƄCDKNKV[(WTVJGT- OQTGEQPEGRVUHQTOQPKVQTKPIVJGJGCNVJ OQFWNCTEGTVKƄECVKQP CTGDGKPITGUGCTEJ CPFVJGCEVWCNWUCIGQHCP'/#VJG GFD[QWTKPUVKVWVGYKVJKPVJGUEQRGQHVJKU WUCIGQHXKTVWCNVGUVKPIHQTVJGSWCNKƄECVKQP project. QHVJG'/#CUYGNNCUVJGFGXGNQROGPVQH CRTQEGUUVQDGCDNGVQEGTVKH[QPN[RCTVU 2TQLGEVU QHVJGCKTETCHVKPUVGCFQHVJGGPVKTGCKTETCHV ■ '7RTQLGEVCEVWCVKQP (2 2KNQV#UUKUVCPEGHQT&GITCFGF8KUWCN'PXKTQPOGPV Despite today’s achievements in active developed to reduce visual clutter and to CPFRCUUKXGUCHGV[OGCUWTGUJGNKEQRVGT GPCDNGURCVKCNUKVWCVKQPCYCTGPGUU6JWU ƅKIJVUVKNNTGSWKTGUTGUGCTEJGHHQTVUGI NCPFKPI\QPGU[ODQNUVQIGVJGTYKVJVGTTCKP HQTƅKIJVKPFGITCFGFXKUWCNGPXKTQPOGPVU CPFQDUVCENGKPHQTOCVKQPECPDGFKURNC[GF &8' HQTEQNNKUKQPCXQKFCPEG 6QQXGTEQOGVJGEJCNNGPIGQHGZVGPFKPI (WTVJGTOQTGn$TQYPQWVoQTn9JKVGQWVo VJGƅKIJVGPXGNQRGVQUWEJFGITCFGF situations, describing the entrainment XKUWCNEQPFKVKQPUEWTTGPVTGUGCTEJHQEWUGU QHFGPUGENQWFUQHUCPFQTUPQYD[VJG QPJGCFOQWPVGFFKURNC[UYKVJ& TQVQTETCHVoUFQYPYCUJOC[FGITCFGVJG EQPHQTOCN UEGPGNKPMGF XKUWCNEWGUHQT pilot’s vision and complicate his assess- pilot assistance. OGPVQHVJGTQVQTETCHVoURQUKVKQPCPFQTKGP- n2KNQVKPVJGNQQRo5KOWNCVKQPUCTGTGSWKTGF VCVKQP6JWUTGCNVKOGECRCDNGFQYPYCUJ VQKPETGCUGVJGOCVWTKV[QHVJKUVGEJPQ- simulation models are developed in order NQI[0GYCRRTQCEJGUCPFEQPEGRVUQH VQKPETGCUGUKOWNCVKQPƄFGNKV[ FKURNC[KPI&EQPHQTOCNKPHQTOCVKQPCTG Institute for Helicopter Technology 95 4GUGCTEJ(QEWU Management ■ Nonlinear rotor modelling 2TQH&T+PI/CPHTGF*CLGM&KTGEVQT ■ Dynamic stall ■ 2KNQVCUUKUVCPEG #FLWPEV2TQHGUUQTU ■ (NKIJVUCHGV[ *QP2TQH&T+PI7NTKEJ$WVVGT Competence #FOKPKUVTCVKXG5VCHH ■ 4QVQTƅQYƄGNF Martina Thieme ■ %QWRNGFTQVQTHWUGNCIGUKOWNCVKQP ■ Flight simulation 4GUGCTEJ5EKGPVKUVU ■ HIL simulation &T,ØTIGP4CWNGFGT UKPEG0QX &KRN+PI2JKNKRR#PFGTUEJ Infrastructure Dipl.-Ing. Aaron Barth ■ 4GUGCTEJUKOWNCVQTYKVJKOCIG Dipl.-Ing. Roland Feil EJCPPGNU JQTK\ XGTV &KRN+PI.WFYKI(TKGFOCPP terrain and image data bases, head &KRN+PI5VGRJCPKG/CPPGT tracking system Dipl.-Ing. Oliver Oberinger, Ingénieur ■ 6GUVTKIHQTDNCFGTQQVUVTWEVWTGU NGCF 572#'41 NCICPFƅCR &KRN+PI5KOQP4CFNGT ■ Optical strain measurement system &KRN+PI&QOKPKM5EJKEMGT (Fibre Bragg-gratings) &KRN+PI%JTKUVKCP5RKG» &KRN+PI5ÒTGP5Ø»G Lectures in: &KRN+PI(TCP\8KGTVNGT ■ +PVTQFWEVKQPVQ#GTQPCWVKEU 4QVQTETCHV &QOKPKM9KTVJ/5E ■ 4QVQTETCHV(NKIJV2J[UKEU+++ 5VGRJCP2NCV\GT/5E UKPEG1EV ■ *GNKEQRVGT&GUKIP+++ ■ *GNKEQRVGT5[UVGOU ■ (NKIJV5CHGV[CPF%GTVKƄECVKQP ■ Helicopter Flight Dynamics and Control ■ +PUVTWOGPV(NKIJVHQT*GNKEQRVGTU 2WDNKECVKQPU ■ 5RKG»%-GTNGT/*CLGM/ 'HHGEVUQP ■ (TKGFOCPP.1JOGT2*CLGM/ *GNKEQRVGT&[PCOKEUKP%CUGQH'PIKPG(CKNWTG 4GCN6KOG5KOWNCVKQPQH4QVQTETCHV&QYPYCUJKP &WTKPI+PVGPFGF5KPING'PIKPG1RGTCVKQPVJ 2TQZKOKV[QH%QORNGZ1DUVCENGUWUKPI)TKF$CUGF 'WTQRGCP4QVQTETCHV(QTWO #RRTQCEJGU#PPWCN(QTWO2TQEGGFKPIUs#*5 ■ $CTVJ#(GKN4-QPFCM-*CLGM/ International. %QPEGRVWCN5VWF[HQTCP#WVQPQOQWU4QVQTETCHVHQT ■ #OTK*(GKN4*CLGM/9GKICPF/ 'ZVTGOG#NVKVWFGUVJ'WTQRGCP4QVQTETCHV(QTWO ¸DGTUGV\WPIUXCTKCDNG)GVTKGDGHØT&TGJƅØINGT ■ 5EJKEMGT&*CLGM/ +PƅWGPEGQH2GTKQFK- |&GWVUEJGT.WHVWPF4CWOHCJTVMQPITGUU cally Varying Incident Velocity on the Application ■ 1DGTKPIGT1*CLGM/ #PCN[UKUQHEQORNGZ QH5GOK'ORKTKECN&[PCOKE5VCNN/QFGNU56#$ TQVQTCKTHTCOGEQWRNGFKPUVCDKNKVKGUD[GPGTI[ƅQY 5[ORQUKWO EQPUKFGTCVKQPU#PPWCN(QTWO2TQEGGFKPIUs#*5 ■ *CLGM//KPFV/ ;GCTU#HVGT6JG International. $Q(KTUV(NKIJVs9QWNF9G&Q$GVVGT0QY! #PPWCN(QTWO2TQEGGFKPIUs#*5+PVGTPCVKQPCN 96 Institute for Helicopter Technology Institute of Flight System Dynamics /CMKPIKPPQXCVKQPUƅ[KPEGTVKƄGFRTQFWEVUQHUOCNNCPFOGFKWOUK\GFCGTQURCEGEQORCPKGU ■ As part of Technische Universität München’s department of mechanical engineering, we are devoted to analyzing and modifying the dynamic characteristics of aerial platforms. Our passionate team is committed to OCVWTGEWVVKPIGFIGVGEJPQNQIKGUVJCVCTGTGSWKTGFVQKPEGRVVJGƅKIJV system behavior of tomorrow. &WTKPIVJGNCUV[GCTUYGJCXGCESWKTGFCNN WPOCPPGFCKTETCHV9GJCXGGUVCDNKUJGF VJGGZRGTKGPEGYJKEJKUPGGFGFCNQPIVJG KORQTVCPVRCTVPGTUJKRUCPFU[PGTIKGU YJQNGRTQEGUUQHOCMKPIEQPVTQNKFGCU YKVJVQRTGUGCTEJKPUVKVWVKQPUCPFNGCFKPI ƅ[6JKUKPENWFGUOQFGNKPICPFU[UVGO KPFWUVTKCNRNC[GTUKPVJGƄGNFQHCGTQURCEG KFGPVKƄECVKQPEQPVTQNNGTFGUKIPCPF 1WTWNVKOCVGIQCNKUVJGFGXGNQROGPVCPF KORNGOGPVCVKQPKPTGCNCKTETCHV VJGCRRNKECVKQPQHKPPQXCVKXGCRRTQCEJGU 2TQH&T+PI 1WTTGUGCTEJCTGCUCTGRTGUGPVGFKP VCKNQTGFVQTGCNYQTNFCRRNKECVKQPUCPF (NQTKCP*QN\CRHGN VJGHQNNQYKPIUGEVKQPU6JGTGUGCTEJ RTQFWEVUCUYGNNCUVQVJGFGOCPFKPI KPHTCUVTWEVWTGKPENWFGUUGXGTCNƅKIJV EJCNNGPIGUQHVQOQTTQY %QPVCEV UKOWNCVQTUVGUVTKIUCPFOCPPGFCPF YYYHUFOYVWOFG QHƄEG"HUFOYVWOFG 2JQPG (NKIJV)WKFCPEGCPF(NKIJV%QPVTQN #OQPIVJGXCTKQWUƄGNFUQHTGUGCTEJ ƅKIJVEQPVTQNCPFƅKIJVIWKFCPEGITQWRJCU QTKGPVGFVQYCTFUVJGFGXGNQROGPVQH UWEEGUUHWNN[EQORNGVGFUGXGTCNTGUGCTEJ CGTQURCEGGPIKPGGTKPIVJGCTGCQHƅKIJV RTQLGEVUCPFJCUCESWKTGFPGYEQNNCDQTC- IWKFCPEGCPFEQPVTQNCUYGNNCUƅKIJV VKQPUYKVJVJGKPFWUVT[2TQLGEVTGUWNVUCPF OCPCIGOGPVQHOCPPGFCPFWPOCPPGF QPIQKPITGUGCTEJJCXGDGGPRTGUGPVGF U[UVGOUKURCTVKEWNCTN[EJCNNGPIKPICPF CV#+46'%CPF+.#CPF RTCEVKECNN[TGNGXCPV1PGQHVJGOCKP XCTKQWUUEKGPVKƄEEQPHGTGPEGU QDLGEVKXGUQH67/(5&oUƅKIJVEQPVTQN CPFƅKIJVIWKFCPEGTGUGCTEJITQWRKU 2TQLGEVU VQFGXGNQRPGYEQPEGRVUCPFOGVJQFU ■ #HHQTFKPIUCHGJKIJN[TGNKCDNGCPF QHIWKFCPEGCPFEQPVTQNFGUKIPUCPF CHHQTFCDNGCWVQOCVKQPHQTCGTQURCEG VQRTCEVKECNN[GXCNWCVGVJGKTDGPGƄVUHQT U[UVGOU 67/+#5 OCPPGFCPFWPOCPPGFCGTKCNXGJKENGU ■ &GXGNQROGPVQHCPCWVQRKNQVWUKPIC 4GUGCTEJCEVKXKVKGUGPEQORCUUCWVQOCVKE OQFWNCTCTEJKVGEVWTGHQT%5CKTETCHV VCMGQHHCPFNCPFKPIVTCLGEVQT[IGPGTCVKQP CPFOQFGNDCUGFFGXGNQROGPVQH CPFKPPGTCPFQWVGTNQQREQPVTQNNGTU HWPEVKQPCNCNIQTKVJOUHQTUCHGV[ETKVKECN DCUGFQPPQPNKPGCTCPFCFCRVKXGƅKIJV U[UVGOU $/9K EQPVTQNQTTQDWUVƅKIJVEQPVTQN ■ &GXGNQROGPVQHCXQKEGEQOOCPFGF 0QVCDNGCEJKGXGOGPVUKP CWVQRKNQVHQTKPVGITCVKQPQH7#5KPVQEKXKN KPENWFGVJGFGXGNQROGPVQHCJQNKUVKE CKTURCEG $/9K Simulator tests on brain controlled n#EVKXGƅ[D[YKTGEQPVTQNEQPEGRVo ■ 6QVCNECRCDKNKV[CRRTQCEJVQJKIJN[ ƅKIJV 2JQVQ #*GFFGTIQVV67 München) URGEKƄECNN[FGFKECVGFVQCKTYQTVJKPGUU CEEWTCVGCPFUCHGIWKFCPEGCRRNKGFVQ GPJCPEGOGPVHQTHWVWTGIGPGTCNCXKCVKQP CPCWVQOCVKENCPFKPIU[UVGO $/9K CKTETCHVVJGFGUKIPNC[QWVCPFCPCN[UKUQH ■ &GXGNQROGPVQHCPCWVQRKNQVHQT42#5 TQDWUVEQPVTQNNGTUHQTGZEGNNGPEGKPJCPF- YKVJƄZGFYKPITQVCT[YKPIQTJ[DTKF NKPISWCNKVKGUYKVJTGURGEVVQVJG&#CU EQPƄIWTCVKQP $/9K TGHGTGPEGEQPƄIWTCVKQPCPFVJGXGTKƄECVKQP ■ &GXGNQROGPVQHVJGƅKIJVEQPVTQNU[U- GXCNWCVKQPCPFXCNKFCVKQPQHƅKIJVEQPVTQN VGOHQTCPWPUVCDNGVCKNNGUULGV KPFWUVT[ U[UVGOUD[OGCPUQHKPPQXCVKXGƅKIJV ■ /QFGNDCUGFFGXGNQROGPVQHCEGTVK- UKOWNCVQTVGUVECORCKIPU'ZRGTKOGPVUQP ƄCDNGCXKQPKEUU[UVGOHQTWPOCPPGF DTCKPEQPVTQNNGFCKTETCHVƅKIJVKPVJGUEQRG CGTKCNXGJKENGUQHMIVQMI QHCP'7HWPFGFRTQLGEVCVVTCEVGFKPVGTPC- KPFWUVT[ VKQPCNCVVGPVKQPQHGZRGTVUCPFOGFKC6JG Institute of Flight System Dynamics 97 /QFGNKPI5KOWNCVKQP2CTCOGVGT'UVKOCVKQP CPF(NKIJV5CHGV[ 6JGTGUGCTEJITQWR/QFGNNKPI5KOWNCVKQP SWCPVKƄECVKQPQHVJGKPEKFGPVRTQDCDKNKVKGU 2CTCOGVGTU'UVKOCVKQPCPF(NKIJV5CHGV[ HQTCIKXGPCKTNKPGDCUGFQPKPHQTOCVKQP HQEWUGUQPVJGOQFGNNKPIQHƅKIJVXGJKENG CDQWVVJGƅKIJVQRGTCVKQP2TGFKEVKXGCPC- U[UVGOUQPVJGQPGJCPFCPFRTGFKEVKXG N[UKUYJKEJKUEQPFWEVGFCVQWTKPUVKVWVG CPCN[UKUVQQNUQPVJGQVJGTJCPF6JG TGHGTUVQOCMKPICSWCPVKVCVKXGUVCVGOGPV RCTCOGVGTGUVKOCVKQPCRRTQCEJKUDCUGF CDQWVCHWVWTGUVCVGQTEQPFKVKQPDCUGF QPOGCUWTGFKPRWVCPFQWVRWVFCVCQHVJG QPRTGXKQWUGZRGTKGPEGQTMPQYNGFIG+V TGCNU[UVGO(NKIJVXGJKENGU[UVGOKFGPVK- HQEWUGUQPSWCPVKH[KPIVJGRTQDCDKNKVKGUQH ƄECVKQPHQEWUGUQPVJGCKTETCHVF[PCOKEU UGTKQWUKPEKFGPVUHQTCPKPFKXKFWCNCKTNKPG CPFQPOQFGNKPIVJGHQTEGUCPFOQOGPVU YJKEJCTGGZVTGOGN[UOCNN[GVPQVGSWCNVQ VJCVCEVQPKV6JGTGUWNVKUCXCNKFCVGF \GTQ2TGFKEVKXGCPCN[UKUYKNNDGCPKPVGITCN OQFGNYKVJMPQYPWPEGTVCKPV[DQWPFU RCTVQHVJGDQZQHVQQNUVJCVYKNNMGGRVJG VJCVKUTGNKCDNGKPCMPQYPTGIKQPQHVJG UMKGUQHVQOQTTQYUCHG ƅKIJVGPXGNQRG5[UVGOKFGPVKƄECVKQP VGEJPKSWGUCNNQYVQEQORCTGCPFEQODKPG 2TQLGEVU F[PCOKEOQFGNUHTQOXGT[FKHHGTGPVUQWT- ■ 4GUGCTEJCPFFGXGNQROGPVQHCEQTG EGUGIHTQOƅKIJVVGUVFCVCYKPFVWPPGN UKOWNCVKQPOQFGNHQTCUOCNNCKTETCHV VGUVUQTEQORWVCVKQPCNƅWKFF[PCOKEU KPFWUVT[ NGCFKPIVQXGT[CEEWTCVGTGUWNVU ■ 4QDWUVKPƅKIJVKFGPVKƄECVKQP $C[T 6JGU[UVGOKFGPVKƄECVKQPITQWRHQEWUGU (QTUEJWPIUUVKHVWPI QPWPOCPPGFCGTKCNU[UVGOUCPFIGPGTCN ■ %QPEGRVCPFKORNGOGPVCVKQPQHC CXKCVKQPCKTETCHV+PFQKPIUQVJGITQWRKU UCHGV[OCPCIGOGPVU[UVGOHQTVJG EQPVTKDWVKPIVQOCP[RTQLGEVU6JKUKPENW- KORTQXGOGPVQHƅKIJVUCHGV[ $/9K FGUVJGOQFGNKPIQHƄZGFYKPICKTETCHV ■ 4QDWUVFGVGEVKQPQHUCHGV[ETKVKECN JGNKEQRVGTCPFOWNVKEQRVGTU[UVGOU6JG GXGPVUKPƅKIJVFCVC <+/ KFGPVKƄGFOQFGNUYGTGWUGFCUVJGDCUKU ■ /QFWNCTVTCKPKPIUKOWNCVQTU[UVGOHQT HQTGIVJGOQFGNDCUGFFGUKIPQHƅKIJV 7#5 <+/ EQPVTQNU[UVGOUCPFCUƅKIJVF[PCOKEU OQFGNKPJKIJƄFGNKV[ƅKIJVUKOWNCVQTU 6JGƅKIJVUCHGV[RCTVHQEWUGUQPVJG 6TCLGEVQT[1RVKOK\CVKQP 6JG6TCLGEVQT[1RVKOK\CVKQP4GUGCTEJ )TQWRCV(5&FGXGNQRUVCKNQTGFQRVKOCN EQPVTQNOGVJQFUCPFCRRNKGUVJGOVQ ƅ[KPIU[UVGOUCPFCKTVTCHƄETGNCVGF RTQDNGOU$GUKFGUVJGECNEWNCVKQPQHHWGN CPFVKOGOKPKOCNVTCLGEVQTKGUHQTCUKPING CKTETCHVVJGFGVGTOKPCVKQPQHPQKUGOKPKOCN TQWVGUCUYGNNCUVJGQRVKOK\CVKQPQH EQORNGZCKTVTCHƄEUEGPCTKQUJCXGDGEQOG OQTGCPFOQTGKORQTVCPVFWTKPIVJG Noise minimized approach route to an airport NCUV[GCTU+PVJGUGOWNVKRNGCKTETCHVCTG IWKFGFVJTQWIJCIKXGPCKTURCEGUGEVQT IWCTCPVGGFCVCP[VKOG(WTVJGTOQTGHQT OKPKOK\KPIVJGGPXKTQPOGPVCNKORCEVU CNNCRRNKECVKQPUKVJCUVQDGVCMGPECTGHQT QTVJGQRGTCVKQPCNEQUVUHQTVJGCKTNKPGU CNNCKTETCHVTGNCVGFGPXGNQRGEQPUVTCKPVUCU 1HEQWTUGUCHGV[JCUVJGJKIJGUVRTKQTKV[ YGNNCUCNNTGIWNCVQT[EQPUVTCKPVUVQGPUWTG CPFUGRCTCVKQPEQPUVTCKPVUJCXGVQDG TGCNKUVKEUQNWVKQPU6JGTGUWNVUQHVJG 98 Institute of Flight System Dynamics ECNEWNCVKQPUJCXGCNUQDGGPWUGFYKVJKP (WTVJGTOQTGQRVKOCNEQPVTQNRTQDNGOU CEQOOGTEKCNVWPPGNKPVJGUM[U[UVGO YJGTGPQVQPN[EQPVKPWQWUXCNWGUCTG RTQQƄPIVJGKTWUCDKNKV[6QDGCDNGVQUQNXG UQWIJVDWVCFFKVKQPCNFKUETGVGEQPVTQNU CNNVJQUGRTQDNGOUGHƄEKGPVN[CPQRVKOCN QTFGEKUKQPUCTGVQDGFGVGTOKPGFECPDG EQPVTQNVQQNDQZJCUDGGPFGXGNQRGFKP UQNXGF(QTƅKIJVU[UVGOUVJKUKUGURGEKCNN[ /#6.#$5KOWNKPMVJCVECPDGWUGFVQ TGNGXCPVYJGPFKUETGVGEQPVTQNUCTGKPXQN- UQNXGVTCLGEVQT[QRVKOK\CVKQPRTQDNGOU XGFKPVJGQRVKOK\CVKQPRTQEGUUNKMGVJG HTQOUGXGTCNDTCPEJGU ƅCRUUGVVKPIUQTVJGIGCTRQUKVKQPUVJCV #URGEKCNHGCVWTGQHVJGVQQNDQZKUVJG ECPQPN[VCMGRTGFGƄPGFRQUKVKQPUYKVJPQ CDKNKV[VQUQNXGDKNGXGNQRVKOCNEQPVTQN KPVGTOGFKCVGXCNWGUCNNQYGF RTQDNGOU+PVJKUV[RGQHRTQDNGOUOWNVKRNG QRVKOCNEQPVTQNRTQDNGOUCTGPGUVGFYKVJKP 2TQLGEVU CRCTCOGVGTQRVKOK\CVKQPRTQDNGO6JKU ■ 5KOWNCVKQPQHGPXKTQPOGPVCNKORCEVUQH YC[OCP[PGYCRRNKECVKQPUJCXGDGEQOG CXKCVKQPHQTCKTVTCHƄEEQPVTQNNGTGFWEC- RQUUKDNG1PGQHVJGOKUVJGQRVKOK\CVKQP VKQP #K( QHCRRTQCEJCPFFGRCTVWTGTQWVGUYKVJ ■ #FCRVCVKQPQH914*2VQCXKQPKEU TGURGEVVQPQKUGKPUEGPCTKQUYJGTGCNN EQPUVTCKPVU '7 CKTETCHVCTGƅ[KPIEQUVQRVKOCN#PQVJGT ■ 7UGQHFKHHGTGPVOQFGNKPIƄFGNKVKGU CRRNKECVKQPKUVJGQRVKOK\CVKQPQHCKTTCEG YKVJKPQRVKOCNEQPVTQNRTQDNGOU &() EQWTUGUYKVJTGURGEVVQUCHGV[ETKVGTKC ■ /QFGNKPIUKOWNCVKQPCPFQRVKOK\CVKQP CUUWOKPICNNRKNQVUƅ[KPIVJTQWIJVJG QHGZQCVOQURJGTKETQEMGVU KPFWUVT[ EQWTUGKPOKPKOCNVKOG #XKQPKEUCPF5CHGV[%TKVKECN5[UVGOU 6TCFKVKQPCNN[VJGTGUGCTEJCV(5&YCU KUCEEQORNKUJGFKPENQUGEQNNCDQTCVKQPYKVJ HQEWUGFQPHWPEVKQPUCPFCNIQTKVJOU9KVJ JKIJN[KPPQXCVKXG5/'UOCPWHCEVWTGTUQH VJGPGYHQEWUQPRTQVQV[RKPICRRNKECVKQP 42#5CPFIGPGTCNCXKCVKQPCKTETCHVCUYGNN U[UVGOUYKVJUOCNNCPFOGFKWOGPVGTRTKUGU CUVQQNXGPFQTU CUOCKPRCTVPGTUHQT7#542#5CPFIGPGTCN CXKCVKQPCKTETCHVKORNGOGPVCVKQPCURGEVU 2TQLGEVU JCXGICKPGFJKIJKORQTVCPEG9KVJVJGEQUV ■ &GXGNQROGPVQHEGTVKƄCDNGƅKIJVEQPVTQN YGKIJVXQNWOGCPFQVJGTEQPUVTCKPVUQHVJG U[UVGOCTEJKVGEVWTGUHQT42#5WRVQ OCTMGVUCFFTGUUGFCPFVJGNKOKVGFRGTUQPCN MI/619 <+/ CPFƄPCPEKCNTGUQWTEGUQHV[RKECN5/'U ■ &GXGNQROGPVQHKPVGTPCNN[TGFWPFCPV CVTCPUHGTQHUQNWVKQPURTQEGUUGUEQO- GNGEVTQOGEJCPKECNCEVWCVQTUYKVJ RQPGPVUCPFVQQNUHTQONCTIGCPFOKNKVCT[ DCEMWRƅKIJVEQPVTQNECRCDKNKVKGU <+/ CXKCVKQPYQWNFNGCFVQCIKICPVKEHCKNWTG ■ 'PJCPEGOGPVUQPOQFGNDCUGF $CUGFQPVJGURGEKƄETGSWKTGOGPVUQHVJG FGXGNQROGPVRTQEGUUGUCPFVQQNUHQT OCTMGVEQPUKFGTGFCPFWVKNK\KPIFKUTWRVKXG ƅKIJVYQTVJ[EGTVKƄCDNGUQHVYCTG VGEJPQNQIKGUCPFKPPQXCVKQPUHTQOPQP ■ &GXGNQROGPVQHEGTVKƄCDNGƅKIJVEQPVTQN CGTQURCEGFQOCKPUVCKNQTGFRTQEGUUGU U[UVGOCTEJKVGEVWTGUHQT42#5CDQXG VQQNUCPFUQNWVKQPUCTGTGSWKTGF4GUGCTEJ MI/619 KPFWUVT[ HQEWUGUCTGOQFGNDCUGFFGUKIPQHHWPEVKQ- ■ &GXGNQROGPVQHCU[UVGOCPFUQHVYCTG PCNCNIQTKVJOUHQTIWKFCPEGPCXKICVKQPCPF FGXGNQROGPVRTQEGUUHQTEGTVKƄCDNG EQPVTQNCRRNKECVKQPUOQFGNDCUGFUCHGV[ CXKQPKEU KPFWUVT[ CUUGUUOGPVCUYGNNCUVJGFGXGNQROGPV ■ 2J[UKECNOQFGNKPICPFUKOWNCVKQPQH QHCXKQPKEUU[UVGOCTEJKVGEVWTGUCPFVJG CXKQPKEUU[UVGOUHCKNWTGDGJCXKQT EQPVTKDWVKPIEQORQPGPVU ƅKIJVEQPVTQN ■ #UUKUVGFOQFGNXCNKFCVKQPCICKPUV EQORWVGTUFCVCEQPEGPVTCVQTWPKVUGNGEVTQ- UCHGV[TGSWKTGOGPVUWUKPIHCKNWTG OGEJCPKECNCEVWCVQTUPCXKICVKQPU[UVGOU UKOWNCVKQP CPFRQYGTU[UVGOEQORQPGPVU 6JGYQTM Institute of Flight System Dynamics 99 5GPUQTU0CXKICVKQPCPF&CVC(WUKQP 0CXKICVKQPU[UVGOUCPFUGPUQTURTQXKFG GUUGPVKCNKPHQTOCVKQPQPCKTETCHVUVCVG TGSWKTGFHQTƅKIJVEQPVTQNCPFIWKFCPEG UWEJCURQUKVKQPCPFCPIWNCTTCVG%QPUG- SWGPVN[VJGRGTHQTOCPEGQHƅKIJVEQPVTQN ITGCVN[FGRGPFUQPPCXKICVKQPCEEWTCE[ +PCFFKVKQPUCHGCPFUWEEGUUHWNOKUUKQP CEEQORNKUJOGPVTGSWKTGUJKIJCXCKNCDKNKV[ CPFTQDWUVPGUUQHPCXKICVKQPYKVJTGURGEV VQHCWNVUQTFKUVWTDCPEGU6JG0CXKICVKQP 4GUGCTEJ)TQWRCV(5&UVWFKGUVJG Integrated navigation CRRNKECVKQPQHKPPQXCVKXGOGVJQFUVJCV GPCDNGTGFWEVKQPQHPCXKICVKQPU[UVGO 2TQLGEVU UK\GYGKIJVRQYGTCPFEQUV6JGHQEWU ■ 5CVGNNKVGPCXKICVKQP NKGUQPFCVCHWUKQPQHXCTKQWUUGPUQT ■ 5WTHCEGKOCIGCPFOQFGNCKFGF OGCUWTGOGPVUECTT[KPIKPFGRGPFGPVKPHQT- navigation OCVKQPCPFKPGTVKCNPCXKICVKQPKPKPVGITCVGF ■ (CWNVVQNGTCPV#&#*45 PCXKICVKQPU[UVGOU 4GUGCTEJ(QEWU %QWTUGU ■ (NKIJVIWKFCPEGCPFƅKIJVEQPVTQN ■ +PVTQFWEVKQPVQ(NKIJV5[UVGO&[PCOKEU ■ /QFGNKPIUKOWNCVKQPRCTCOGVGT CPF(NKIJV%QPVTQN GUVKOCVKQPCPFƅKIJVUCHGV[ ■ (NKIJV5[UVGO&[PCOKEU+++ ■ 6TCLGEVQT[QRVKOK\CVKQP ■ (NKIJV%QPVTQN+++ ■ #XKQPKEUCPFUCHGV[ETKVKECNU[UVGOU ■ (NKIJV)WKFCPEG+ ■ 5GPUQTUPCXKICVKQPFCVCHWUKQP ■ &GXGNQROGPVQH(NKIJV%QPVTQN5[UVGOU ■ 0QPNKPGCT#FCRVKXG(NKIJV%QPVTQN %QORGVGPEG ■ (NKIJV&[PCOKEU%JCNNGPIGUQH*KIJN[ ■ 5KOWNCVKQPQHCGTQURCEGU[UVGOU #WIOGPVGF#KTETCHV+++ ■ &GXGNQROGPVQH)0%HWPEVKQPUKP ■ #KTETCHV6TCLGEVQT[1RVKOK\CVKQP CEEQTFCPEGVQCGTQURCEGUVCPFCTFU ■ 0CXKICVKQPCPF&CVC(WUKQP ■ 6TCLGEVQT[QRVKOK\CVKQPWPFGTCRRNKEC- ■ (NKIJV5[UVGO+FGPVKƄECVKQPCPF2CTC- VKQPTGNGXCPVEQPUVTCKPVU OGVGT'UVKOCVKQP ■ #KTNKPGQRGTCVKQPCNUCHGV[CUUGUUOGPV ■ (WPFCOGPVCNUQH2TCEVKECN(NKIJV.CD ■ (NKIJV)WKFCPEG.CD +PHTCUVTWEVWTG ■ (NKIJV6GUVKPI.CD ■ /WNVKRNGƄZGFCPFTQVCT[YKPI7#5 ■ (NKIJV%QPVTQN.CD 42#5 ■ 1RVKOCN%QPVTQN.CD ■ 6JTGGƅKIJVUKOWNCVQTU HTQOTGUGCTEJVQ NGXGN(6& ■ 6YQOCPPGFTGUGCTEJCKTETCHVUGTXKPI CUƅ[KPIVGUVDGFQPGQHVJGOYKVJ CEVKXGCEEGUUVQƅKIJVEQPVTQNU ■ *+.VGUVDGPEJGU 100 Institute of Flight System Dynamics Management &KRN+PI/CTMWU*QTPCWGT 5EJQNCT 2TQH&T+PI(NQTKCP*QN\CRHGN&KTGEVQT &KRN+PI#PFTGCU,CTQU WPVKN 2TQH&T+PI&TJE)QVVHTKGF5CEJU TGV VJGPGZVGTPCN 2TQH&T+PI1VVQ9CIPGT &KRN+PI'TKM-CTNUUQP &T+PI/CVVJKCU*GNNGT %JTKUVQRJ-TCWUG/5E &T+PI/KEJCGN-TKGIGN #FLWPEV2TQHGUUQTU.GEVWTGTU /CTVKP-ØINGT/5E &T+PI&KRN/CVJVGEJP &KRN+PI2CVTKEM.CWHHU ,QJCPP&CODGEM /KSWGN.GKVCQ/5E 5EJQNCT &T+PI/CVVJKCU*GNNGT &KRN+PI,CMQD.GP\ &KRN+PI&CXKF.ÒDN #FOKPKUVTCVKXG5VCHH #TPCD/CKV[2J& /QPKEC-NGKPQVJ)TQUU &KRN+PI/CZKOKNKCP/ØJNGII &KRN+PI0KNU/WOO 4GUGCTEJ5EKGPVKUVU &KRN+PI-CLGVCP0ØTPDGTIGT 5TCXCP#MMKPCRCNNK/5E &KRN+PI(NQTKCP2GVGT WPVKN &KRN+PI6JCFFÀWU$CKGT VJGPGZVGTPCN (GFQT$CMNCPQX/5E 5EJQNCT &KRN+PI.CTU2GVGT &KRN+PI$GTPJCTF$CWT 5EJQNCT +FTKU2WVTQ/5E 5EJQNCT &KRN+PI/CIPWU$KEJNOGKGT 5EJQNCT &KRN+PI6JQOCU4CHƅGT &T+PI6JQOCU$KGTNKPI WPVKN &KRN+PI/CZKOKNKCP4KEJVGT &KRN+PI/CVVJKCU$KVVPGT &KRN+PI/CVVJKCU4KGEM 5EJQNCT &KRN+PI$GPLCOKP$TCWP WPVKN 5KOQP5EJCV\/5E VJGPGZVGTPCN &KRN+PI8QNMGT5EJPGKFGT &KRN+PI5VCPKUNCX$TCWP &KRN+PI%JTKUVQRJGT5EJTQRR ;CJCQ%JGPI/5E 5EJQNCT &T+PI(CNMQ5EJWEM WPVKN (CTJCPC%JGY/5E 5EJQNCT ,GCPGVVG5GGYCNF/5E &KRN+PI%JTKUVQRJ&ÒTJÒHGT ,CXGPUKWU5GODKTKPI/6 5EJQNCT &KRN+PI.WFYKI&TGGU &KRN+PI2JKNKR5RKGIGN &KRN+PI%JTKUVKCP'KVPGT WPVKN .WMCU5VGKPGTV/5E 5EJQNCT VJGPGZVGTPCN &KRN+PI&CXKF6TQODC &KRN+PI)WKNNGTOQ(CNEQPK %JQPI9CPI/5E &KRN+PI6KO(TKEMG+PIÅPKGWT5WRCÅTQ ,KCP9CPI/5E &KRN+PI#IPGU)CDT[U Institute of Flight System Dynamics 101 2WDNKECVKQPU ■ %TQEQNN2JKNKRR )ÒTEMG.QTGP\ 6TQOOGT) ■ 'KVPGT%JTKUVKCP $TCWP5VCPKUNCX *QN\CRHGN(NQTKCP *QN\CRHGN(NQTKCP 7PKƄGF/QFGN6GEJPKSWG #WVQNCPF%QPVTQNNGT&GUKIP2TQEGFWTGDCUGF HQT+PGTVKCN0CXKICVKQP#KFGFD[8GJKENG&[PCOKEU QP6QVCN5[UVGO'TTQT%QPEGRVHQTC5OCNN7#8 /QFGN+P 0#8+)#6+10 #KTETCHV+P #+##)WKFCPEG0CXKICVKQPCPF%QPVTQN ■ (KUEJ(NQTKCP $KVVPGT/CVVJKCU *QN\CRHGN(NQTKCP )0% %QPHGTGPEG$QUVQP/# 1RVKOCN5EJGFWNKPIQH(WGN/KPKOCN ■ 'KVPGT%JTKUVKCP *QN\CRHGN(NQTKCP #RRTQCEJ6TCLGEVQTKGU+P ,QWTPCNQH#GTQURCEG #WVQOCVKE.CPFKPI5[UVGOWUKPI5$#5CPF'NGEVTQ 1RGTCVKQPU 1RVKECN5GPUQT/GCUWTGOGPV&CVC+P 7#89QTNF ■ 6TCWIQVV,QJCPPGU 0GUVGTQXC#2 5CEJU %QPHGTGPEG(TCPMHWTVCO/CKP)GTOCP[ )QVVHTKGF 6JG(NKIJVQHVJG#NDCVTQU+P +''' ■ 'KVPGT%JTKUVKCP *QN\CRHGN(NQTKCP &GXGNQR- 5RGEVTWO,WN[ RRs OGPVQHC0CXKICVKQP5QNWVKQPHQTCP+OCIG#KFGF ■ $KEJNOGKGT/CTMWU *QN\CRHGN(NQTKCP :CTIC[ #WVQOCVKE.CPFKPI5[UVGO+P +10206*QPQNWNW 'PTKE *QXCMKO[CP0CKTC .#FCRVKXG 75# #WIOGPVCVKQPQHC*GNKEQRVGT$CUGNKPG%QPVTQNNGT ■ 'KVPGT%JTKUVKCP *QN\CRHGN(NQTKCP 6QVCN +P #+##)WKFCPEG0CXKICVKQPCPF%QPVTQN )0% 5[UVGO2GTHQTOCPEG%QPEGRVCRRNKGFVQVJG %QPHGTGPEG$QUVQP/# &GXGNQROGPVQHCP+OCIG#KFGF#WVQOCVKE7#8 ■ $KGTNKPI6JQOCU *ÒEJV.GQPJCTF /GTMN .CPFKPI5[UVGO+P 7#89QTNF%QPHGTGPEG %JTKUVKCP /CKGT4WFQNH *QN\CRHGN(NQTKCP (TCPMHWTVCO/CKP)GTOCP[ 5KOKNCTKVKGUQH*GFIKPICPF.#FCRVKXG%QPVTQN+P ■ (CNEQPK)WKNNGTOQ (TKVUEJ1NKXGT .QJOCPP %'#5'WTQ)0%&GNHV6JG0GVJGTNCPFU $QTKU *QN\CRHGN(NQTKCP #FOKUUKDNG6JTWUV ■ $KGTNKPI6JQOCU /ØJNGII/CZKOKNKCP *QN\CRHGN %QPVTQN.CYUHQT3WCFTQVQT2QUKVKQP6TCEMKPI+P (NQTKCP 4GHGTGPEG/QFGN/QFKƄECVKQP 2TQEGGFKPIUQHVJG#OGTKECP%QPVTQN%QPHGTGPEG HQT4QDWUV2GTHQTOCPEG%QPUGTXCVKQPQH/QFGN 9CUJKPIVQP&%75# 4GHGTGPEG#FCRVKXG%QPVTQNNGTU+P #+##)WKFCPEG ■ (CNEQPK)WKNNGTOQ *QN\CRHGN(NQTKCP 2QUK- 0CXKICVKQPCPF%QPVTQN )0% %QPHGTGPEG$QUVQP VKQP6TCEMKPIQHC/WNVKEQRVGTWUKPIC)GQOGVTKE /# $CEMUVGRRKPI%QPVTQN.CY+P %'#5'WTQ)0% ■ $KVVPGT/CVVJKCU $TWJU2JKNKR 4KEJVGT/CZKOKNKCP &GNHV6JG0GVJGTNCPFU *QN\CRHGN(NQTKCP #P#WVQOCVKE/GUJ ■ (TKEMG6KO *QN\CRHGN(NQTKCP #RRN[KPI 4GƄPGOGPV/GVJQFHQT#KTETCHV6TCLGEVQT[1RVKOK- $TCKP/CEJKPG+PVGTHCEGUVQ#KETCHV%QPVTQN 2QVGPVK- \CVKQP2TQDNGOU+P #+##)0%CPF%Q.QECVGF CNUCPF%JCNNGPIGU+P &).4$GTKEJV> %QPHGTGPEGU$QUVQP/# /GPUEJ\YKUEJGP#WVQOCVKUKGTWPI-QORGVGP\WPF ■ $KVVPGT/CVVJKCU (NGKUEJOCPP$GPLCOKP 4KEJVGT 8GTCPVYQTVWPI1VVQDTWPP /CZKOKNKCP *QN\CRHGN(NQTKCP 1RVKOK\CVKQP ■ *GKUG%JTKUVKCP .GKVCQ/KIWGN *QN\CRHGN(NQTKCP QH#6/5EGPCTKQU%QPUKFGTKPI1XGTCNNCPF5KPING 2GTHQTOCPEGCPF4QDWUVPGUU/GVTKEUHQT %QUVU+P VJ+PVGTPCVKQPCN%QPHGTGPEGQP4GUGCTEJ #FCRVKXG(NKIJV%QPVTQNs#XCKNCDNG#RRTQCEJGU KP#KT6TCPURQTVCVKQP+UVCPDWN6WTMG[/C[ +P #+##)WKFCPEG0CXKICVKQPCPF%QPVTQN )0% %QPHGTGPEG$QUVQP/# ■ $KVVPGT/CVVJKCU *QTPHGEM%JTKUVQRJ *QN\CRHGN ■ *ÒEJV.GQPJCTF $KGTNKPI6JQOCU *QN\CRHGN (NQTKCP 1RVKOK\CVKQPQH/KFVQ.QPI4CPIG (NQTKCP 7NVKOCVG$QWPFGFPGUU6JGQTGOHQT (NKIJVU%QPUKFGTKPI#KTVQ#KT4GHWGNKPIHQT(WGN /QFGN4GHGTGPEG#FCRVKXG%QPVTQN5[UVGOU+P 5CXKPIU+P '7%#55/ØPEJGP #+##)WKFCPEG0CXKICVKQPCPF%QPVTQN%QPHG- ■ $TCWP5VCPKUNCX )GKUGT/CTMWU *GNNGT/CVVJKCU TGPEG0CVKQPCN*CTDQWT/CT[NCPF75# *QN\CRHGN(NQTKCP %QPƄIWTCVKQP#UUGUUOGPV ■ *ÒJPFQTH.WMCU 5GODKTKPI,CXGPUKWU *QN\CRHGN CPF2TGNKOKPCT[%QPVTQN.CY&GUKIPHQTC0QXGN (NQTKCP %QRWNCUCRRNKGFVQ(NKIJV&CVC &KCOQPF5JCRGF7#8+P +PVGTPCVKQPCN%QPHGTGPEG #PCN[UKU+P 2TQDCDKNKUVKE5CHGV[#UUGUUOGPVCPF QP7POCPPGF#KTETCHV5[UVGOU +%7#5 1TNCPFQ /CPCIGOGPV25#/*QPQNWNW*CYCKK (.75#/C[ ■ .GKVCQ/KIWGN 2GVGT(NQTKCP *QN\CRHGN(NQTKCP ■ %JQYFJCT[)KTKUJ /ØJNGII/CZKOKNKCP *QY, #FCRVKXG#WIOGPVCVKQPQHC(KIJVGT#KTETCHV 2 *QN\CRHGN(NQTKCP %QPEWTTGPV.GCTPKPI #WVQRKNQV7UKPIC0QPNKPGCT4GHGTGPEG/QFGN+P #FCRVKXG/QFGN2TGFKEVKXG%QPVTQN+P %'#5 %'#5'WTQ)0%&GNHV6JG0GVJGTNCPFU 'WTQ)0%&GNHV6JG0GVJGTNCPFU ■ .ÒDN&CXKF *QN\CRHGN(NQTKCP *KIJ(KFGNKV[ ■ %JWF[2GVGT 8NM,CP .GKVCQ/KIWGN 5VTQUEJGT 5KOWNCVKQP/QFGNQHCP#GTKCN4GHWGNKPI$QQO (GNKZ 'XQNWVKQP&TKXGP%QPVTQNNGT&GUKIPHQT CPF4GEGRVCENG+P &).4&GWVUEJGT.WHVWPF #GTQUGTXQGNCUVKE#KTETCHV+P #+##/QFGNKPICPF 4CWOHCJTVMQPITGUU5VWVVICTV 5KOWNCVKQP6GEJPQNQIKGU%QPHGTGPEG$QUVQP/# ■ .ÒDN&CXKF *QN\CRHGN(NQTKCP 5KOWNCVKQP ■ %TQEQNN2JKNKRR )ÒTEMG.QTGP\ 6TQOOGT) #PCN[UKUQHC5GPUQT&CVC(WUKQPHQT%NQUG(QT- *QN\CRHGN(NQTKCP 7PKƄGF/QFGN6GEJPKSWG OCVKQP(NKIJV+P #+##)WKFCPEG0CXKICVKQPCPF HQT+PGTVKCN0CXKICVKQP#KFGFD[8GJKENG&[PCOKEU %QPVTQN%QPHGTGPEG0CVKQPCN*CTDQWT/CT[NCPF /QFGN+P 2TQEGGFKPIUQHVJG+PVGTPCVKQPCN 75# 6GEJPKECN/GGVKPIQH6JG+PUVKVWVGQH0CXKICVKQP ■ /ØJNGII/CZKOKNKCP %JQYFJCT[)KTKUJ *QN\CRHGN 5CP&KGIQ%# (NQTKCP 1RVKOK\KPI4GHGTGPEG%QOOCPFU ■ &TGGU.WFYKI *CUGNJQHGT*GKMQ 5GODKTKPI HQT%QPEWTTGPV.GCTPKPI#FCRVKXG1RVKOCN%QPVTQN ,CXGPUKWU *QN\CRHGN(NQTKCP /QFGNKPIVJG QH7PEGTVCKP&[PCOKECN5[UVGOU+P #+##)WKFCPEG (NCTG/CPGWXGT2GTHQTOGFD[#KTNKPG2KNQVU7UKPI 0CXKICVKQPCPF%QPVTQN )0% %QPHGTGPEG (NKIJV1RGTCVKQP&CVC+P #+##/QFGNKPICPF $QUVQP|/# 5KOWNCVKQP6GEJPQNQIKGU%QPHGTGPEG$QUVQP/# ■ /ØJNGII/CZKOKNKCP %JQYFJCT[)KTKUJ *QY,2 ■ &TGGU.WFYKI 9CPI%JQPI *QN\CRHGN(NQTKCP *QN\CRHGN(NQTKCP #FCRVKXG1RVKOCN%QPVTQN 7UKPI5WDUGV5KOWNCVKQPVQ3WCPVKH[ QH%QPUVTCKPGF0QPNKPGCT7PEGTVCKP&[PCOKECN5[U- 5VCMGJQNFGT%QPVTKDWVKQPVQ4WPYC[1XGTTWP+P VGOUWUKPI%QPEWTTGPV.GCTPKPI/QFGN2TGFKEVKXG 25#/2TQDCDKNKUVKE5CHGV[#UUGUUOGPVCPF %QPVTQN+P #+##)WKFCPEG0CXKICVKQPCPF%QPVTQN /CPCIGOGPV*QPQNWNW*+/#,WPG )0% %QPHGTGPEG$QUVQP/# 102 Institute of Flight System Dynamics ■ /ØJNGII/CZKOKNKCP &CWGT%, &KVVTKEJ,ÒTI ■ 9CPI%JQPI &TGGU.WFYKI )KUUKDN0CFKPG *QN\CRHGN(NQTKCP #FCRVKXG6TCLGEVQT[%QP *ÒJPFQTH.WMCU 5GODKTKPI,CXGPUKWU *QN\CRHGN VTQNNGTHQT)GPGTKE(KZGF9KPI7POCPPGF#KTETCHV (NQTKCP 3WCPVKƄECVKQPQH+PEKFGPV2TQDCDK- +P %'#5'WTQ)0%&GNHV6JG0GVJGTNCPFU NKVKGU7UKPI2J[UKECNCPF5VCVKUVKECN#RRTQCEJGU ■ 0CTCPI5KFFCTVJ# 2GVGT(NQTKCP *QN\CRHGN +P VJ+PVGTPCVKQPCN%QPHGTGPEGQP4GUGCTEJKP#KT (NQTKCP 8CNCUGM, #WVQRKNQVHQTC0QPNKPGCT 6TCPURQTVCVKQP+UVCPDWN6WTMG[/C[ 0QP/KPKOWO2JCUG6CKN%QPVTQNNGF/KUUKNG+P ■ 9CPI%JQPI &TGGU.WFYKI *QN\CRHGN(NQTKCP #+##)WKFCPEG0CXKICVKQPCPF%QPVTQN%QPHG- +PEKFGPV2TGFKEVKQPWUKPI5WDUGV5KOWNCVKQP TGPEG0CVKQPCN*CTDQWT/CT[NCPF75# +P VJ%QPITGUUQH+PVGTPCVKQPCN%QWPEKNQHVJG ■ 2GVGT(NQTKCP *GNNOWPFV(CDKCP *QN\CRHGN(NQTKCP #GTQPCWVKECN5EKGPEGU5V2GVGTUDWTI4WUUKC #PVK9KPFWR%QOOCPF(KNVGTGF#FCRVKXG 5GRVGODGT $CEMUVGRRKPI#WVQRKNQV&GUKIPHQTC6CKN%QPVTQNNGF ■ 9CPI,KCP *QN\CRHGN(NQTKCP 2GVGT(NQTKCP #KT&GHGPUG/KUUKNG+P #+##)WKFCPEG0CXKICVKQP %QORCTKUQPQH&[PCOKE+PXGTUKQPCPF$CEMUVGR- CPF%QPVTQN )0% %QPHGTGPEG$QUVQP/# RKPI%QPVTQNYKVJ#RRNKECVKQPVQC3WCFTQVQT ■ 4CHƅGT6JQOCU 9CPI,KCP *QN\CRHGN(NQTKCP +P %'#5'WTQ)0%&GNHV6JG0GVJGTNCPFU 2CVJ)GPGTCVKQPCPF%QPVTQNHQT7POCPPGF ■ 9CPI,KCP *QN\CRHGN(NQTKCP :CTIC['PTKE /WNVKTQVQT8GJKENGU7UKPI0QPNKPGCT&[PCOKE *QXCMKO[CP0CKTC 0QPECUECFGF&[PCOKE +PXGTUKQPCPF2UGWFQ%QPVTQN*GFIKPI+P VJ +PXGTUKQP&GUKIPHQT3WCFTQVQT2QUKVKQP%QPVTQN +(#%5[ORQUKWOQP#WVQOCVKE%QPVTQN9ØT\DWTI YKVJ.#WIOGPVCVKQP+P %'#5'WTQ)0%&GNHV ■ 4KEJVGT/CZKOKNKCP $KVVPGT/CVVJKCU *QN\CRHGN 6JG0GVJGTNCPFU (NQTKCP 0QKUG/KPKOCN#RRTQCEJGUQP ■ Institute of Flight System Dynamics 103 ■ /ØJNGII/CZKOKNKCP 0KGTOG[GT2JKNKRR *QN\CRHGN ■ 5EJCV\5KOQP2 *QN\CRHGN(NQTKCP /QFWNCT (NQTKCP 4GHGTGPEGEQOOCPFUJCRKPIHQT VTCLGEVQT[RCVJHQNNQYKPIEQPVTQNNGTWUKPIPQPNKPGCT CRRTQZKOCVGF[PCOKEKPXGTUKQPDCUGFOQFGN4GHG- GTTQTF[PCOKEU+P #GTQURCEG'NGEVTQPKEUCPF TGPEG#FCRVKXG%QPVTQN+P #GTQURCEG'NGEVTQPKEU 4GOQVG5GPUKPI6GEJPQNQI[ +%#4'5 +''' CPF4GOQVG5GPUKPI6GEJPQNQI[ +%#4'5 +PVGTPCVKQPCN;QI[CMCTVC+PFQPGUKC0QX +'''+PVGTPCVKQPCN;QI[CMCTVC+PFQPGUKC +'''RR 0QX +'''RR ■ 9CPI,KCP .ÒDN&CXKF 4CHƅGT6JQOCU *QN\CRHGN ■ 4KEJVGT/CZKOKNKCP $KVVPGT/CVVJKCU 4KGEM/CV- (NQTKCP -KPGOCVKE/QFGNNKPICPF%QPVTQN VJKCU *QN\CRHGN(NQTKCP #0QP%QQRGTCVKXG &GUKIPHQTCP#GTKCN4GHWGNNKPI6CUM+P #RRNKGF $K.GXGN1RVKOCN%QPVTQN2TQDNGO(QTOWNCVKQPHQT #GTQF[PCOKEU%QPHGTGPEG$TKUVQN 0QKUG/KPKOCN&GRCTVWTG6TCLGEVQTKGU+P +%#5 VJ+PVGTPCVKQPCN%QPHGTGPEG5V2GVGTUDWTI ■ Institute of Flight System Dynamics Institute of Aircraft Design Applied aircraft design for civil aviation and unmanned aerial systems ■ In 2013-14 the research focus of the Institute of Aircraft Design has been on the further enhancement of the integrated aircraft design environ- ment enabling aircraft design studies as well as operational analysis on mission performance. Multiple test systems have been established to verify design data gathered in simulation based design. A highlight was ƄTUVVGUVQHCHWNN[KPVGITCVGFRTQRWNUKQPU[UVGOHQTCFGOQPUVTCVQTCKT vehicle featuring a curved inlet and nozzle system for a jet engine. For civil aircraft designs and operations The optimization of reduced noise the capabilities in the operational assess- EQPƄIWTCVKQPUJCUDGGPGPCDNGFVJTQWIJ ment have been enhanced with respect to an innovative noise assessment procedure Univ.-Prof. Dr.-Ing. noise and emission assessment as well as developed for small aircraft. Mirko Hornung quantifying the capacity impact on airport operations. Contact www.lls.mw.tum.de [email protected] Phone +49.89.289.15981 UAS System Testing and Demonstration unmanned aerial vehicle (UAV) research platform. The endurance of 75 minutes with electric propulsion and high payload ratio and modularity is unique in its class. During its mission the air vehicle is autonomously guided by an autopilot that EQORTKUGUVJGƅKIJVEQPVTQNU[UVGOCPF an integrated navigation system which provides inertial, magnetic and air data for VJGƅKIJVEQPVTQNEQORWVGT4GFWPFCPE[ is given for most of the electric and Propeller performance testing electro-mechanical systems in order to achieve a high safety standard. Testing of aircraft concepts and single systems are core research tasks at the Institute for Aircraft Design. Test facilities are established to test, among others, motors, propellers, integrated jet pro- pulsion systems, fuel cell systems and actuation systems. The institute operates an UAS research RNCVHQTOVQRGTHQTOKPƅKIJVVGUVKPIQHPQXGN system concepts and mission systems. The IMPULLS (Innovative Modular Pay- NQCF7#5s..5 U[UVGOKUCƄZGFYKPI Research UAS: IMPULLS Institute of Aircraft Design 105 Air Transport Fleet Development and Environmental Assessment the noise impact is a key criterion for the required capacity increase of the air transport system. The Institute of Aircraft &GUKIPKFGPVKƄGUVJGPQKUGUQWTEGUQH current aircraft and discusses main drivers CPFKPƅWGPEGUQHCKTETCHVFGUKIPEJCTCE- teristics on noise emission, all aiming at the question: How can we reduce the Novel aircraft concept for high #XKCVKQPJCUFGƄPGFCODKVKQWUVCTIGVU PQKUGKORCEVQHCXKCVKQP!(QTGZCORNGKP capacity short range operations for the reduction of the environmental CPKPFWUVT[RTQLGEVVJGGZRGEVGFITQWPF impact of air transport. A comprehensive noise of a future propeller-driven aircraft methodology for the development and during an early conceptual design stage assessment of future aircraft technologies was estimated. has been elaborated at the institute to In order to reduce noise pollution in the determine the impact new technologies vicinity of airports, a variety of different have at system-wide level, i.e., conside- operational procedures, infrastructural TKPIVJGINQDCNCKTVTCPURQTVƅGGV9KVJ RQUUKDKNKVKGUCPFQHƄEKCNKPUVTWOGPVU the help of scenario-planning techniques, capable of reducing noise are compared. multiple future scenarios are created that In this, new operational procedures FGƄPGCNVGTPCVKXGFGXGNQROGPVRCVJUQHCNN enabling the reduction ground noise, so important regional markets in commercial called noise abatement procedures (NAP), air transport. The core principle of the are simulated not only for single types technology assessment methodology QHCKTETCHVDWVQPGPVKTGCKTETCHVƅGGVU is a mathematical simulation model of %CNEWNCVKQPUEQPƄTOVJGUKIPKƄECPVRQVGP- VJGINQDCNCKTNKPGTƅGGVVJCVKUECRCDNG VKCNQHOQFKƄGFCRRTQCEJCPFFGRCTVWTG of dynamically calculating the time- and procedures when aiming for reduced OCTMGVURGEKƄEƅGGVUK\GEQORQUKVKQP community noise. and age distribution, while taking into As boundary conditions for the global air account the market conditions stipulated transport sector are sensitive to global D[VJGRTGFGƄPGFHWVWTGUEGPCTKQU and regional developments and trends, Preliminary results of the research regular scenario studies are performed project have led to the creation of a new between industry and the Institute of high-capacity turboprop aircraft concept Aircraft Design. Combining students and that is designed to serve quickly growing GZRGTVUCNNQYHQTCVJQTQWIJCPCN[UKUQH short-range markets (e.g. in China) while future developments and the derivation UKIPKƄECPVN[TGFWEKPIGPGTI[EQPUWORVKQP of impacts and ways of action for the per passenger transported. different aviation stakeholders. CO2 emissions and the noise impact are During the spring months of 2014, stu- OCKPGPXKTQPOGPVCNHCEVQTUKPƅWGPEKPIVJG FGPVUCNQPIUKFGYKVJKPFWUVT[GZRGTVUHTQO future development of aviation. Especially Airbus, Bauhaus Luftfahrt, Airbus Group Innovation, Munich Airport, and TrendOne joined forces to perform a scenario study under the supervision of the Institute of Aircraft Design. This year’s study ‘Virtua- NK\CVKQPQH#KT6TCPURQTV oKFGPVKƄGF possible crucial changes within the future aviation system and revealed resulting consequences for the different Students of the stakeholders. 2014 scenario process 106 Institute of Aircraft Design UAS Aircraft Design %QWRNKPIVJG#KTETCHV&GUKIP$QZYKVJ simulation capabilities does provide all means to evaluate mission performance of an integrated UAS taking also mission sensor performance into consideration. 4GFWEVKQPQHVJGCEQWUVKEHQQVRTKPVQH7#5 is a clear task for UAS. This is achieved through: A propeller design environment with inherent noise analysis using in-house generated wind-tunnel data as well as Simulated UAS mission utilizing an optical sensor KPƅKIJVPQKUGOGCUWTGOGPVU 2TQRWNUKXGEQPƄIWTCVKQPUUVWFKGUEQO- The design of unmanned air systems prise investigations of propeller installation (UAS) or remotely piloted air systems effects on the aeroacoustic behavior of the 42#5 HGCVWTGUCXGT[ENQUGEQWRNKPI aircraft including airframe noise shielding. of the key mission requirements, the +FGPVKƄECVKQPQHCEQWUVKEHQQVRTKPVUQH respective mission sensor suite and the 7#8UD[OGCPUQHOQFGNDCUGFKPƅKIJV performance capabilities of the air vehicle. measurements is enabling highly accurate The Institute for Aircraft Design integrates multidimensional noise models that all disciplines in a consistent, computer- consider power rating, directivity of the aided design process. emissions, distance and atmospheric Integrated air vehicle design does require CVVGPWCVKQP9JKNGQTKIKPCNN[FGXGNQRGF a consistent data management approach HQTKPƅKIJVOGCUWTGOGPVUVJGOGVJQF HQTMG[FGUKIPFCVC9KVJKPVJGKPVGITCVGF also allows enhanced mission planning design environment ADEBO (Aircraft considering sensor and noise footprint. &GUKIP$QZ CPQXGNFCVCOQFGNJCUDGGP Advanced aircraft performance might be established for an improved MatLab achieved through novel control system, implementation. The novel data model like thrust vectoring devices and active ADDAM does now allow for a consistent ƅQYEQPVTQNQHVJGYKPI0GYEQPEGRVU data management of alternative aircraft are designed, validated and tested to designs in one design setup. identify the potential for highly agile UAS. Novel control systems for agile UAS Institute of Aircraft Design 107 Research Focus Management ■ Szenario- and future analysis Univ.-Prof. Dr.-Ing. Mirko Hornung, ■ Aircraft design Director ■ Analysis & evaluation of aircraft Prof. h.c. Dr.-Ing. Dr. h.c. Dieter Schmitt, concepts Emeritus Prof.-Ing. Gero Madelung, Emeritus Competence ■ Szenario technique Adjunct Professors ■ Aircraft design (manned/unmanned, &KRN+PI#ZGN$GEMGT military & civil) ■ Aircraft integration and realisation Administrative Staff (UAVs, prototypes) Natalie Gulotta ■ Propulsion integration, electrical and hybrid propulsion systems Research Scientists ■ Operational assessment: noise, airport &T+PI%JTKUVKCP4Ò»NGT capacity, cost Dipl.-Ing. Lykourgos Bougas Dipl.-Ing. Jens Feger Infrastructure Dipl.-Ing. Ekaterina Fokina ■ Integrated aircraft design environment Sebastian Herbst, M.Sc. ■ Laboratory for demonstrator aircraft Dipl.-Ing. Thomas Lampl ■ 'ZRGTKOGPVCN7#5 GI+/27..57#8 &KRN+PI0KENCU4CPFV ■ Mission simulation Dipl.-Ing. Christoph Schinwald ■ Airport simulation Dipl.-Ing. Sebastian Speck Dipl.-Ing. Korbinian Stadlberger Courses Dipl.-Ing. Joachim Sturm ■ Fundamentals in Aeronautics (jointly &KRN+PI(GNKZ9KNN with the Institute of Helicopter Techno- logy) Technical Staff ■ Aircraft Design John Lewis ■ Operational Aspects of Aviation Practical Courses ■ Aviation Scenarios, Technology Evaluation ■ CAD in Aircraft Design ■ Aircraft Design 108 Institute of Aircraft Design Publications 2013-14 ■ 024CPFV 2GTURGEVKXGUQH6WTDQRTQR#KTETCHV # ■ S. Speck, M. Hornung: Methoden zur Bewertung Stakeholder-oriented Evaluation Using Scenario und Minimierung der Signatur von unbemannten 2NCPPKPI&GWVUEJGT.WHVWPF4CWOHCJTV- (NWI\GWIGP&GWVUEJGT.WHVWPF4CWO- kongress, 16-18 September 2014, Augsburg, fahrtkongress, 10-12 September 2013, Stuttgart, Deutschland Germany ■ 024CPFV59QNH #WVQOCVKQPKP#KT6TCPURQTV ■ 04CPFV (QWPFCVKQPUQHC6GEJPQNQI[#UUGUUOGPV #5EGPCTKQDCUGF#RRTQCEJVQVJG&GƄPKVKQPQH Technique Using a Scenario-Based Fleet System 1RGTCVKQPCN4GSWKTGOGPVUVJ%QPITGUUQHVJG Dynamics Model, AIAA Aviation 2013: 13th Aviation International Council of the Aeronautical Sciences, Technology, Integration, and Operations Conference s5GRVGODGT5V2GVGTUDWTI4WUUKC (ATIO), 12-14 August 2013, Los Angeles, USA ■ 5*GTDUV#-NÒEMPGT &GUKIPFTKXGTUQH*[DTKF ■ S. Speck, M. Hornung: An Approach for Aero- Mission Scenarios: Effects on Unmanned Aerial acoustic Footprint-Modeling of Low Altitude 8GJKENG&GUKIPCPF/KUUKQP/CPCIGOGPV9QTNF Platforms by Means of Time Domain System Congress on Unmanned System Engineering +FGPVKƄECVKQP#+###XKCVKQP VJ#XKCVKQP 9%75'PI ,WN[#WIWUV1ZHQTF7- Technology, Integration, and Operations Conference ■ L. Bougas, M. Hornung: Propulsion integration and (ATIO), 12-14 August 2013, Los Angeles, USA ƅKIJVRGTHQTOCPEGGUVKOCVKQPHQTCNQYQDUGTXCDNG ■ )²VVN 4GRTGUGPVCVKXGVTCHƄEUKVWCVKQPUHQTCKT ƅ[KPIYKPIFGOQPUVTCVQT%'#5#KT5RCEG VTCPURQTVVGEJPQNQI[GXCNWCVKQP9QTNF%QPHGTGPEG %QPHGTGPEG5GRVGODGT.KPMÒRKPI QP6TCPURQTVCVKQP4GUGCTEJ 9%64 ,WN[ Sweden 4KQFG,CPGKTQ$TC\KN ■ 024CPFV55CTVQTKWU/7TDCP 4GSWKTGOGPVU ■ J. Schoemann and M. Hornung: Design of and Concepts of Operations for a Personalized Air Hybrid-Electric Propulsion Systems for Small Transport System in 2050, 52. Aerospace Sciences Unmanned Aerial Vehicles, 5th European Meeting (AIAA SciTech 2014), 13-17 January 2014, Conference for Aeronautics and Space Sciences National Harbor, USA (EUCASS), 01-04 July 2013, Munich, Germany ■ /+YCPK\MK024CPFV55CTVQTKWU 2TGNKOKPCT[ ■ 024CPFV-2NÒVPGT%,G»DGTIGT#$GEMGT #KT Design of a Heavy Short- and Medium-Haul Turbo- 6TCHƄE)TQYVJ'PGTI[CPFVJG'PXKTQPOGPV prop-Powered Passenger Aircraft, 52. Aerospace Drivers, Challenges, and Opportunities for Aviation, Sciences Meeting (AIAA SciTech 2014), 13-17 VJ#6459QTNF%QPHGTGPEG,WPG January 2014, National Harbor, USA Bergamo, Italy ■ 04CPFV)²VVN #RRNKGF5EGPCTKQ2NCPPKPICUC Basis for the Assessment of Future Aircraft Techno- NQIKGU&GWVUEJGT.WHVWPF4CWOHCJTVMQPITGUU 10-12 September 2013, Stuttgart, Germany ■ -&$ØEJVGT04CPFV %CRCEKV[UECNKPIKP airborne communication networks based on air VTCHƄEUEGPCTKQOQFGNKPI&GWVUEJGT.WHVWPF 4CWOHCJTVMQPITGUU5GRVGODGT Stuttgart, Germany Institute of Aircraft Design 109 Flow control and Aeroacoustics Group 0WOGTKECNCPFGZRGTKOGPVCNUVWF[QHƅQYCPFUQWPFƄGNFUCPFVJGKTEQPVTQN ■ The focus of the research group in 2013-14 was the development and VGUVKPIQHTGUGCTEJVQQNUHQTVJGPWOGTKECNRTGFKEVKQPQHƅQYCPFUQWPF ƄGNFUCPFHQTVJGKTXCNKFCVKQPKPYKPFVWPPGNGZRGTKOGPVU A highlight was the establishment of the EPFL and the design, manufacturing and EUROTECH-Greentech cooperation on testing of a 1:300 scale model of a wind wind energy with partners from DTU and turbine. Sound Radiation from a One-stage Rotor-stator Prof. Dr.-Ing. %QPƄIWTCVKQP5WDLGEVVQ%TQUU(NQY *CPU,CMQD-CNVGPDCEJ This study aims at understanding the role Contact QHKPƅQYFKUVQTVKQPQPVJGIGPGTCVKQPQH tonal noise in turbomachines. For this www.aer.mw.tum.de Hans-Jakob.Kaltenbach RWTRQUGCIGPGTKEEQPƄIWTCVKQPEQPUKUV @tum.de ing in a 4-bladed rotor and a 4-bladed Phone +49.89.289.16397 UVCVQTKUOQWPVGFKPCƅCVRCVGUWDLGEVVQ CVCPIGPVKCNUVTGCO6JGHCTƄGNFUQWPF above the rotor is predicted with a hybrid approach combining a URANS-model are compared with measurements in the QHVJGƅQYƄGNFCPFCPKPVGITCNUQNW- aeroacoustic wind tunnel (AWB) of DLR tion of the Lighthill equation using the Braunschweig that were obtained for diffe- Ffowcs-Williams Hawkings solver SpySi rent inlet lip geometries. developed by the group of Prof. S. Becker at the University of Erlangen. Predictions Self-noise from Splitter Attenuators KP.CTIG+PFWUVTKCN'ZJCWUV5VCEMU Splitter attenuators are used in a wide DCPFUQWTEGUCTGQDVCKPGFVJTQWIJƅQY range of applications, including high-end modeling via large-eddy simulation using silencers for power generation systems. the compressible mutli-block CFD solver With the upstream noise reduced to ever 05/$6JGHCTƄGNFUQWPFKURTGFKEVGF lower levels, the effect of the self-noise with the Ffowcs-Williams Hawkings solver generated by the splitter itself – as a bluff SpySi developed in the group of Prof. Ste- DQF[KOOGTUGFKPVJGƅQYsDGEQOGU fan Becker at the University of Erlangen. critical for the overall performance of the silencing system. A combined experimen- Projects tal and numerical study on the acoustic Marie-Curie Initial Training Network optimization of the splitter trailing edge is ‘FlowAirS’ Silent Air Flows in transport, carried out under laboratory conditions in buildings and power generation. Subpro- scale 1:3. Different trailing edge shapes ject ‘LES of exhaust gas systems’ and including tapered and serrated extensions ‘Aeroacoustics of noise reducing devices have been tested. Only moderate changes for power plant applications’. in the measured noise have been found, despite a reduction of the total pressure loss that can be achieved by appropriate design of the splitter trailing edges. Numerical predictions of the broad 110 Flow control and Aeroacoustics Group /QFGNNKPIQH9KPF6WTDKPG9CMG+PVGTCEVKQP and quantitative prediction of the mean ƅQYCPFVWTDWNGPEGRTQRGTVKGUKPVJG wake for different terrain conditions respectively surface roughness. Towards this goal experiments are carried out on a 1:300 scale wind turbine model in the atmospheric boundary layer wind tunnel of TUM. Roughness elements on the YKPFVWPPGNƅQQTCTGCFLWUVGFKPQTFGT to model different terrain. The numerical modelling consists in the implementation of the actuator line representation of the In a wind farm setting with several wind blade in the large-eddy simulation code turbines operating close to each other INCA developed by Dr. S. Hickel from the interaction of the wake generated the Institute of Aerodynamics and Fluid by a wind turbine with the turbulence in Mechanics. the atmospheric boundary layer affects DQVJVJGGHƄEKGPE[CPFVJGNQCFURGEVTWO Projects experienced by the downstream turbines. IGSSE project EUROTECH-greentech This project aims at better understanding 03-Wind. 4GUGCTEJ(QEWU Management ■ Numerical prediction of generation and Prof. Dr.-Ing. Hans-Jakob Kaltenbach RTQRCICVKQPQHƅQYKPFWEGFPQKUG ■ Flow control with focus on suppression Administrative Staff QHƅQYUGRCTCVKQPCPFPQKUGOKVKICVKQP Angela Grygier (secretary of the Chair of ■ Self-noise of splitter attenuators Aerodynamics) ■ Wake interaction of wind turbines 4GUGCTEJ5EKGPVKUVU Competence Jithendra Tirakala, M.Sc. ■ 0WOGTKECNRTGFKEVKQPQHƅQYCPFUQWPF Konstantin Vachnadze, M.Sc. ■ 'ZRGTKOGPVCNKPXGUVKICVKQPQHƅQYCPF Dipl.-Ing. Victor Stein (neu in 2013) UQWPFƄGNFU Cecilia Sebastiani, M.Sc. (External candidate) Infrastructure ■ Usage of wind-tunnel at the institute of CGTQF[PCOKEUCPFƅWKFOGEJCPKEU ■ Test set-up of a microphone array Courses 2WDNKECVKQPU ■ Continuum Mechanics (MSE), 50% ■ ■ Grundlagen der numerischen Strö- W. Jürgens , H.-J. Kaltenbach: The effect of sweep QPVJGHQTEGFVTCPUKVKQPCNƅQYQXGTCDCEMYCTF mungsmechanik facing step, Computers & Fluids, vol 59, 2012, ■ Aeroakustik RR| ■ ■ W. Jürgens , H.-J. Kaltenbach: Control of a 5VTÒOWPIUDGGKPƅWUUWPI three-dimensional turbulent shear-layer by means of ■ Numerische Strömungsakustik oblique vortices. In preparation. ■ Praktikum Numerische Strömungssi- mulation Flow control and Aeroacoustics Group 111 Institute of Plant and Process Technology Modelling and simulation of chemical processes, equipment design, thermodynamic property data ■ In 2013-14 the focus of the research of the Institute of Plant and Process Technology was the GPGTI[GHƄEKGPVFGUKIPQHEJGOKECN production processes as well as KPPQXCVKXGFGUKIPOGVJQFUHQT RTQEGUUGSWKROGPV(WTVJGTOQTG besides the already established VJGQTGVKECNCPFRTGFKEVKXGEQO- RWVCVKQPQHVJGTOQF[PCOKECPF Prof. Dr.-Ing. VJGTOQRJ[UKECNRTQRGTV[FCVCYKVJ Harald Klein %15/145VJGJKIJRTGUUWTG GZRGTKOGPVCNVGUVTKIHQTOGCUW- Contact TGOGPVQHRJCUGGSWKNKDTKCYCU www.apt.mw.tum.de EQOOKUUKQPGFCVVJG+PUVKVWVGQH [email protected] 2NCPVCPF2TQEGUU6GEJPQNQI[ Phone +49.89.289.16501 A highlight was the commissioning of the packed column (1.2 m diameter). This test stand enables the Institute of Plant and Process Technology to perform experi- ments of gas-liquid contacting equipment in semi-industrial scale. 2CEMGFEQNWOPVGUVTKI OFKCOGVGT Process Design Gas phase (g) Aqueous liquid phase (aq) process of dimethyl-ether (DME, which Organic liquid phase (org) Three-phase state (aq,org,g) can serve as future diesel substitute) Condenser CO2-rich gas CO2-lean flue gas was investigated and optimized. Another Makeup highlight was optimization of the CO2 dis- (H2O, MEA) Separator solution into open algae ponds where fuel KURTQFWEGFD[OQFKƄGFCNICGURGEKGUQWV Absorber Desorber of CO2, brackish water and sunlight. For Makeup (Hydrocarbon) post-combustion capture (PCC) of CO2 COQFKƄGFTGIGPGTCVKQPRTQEGUUQHVJG Flue gas Reboiler loaded solvent was investigated and opti- Rich solvent Lean solvent mized considering the complete process KPENWFKPIVJGEQCNƄTGFRQYGTRNCPVCPF (NQYUJGGVQHCDUQTRVKQPRTQEGUU the CO2 compression. HQT%1TGOQXCNHTQORQYGTRNCPV ƅWGICUGU The utilization of CO2 as feedstock for Projects large scale chemical production pro- ■ Integrierte Dimethylethersynthese aus cesses is possible in the synthesis gas Methan und CO2 – DMEEXCO2 (BMBF) generation step of many state of the art ■ Untersuchung zum Effekt von processes. Besides that, in the future CO2 Strippkomponenten bei Absorptions- separation as well as integrated energy prozessen zur CO2-Abtrennung aus GHƄEKGPVRTQEGUUFGUKIPECPEQPVTKDWVGVQ Kraftwerksrauchgasen ■ CUKIPKƄECPVTGFWEVKQPQH%12 emission to Mass transfer of CO2 in open algae the atmosphere. The one-step synthesis ponds 112 Institute of Plant and Process Technology Equipment Design Methods Equipment design becomes more and new column with 1.2 m diameter at the more important for enhancement of the institute. Bubble columns provide large GPGTI[GHƄEKGPE[QHRTQEGUUGU*GCVGZ interfacial areas for chemical reactions. changers are the most employed apparatus 1RGTCVKQPQHCOQFKƄGFDWDDNGEQNWOPKU in the chemical industry. Innovative design performed at the institute for investigation can increase transfer rates and thus enable of possibilities to enhance capacity of a better heat integration in processes such apparatus. which leads to a reduction of CO2 exhaust. 6JGTGHQTGVJGWVKNK\CVKQPQHNQYƄPPGFVWDGU Projects for condensation of mixtures of hydrocar- ■ Innovative Apparate- und Anlagen- Condensation on a bundle of bons was investigated. konzepte zur Steigerung der Energie- ƄPPGFVWDGU Upcoming processes like post-combustion GHƄ\KGP\XQP2TQFWMVKQPURTQ\GUUGP capture (PCC) of CO2 require much bigger -!nnovA2 (BMBF) equipment than conventional processes. ■ Zellenmodell zur Auslegung von A model for dimensioning mass transfer Packungskolonnen und Flüssigkeits- columns, based on CAD-data of packing verteilern (BFS) elements, is developed and tested in a ■ Betrieb von Blasensäulen Modelling and Thermodynamic Property Data In 2013 the high pressure phase equilibria test stand was successfully commissioned at the Institute of Plant and Process 6GEJPQNQI[#UCƄTUVGZCORNGVJG system methanol-CO2 was experimentally investigated and data which is consistent with literature could be obtained and will be published in 2015. A new test stand for measurements of permeabilities through polymer mem- *KIJRTGUUWTGRJCUGGSWKNKDTKWONCDQTCVQT[ branes was assembled at the Institute of Plant and Process Technology in close Based on quantum chemical simulations cooperation with an industrial car manu- and statistical thermodynamics predictive HCEVWTGTVQKPXGUVKICVGJWOKFKƄECVKQPQHCKT computation of thermodynamic and ther- supply for fuel cells. mophysical property data was performed with the method COSMO-RS for various Projects substances and mixtures at the Institute ■ Gruppenbeitragsmethode auf der Basis of Plant and Process Technology. A von COSMO-RS-ı2TQƄNGP powerful computer infrastructure provides ■ #WHDCWGKPGT*QEJFTWEM8..'2JCUGP the required computational resources. gleichgewichtsapparatur Thereby, an extension to the existing ■ Entwicklung eines Testaufbaus für program was implemented and tested in die Befeuchterentwicklung für PEM cooperation with the commercial software Brennstoffzellen supplier. Institute of Plant and Process Technology 113 Research Focus Management ■ Process design 2TQH&T+PI*CTCNF-NGKP&KTGEVQT ■ Equipment design methods Dr.-Ing. Sebastian Rehfeldt ■ Modelling and thermodynamic property data Emeritus Professors Prof. em. Dr.-Ing. Eckhart Blaß, Emeritus Competence Prof. Dr.-Ing. Johann Stichlmair, Emeritus ■ Process modelling and simulation /#6.#$7PKUKO&GUKIP#URGP2NWU Adjunct Professors ■ Experimental measurement of thermo- Dr.-Ing. Alexander Alekseev dynamic property data 2TQH&T+PI*CTCNF)TQ»OCPP ■ Predictive computation of thermodyna- mic property data Research Scientists ■ Experimental measurement of heat Dipl.-Ing. Alexander Büchner VTCPUHGTEQGHƄEKGPVU Tomas Cahalan, M.Eng. ■ Experimental measurement of maldis- Dipl.-Ing. Umberto Cardella tribution Dipl.-Ing. Regina Deschermeier ■ Pilot-scale investigations of apparatus Johannes Fendt, M.Sc. design methods (NQTKCP*CPWU/5E (CDKCP*ÒJNGT/5E Infrastructure Dipl.-Ing. Isabel Kiendl ■ *KIJRTGUUWTGRJCUGGSWKNKDTKWO Dipl.-Ing. Andreas Kossmann laboratory Andreas Rarrek, M.Sc. ■ Analytical laboratory Dipl.-Ing. Anna Reif ■ Distillation columns (pilot scale) Dipl.-Ing. Tobias Sachsenhauser ■ Condensers & evaporators (pilot scale) ■ Workshop Administrative Staff ■ Computer room Maria Anna Schmid Courses Technical Staff ■ Introduction to Process and Plant /CTKCP$ÒUYCNF Engineering Ralf Priller ■ Thermal Separation Principles I & II Danuta Styrnik ■ *GCVCPF/CUU6TCPUHGT ■ Process and Plant Engineering ■ Equipment Design ■ Process Design ■ Similarity and Dimensionless Numbers ■ .CD%QWTUGKP2TQEGUU'PIKPGGTKPI ■ Practical Course in Process Simulation ■ Principles of Refrigeration and Industrial .QY6GORGTCVWTG5[UVGOU ■ Paper Technology 114 Institute of Plant and Process Technology Publications 2013-14 ■ 4GKH# $ØEJPGT# 4GJHGNFV5 -NGKP* $GUVKO- ■ -QUUOCPP# /QUGT2 -NGKP* 5VWF[QHVJG mung des globalen, äußeren Wärmeübergangskoef- Effect of Stripping Components in Absorption Ƅ\KGPVGPDGKFGT-QPFGPUCVKQPXQP4GKPUVQHHGPCP Processes for CO2-Removal from Power Plant Flue einem horizontalen Rippenrohr, Chemie Ingenieur Gases, 2013 AIChE Annual Meeting, San Francisco, Technik, (in press) USA, 03-08.11.2013 ■ $ØEJPGT# 4GKH# 4GJHGNFV5 -NGKP* ■ Rehfeldt, S.; Sachsenhauser, T.; Schreiber, S.; Untersuchung der Kondensation von Reinstoffen an -NGKP|* 2TGFKEVKQPQH$KPCT[(KEM&KHHWUKQP einem horizontalen berippten Rohrbündel, Chemie %QGHƄEKGPVUWUKPI%15/1456JGTOQF[PCOKEU Ingenieur Technik, (in press) 2013, Manchester, UK, 03-06.09.13 ■ $ØEJPGT# 4GKH# 4GJHGNFV5 -NGKP* Institute of Plant and Process Technology 115 Continuum Mechanics Group Predictive computational modeling of materials ■ The focus of the Continuum Mechanics Group in 2013-14 was the development of novel models, methodologies and computational tools for quantifying uncertainties and their effect in materials simulation. In that respect our work has been directed towards 3 fronts: a) the cali- bration and validation of computational models using experimental data, b) uncertainty propagation in multiscale systems, c) Design/control/ optimization of complex systems under uncertainty. A highlight was the initiation of a project (Warwick University) who will be hosted on ‘Predicitive Materials Modeling’ by the Continuum Mechanics Group. On through the Institute of Advanced Study, the teaching front, Prof. Koutsourelakis Prof. Dr. Phaedon-Stelios TUM. This project will take place in received the Prize for Best Lecture by the Koutsourelakis the context of the Hans Fischer Senior MSE students’ union for the ‘Uncertainty Fellowship to Prof. Nicholas Zabaras Modeling in Engineering’ module. Contact www.contmech.mw.tum.de [email protected] Phone +49.89.289.16690 Nonlinear Inverse Problems with Applications in Medical Diagnostics This projects aims at addressing import- Our motivating application is biomaterials ant modeling and computational issues where several studies have shown that the associated with the integration of experi- KFGPVKƄECVKQPQHOCVGTKCNRCTCOGVGTUHTQO mental data with computational models. deformation data can lead to earlier and more accurate diagnosis of various patho- NQIKGU6JKURTQLGEVFGXGNQRUGHƄEKGPV computational tools that can lead not only to estimates of the material properties and their spatial variability but also to quan- VKH[KPIVJGEQPƄFGPEGKPVJQUGGUVKOCVGU due to the various sources of uncertainty. #UKIPKƄECPVTQNGKPVJKUGHHQTVKURNC[GFD[ novel dimensionality reduction techniques which can identify a sparse set of features. Reference Inferred posterior along diagonal 116 Continuum Mechanics Group 4GFWEGFQTFGT/QFGNKPIHQT7PEGTVCKPV[3WCPVKƄECVKQP Applications in Random Media As the physical problems become more complex and the mathematical models more involved, current computational OGVJQFURTQXGKPETGCUKPIN[KPGHƄEKGPV especially in contexts requiring numerous UQNWVKQPUCUKPWPEGTVCKPV[SWCPVKƄECVKQP VCUMU+PVJGNCVVGTECUGVJGFKHƄEWNV[KU HWTVJGTCORNKƄGFD[VJGNCTIGPWODGTQH Linear vs. nonlinear Reduced-basis construction input parameters (random variables). A particularly challenging example of this stic reduced-basis models. These consist involves the simulation of random media of mixtures of reduced-basis sets which where the description of the underlying CTGKFGPVKƄGFD[CNKOKVGFPWODGTQH microstructure requires thousands of ran- full-scale runs and can identify the most dom variables and frequently necessitates important features of the input as well as the employment of multiscale techniques. the various response regimes associated This project aims at developing probabili- with them. Stochastic Topology Optimization Topology optimization is a well-establish- ed discipline in engineering design which is concerned with the appropriate com- bination of two or more material phases in order to achieve optimal aggregate behavior. Despite the development of mature computational tools, much less attention has been directed to problems Deterministic optimum Stochastic optimum where uncertainty in the material pro- RGTVKGUKURTGUGPV5KOKNCTFKHƄEWNVKGUCTG number of random and design variables. encounter ed in many other areas of mate- They are based on a reformulation of rial design where decision-making under the associated stochastic optimization uncertainty is sought. This project aims problem as well as the development at developing appropriate computational of variational approximation tools for tools that can handle systems with a large identifying lower-dimensional solution subspaces. Continuum Mechanics Group 117 Research Focus Management ■ 7PEGTVCKPV[SWCPVKƄECVKQP Prof. Dr. Phaedon-Stelios Koutsourelakis, ■ Random media Director ■ Multiscale formulations ■ Inverse problems Administrative Staff ■ Design/optimization under uncertainty Karakus Cigdem Competence Research Scientists ■ Computer simulation Dipl.-Ing. Isabell Franck ■ Mathematical modeling of stochastic Michael Kraus, M.Sc. systems Markus Schoeberl, M. Sc. Infrastructure ■ 256core HPC Courses Master ■ Atomistic Modeling of Materials (WS) ■ Bayesian Strategies for Inverse Prob- lems (SS) MSE ■ Continuum Mechanics (WS) ■ Uncertainty Modeling in Engineering (SS) Publications 2013-14 ■ I. Franck, P.S. Koutsourelakis. Sparse Variational Bayesian Approximations for Nonlinear Inverse Problems: applications in nonlinear elastography, Comp. Meth. Appl. Mech. Eng., submitted 2014. ■ P.S. Koutsourelakis. Optimization in the Presence of Uncertainty: Applications in Designing Random Heterogeneous Media. SIAM CSE, 2013. ■ I. Franck, P.S. Koutsourelakis. Variational Bayesian Approximations for Nonlinear Inverse Problems. SIAM UQ, 2014. ■ P.S. Koutsourelakis. High-dimensional optimization in the presence of uncertainty. Numerical Methods HQT7PEGTVCKPV[3WCPVKƄECVKQP*CWUFQTHH%GPVGT Bonn, 2013. 118 Continuum Mechanics Group Systems Biotechnology Group Model based metabolic engineering for bacterial systems ■ Systems Biotechnology combines methods from engineering sciences, microbiology and computational sciences to improve biotechnological processes. In 2013-14 the group expanded its activities with a number of new projects funded by DFG and BMBF. The available wet and dry laboratory space is now extensively used for applications in model-based metabolic engineering. A highlight was the publication of the set up (stochastic and deterministic), English textbook ‘Systems biology model analysis (time scales, sensitivities, – mathematical modeling and model control structures) and applications analysis’ which appeared in October 2013 especially for bacterial systems. Exercises with Chapman & Hall/CRC Press. The as well as numerical software to solve the Prof. Dr.-Ing. book is for graduate students with basic TGURGEVKXGGSWCVKQPU[UVGOUYKVJ/CVNCD Andreas Kremling knowledge in mathematics and microbio- are also provided. logy and covers main aspects of model Contact www.biovt.mw.tum.de/ fg-systembiotechnologie [email protected] Fundamentals for Experimental Analysis and Phone +49.89.289.15761 Mathematical Modeling of Cellular Networks Regulation of transcriptional and bio- chemical processes in a bacterial cell is essential for surviving in changing environmental conditions and understand- ing of the events taking place is pivotal for using bacteria in industrially interesting applications. Research of the systems biotechnology group targets different key regulatory devices, like the phosphotrans- ferase system in Pseudomonas putida or the ComRS two component system in Streptococcus mutans. The experimental information derived either in the group’s own laboratory or by collaboration partners give rise to mathematic models that contribute to a better understanding of cellular processes. population-based variations in the overall Another research focus lies on the process. establishment of a co-culture between a photosynthetically active organism Projects extruding sugar molecules together with ■ G DKQƄNO$/$(G $KQKPKVKCVKXG TGIWNC- heterotrophic organisms capable of pro- VQT[KPƅWGPEGQHVJG265QPRJ[UKQNQI[ ducing industrially interesting compounds. and biotechnological production with P. To this end a photobioreactor is employed RWVKFC&() which allows cultivation and collection of a vast amount of data used to describe the Systems Biotechnology Group 119 Metabolic Engineering of Halophiles, towards Halomonas elongata as Industrial Producer is a highly soluble organic molecule that belongs to the group of compatible solu- tes and is found as an osmotic agent in a wide range of cell types and has also been shown to stabilize and protect macromo- lecules in adverse conditions. The current applications of ectoine cover a wide TCPIGQHFKHHGTGPVƄGNFUNKMGDKQOGFKEKPG cosmetics, support roles in analytic and industrial processes and bioremediation. The project focuses on ectoine production by the halophilic bacterium Halomonas Projects elongata. The reasons for that choice are ■ OPHELIA - optimization of halomonas not only the interest of ectoine as a novel elongate for industrial applications, product for medicine and cosmetics but $/$(G $KQKPKVKCVKXG also the potential of H. elongata for further biotechnological applications. Ectoine Metabolic Engineering of Escherichia coli, Combing Synthetic and Systems Biology Escherichia coli is the organism of choice butions and optimal intervention strategies for basic research in biotechnology due are determined that makes the processes to the possibility for genetic alterations OQTGGHƄEKGPV as well as its simple culture conditions. In two projects together with experimental Projects RCTVPGTUHTQOFKHHGTGPVRNCEGUKP/WPKEJ ■ DynOpt - dynamic process optimization CPF)GTOCP['EQNKKUWUGFHQTVJG KPDKQVGEJPQNQI[$/$(DKQVGEJPQNQI[ production of chemical bulk components KPKVKCVKXG 5[U$KQ6GTRsKPQXCVKXG or interesting precursors for medical strategies for a sustainable production CRRNKECVKQPU$CUGFQPIGPQOGUECNG QHDKQCEVKXGOQNGEWNGU$/$(G $KQ OCVJGOCVKECNOQFGNUQRVKOCNƅWZFKUVTK- initiative 120 Systems Biotechnology Group Research Focus Management ■ /CVJGOCVKECNOQFGNKPIQHEGNNWNCT Prof. Dr.-Ing. Andreas Kremling, Director systems ■ /QFGNCPCN[UKU Administrative Staff ■ /QFGNDCUGFOGVCDQNKEGPIKPGGTKPI Susanne Kuchenbaur ■ Experimental design Research Scientists Competence &T#NDGTVQ/CTKP5CPIWKPQ ■ /QFGNNKDTCT[HQTFKHHGTGPVOQFGN &T-CVJCTKPC2ƅØIGT)TCW systems (metabolic modules, gene Dr. Dagmar Rother expression modules, signaling modu- %JTKUVKCPC5GJT/5E les) 8KMVQTKC-KPF\KGTUMK/5E ■ Design space analysis &KRN6GEJ/CVJ#NGZCPFTC+QXMQXC ■ Time hierarchy analysis *CPPGU.ÒYG/5E ■ Process design /KIWGN8CNFGTTCOC/5E 5C[WTK*CJN/5E Infrastructure ■ S1 – laboratory (allows work with Technical Staff IGPGVKECNN[OQFKƄGFUVTCKPU &KRN+PI (* #FTKCP4CWUEJGPDCEJ ■ Photo-bio-reactor system ■ Standard bio-reactor system ■ Tecan reader Courses HQT/CUVGTn+PFWUVTKCN$KQVGEJPQNQI[o /5' ■ #RRNKGF/CVJGOCVKEU ■ /QFGNKPIQH%GNNWNCT5[UVGOU ■ Analysis and Design of Cellular Systems ■ 1RVKOK\CVKQPKP$KQVGEJPQNQI[ ■ &CVC#PCN[UKUCPF5VCVKUVKECN/QFGNU ■ Exercises in Simulation Studies in $KQVGEJPQNQI[ Publications 2013-14 ■ %JCXCTTÉC/(WJTGT65CWGT72ƅØIGT)TCW Reviews K. & de Lorenzo, V.: Cra regulates the cross-talk ■ -TGONKPI#5CG\4QFTKIWG\, 5[UVGOU$KQNQI[ between the two branches of the phosphoenolpyru- sCPGPIKPGGTKPIRGTURGEVKXG,$KQVGEJPQNQI[ vate:phosphotransferase system of Pseudomonas 129(2), 329-351 (2007) RWVKFC'PXKTQP/KETQDKQNs ■ 2ƅØIGT)TCW-)ÒTMG$ 4GIWNCVQT[TQNGUQH ■ 4QFTKIWG\(GTPCPFG\/4GJDGTI/-TGONKPI the bacterial nitrogen-related phosphotransferase #$CPIC, 5KOWNVCPGQWUOQFGNFKUETKOKPCVKQP U[UVGO6TGPFUKP/KETQDKQNQI[ and parameter estimation in dynamic models of ■ -TGONKPI#)GKUGNOCPP,4QRGTU&FG,QPI EGNNWNCTU[UVGOU$/%5[UVGOU$KQNQI[ * 7PFGTUVCPFKPIECTDQPECVCDQNKVGTGRTGUUKQPKP ■ *GGTOCPP4 Systems Biotechnology Group 121 Biomechanics Group Mechanics and permeability of biological (hybrid-)materials ■ The mission of the biomechanics group is to 1. discover new, to date unknown material properties of biopolymer materials; 2. identify the microscopic principles that govern those material properties (mechanics, permeability); 3. apply those principles to synthetic polymers to create biomimetic materials for biomedical applications. The studied biomaterials range from existing and novel biopolymer-based very soft gels such as vitreous humor materials and to test their applicability for and mucus to stiff tissues such as biomedical or industrial purposes. Prof. Dr. Oliver Lieleg cartilage. Accordingly, a broad variety of Highlights in the year 2014 were the characterization methods is used in the development of a thermoresponsive Contact Biomechanics Group. Biomedical ques- wound gel with autogelation properties tions addressed include tattoo removal, and the generation of an engineered www.imetum.tum.de/ forschung/biologische- prevention of microbial infection and hybrid-mortar material with water-repellent hydrogele/allgemein reduction of wear in osteoarthritis. properties. We now aim to further opti- [email protected] Phone +49.89.289.10952 In our highly interdisciplinary projects, we mize both materials, test them in realistic work together with chemists, pharma- settings and launch corresponding patent cists, physicists and medical researchers applications. to generate, characterize and optimize Biological Hydrogels as Selective Diffusion Barriers Biological hydrogels such as the extracel- lular matrix or mucus allow only certain particles or molecules to pass. Many other particles including many pathogens are trapped in the hydrogel matrix and thus prevented from penetrating the hydrogel DCTTKGT7UKPIƅWQTGUEGPEGOKETQUEQR[ with high temporal resolution, we aim at deciphering the underlying physical prin- EKRNGUVJCVGUVCDNKUJUGNGEVKXGƄNVGTKPIKP biological hydrogels. We use reconstituted model systems whose composition we are able to precisely control. Projects ■ DFG LI1902/3-1 biological hydrogels as diffusion barriers ■ SFB 1032 nanoagents in 3-dimensional biopolymer hydrogels 122 Biomechanics Group Hydrogels as Protective Shields towards Infection the wound gel we are engineering needs to possess well-tailored viscoelastic properties. We also embed nanoparticles for a controlled and prolonged release QHFTWIUVJCVDGPGƄVVJGYQWPFJGCNKPI process. In the long run, we aim at replac- ing the biological component by (semi-) synthetic polymers. Project 9GCKOCVKPVGITCVKPIRWTKƄGFOWEKPDKQ- ■ Dean’s Innovation Fond optimized polymers into other polymeric materials RWTKƄECVKQPQHCPVKXKTCNDKQRQN[OGTU to harness the anti-viral and anti-bacterial (mucin glycoproteins) from the mucosa properties of mucins. For this application, of pig stomachs /CVGTKCN2TQRGTVKGUQH$CEVGTKCN$KQƄNOU Bacteria secret a broad range of biopo- lymers which form a protective matrix around the prokaryotes. This community of biopolymers and bacteria is referred VQCUCDKQƄNOCPFEQPUVKVWVGUCUGXGTG issue in industry and medicine. We aim at quantifying the material properties of DCEVGTKCNDKQƄNOUYJKEJKPENWFGUVJGKT Projects mechanics, self-mending abilities and ■ SFB 863 mechanics of bacterial water-repellent surface properties to DKQƄNOU develop new strategies for the removal of ■ %G05OGEJCPKUOUQHDKQƄNOHQTOCVKQP DKQƄNOUHTQOUWTHCEGU Cartilage and Cartilage Substitute Materials cartilage. By exploiting loss and gain of function experiments, we aim to under- stand what molecular components are responsible for the outstanding mecha- nical properties of cartilage. In a second step we then try to develop suitable cartilage surrogate materials. Project In the framework of the IGSSE focus ■ IGSSE lubrication, recovery and ageing area ‘Biomaterials’ we are studying the in native cartilage and cartilage sub- bulk and tribological properties of native stitutes - LURACS Biomechanics Group 123 Research Focus Courses ■ Biological (hybrid-)materials ■ Microscopic Biomechanics ■ Cartilage and cartilage surrogate ■ Experimental Techniques for the materials Characterization of Biomaterials ■ Biological hydrogels as selective ■ Design Principles in Biomaterials diffusion barriers ■ Engineering Solutions for Biomedical ■ /CVGTKCNRTQRGTVKGUQHDCEVGTKCNDKQƄNOU Problems ■ Medical applications of nanoparticles ■ Lab Course in Cell Cultivation Methods ■ Biophysics Lab Course for Biochemis- Competence try Students ■ Rheology, tribology ■ /KETQƅWKFKEUFKHHWUKQPOGCUWTGOGPVU Management ■ Surface characterization Prof. Dr. rer. nat. Oliver Lieleg, ■ 2WTKƄECVKQPQHCPVKDCEVGTKCNCPVKXKTCN Group Leader glycoproteins ■ Cell culture, microbiology Administrative Staff Iris König-Decker, Secretary Infrastructure ■ Rheometer, tribometer Technical Staff ■ Optical microscopes Konstantinia Bidmon, Biolog.-Technical ■ 2TQƄNQOGVGT Assistant ■ Scanning electron microscope Sabine Günzkofer, Lab Assistant ■ S1 laboratory (working permission for IGPGVKECNN[OQFKƄGFOKETQQTICPKUOUQH Research Scientists biosafety level 1) Fabienna Arends, M.Sc. ■ Laboratory for cell culture Kathrin Boettcher, M.Sc. ■ 'SWKROGPVHQTRTQVGKPRWTKƄECVKQP Dipl.-Ing. (FH) Stefan Grumbein, M.Sc. Benjamin Käsdorf, M.Sc. Dipl.-Ing. Julia Nachtsheim Constantin Nowald, M.Sc Publications 2013-14 ■ K. Boettcher, S. Grumbein, U. Winkler, J. Nachts- ■ S. Grumbein, M. Opitz, O. Lieleg, Selected metal heim, and O. Lieleg, Adapting a commercial shear KQPURTQVGEV$CEKNNWUUWDVKNKUDKQƄNOUHTQOGTQUKQP rheometer for applications in cartilage research, Metallomics, RSC, 6(8), 1441-1450 (2014) 4GXKGYQH5EKGPVKƄE+PUVTWOGPVU ■ (#TGPFU4$CWOIÀTVGN1.KGNGI+QP5RGEKƄE ■ S. Kesel, A. Mader, P. Seeberger, O. Lieleg, and M. Effects Modulate the Diffusive Mobility of Colloids Opitz, Carbohydrate-coating reduces adhesion of in an Extracellular Matrix Gel, Langmuir, 29 (51): DKQƄNOHQTOKPI$CEKNNWUUWDVKNKUVQIQNFUWTHCEGU 15965-15973 (2013) Applied and Environmental Microbiology, 80(19) ■ #5%TKVEJƄGNF);CQ#,CKUJCPMCT45(TKGF- 5911-7 (2014) lander, O. Lieleg, P.S. Doyle, G. McKinley, M. House ■ K.W. Müller, R.F. Bruisma, O. Lieleg, A.R. Bausch, and K. Ribbeck, Cervical Mucus Properties Stratify 9#9CNNCPF#,.GXKPG4JGQNQI[QHUGOKƅGZKDNG Risk for Preterm Birth, PLoS ONE, 8(8) e69528 bundle networks with transient linkers, Physical (2013) Review Letters, 112(23) 238102 (2014) 124 Biomechanics Group Institute of Automotive Technology Vehicle concepts – smart mobility – vehicle dynamics and control systems – driver assistance and safety – electric vehicle components ■ The research focus of the Institute of Automotive Technology in YCUVJGGOGTIKPIƄGNFQHGOQDKNKV[+PCFFKVKQPVQFGXGNQRKPI PQXGNXGJKENGEQPEGRVUCPFCPCN[\KPIVJGTGURGEVKXGOCTMGVEQPFKVKQPU CRCTVKEWNCTGORJCUKUKPTGUGCTEJKURNCEGFQPRQYGTVTCKPVGEJPQNQIKGU CPFFTKXGTCUUKUVCPEGU[UVGOU 6JGGOGTIKPISWGUVKQPQPJQYVQGPUWTG GHƄEKGPVXGJKENGUKPVJGHCEGQHKPETGCUKPI VJGXKCDKNKV[QHKPFKXKFWCNVTCPURQTVVJTQWIJ TGUQWTEGUJQTVCIGUYCUCPUYGTGFYKVJ VJGRWDNKERTGUGPVCVKQPQHVJGGNGEVTKE ECT8KUKQ/6JKURTQVQV[RGQHCPGNGEVTKE XGJKENGYCUFGXGNQRGFVQFGOQPUVTCVG VJGRTQOKUKPIECRCDKNKVKGUQHCUOCNNUECNG Prof. Dr.-Ing. GNGEVTKEXGJKENGHQTCPWTDCPGPXKTQPOGPV Markus Lienkamp 6CEMNKPIVJGEJCNNGPIGUQHVJGRTQFWEVKQP RTQEGUUVJGWUGQHPQXGNRTQOKUKPI Contact OCVGTKCNUCPFKPVGTFKUEKRNKPCT[YQTMVJG YYYHVOOYVWOFG GPIKPGGTKPIRTQEGUUKUTGƅGEVGFKPCNNQH NKGPMCOR"HVOOYVWOFG VJGHQNNQYKPIHQEWUCTGCUQHVJG+PUVKVWVGQH 2JQPG 8KUKQ/RTQVQV[RG #WVQOQVKXG6GEJPQNQI[ E-mobility and Infrastructure +PVJGƄGNFQHGOQDKNKV[PGYXGJKENG EQPEGRVUCTGFGXGNQRGFHTQOUOCNNUECNG XGJKENGUWRVQWVKNKV[XGJKENGU6JKUKPXQNXGU HQTGOQUVVJGTGUGCTEJKPGNGEVTKEXGJKENG EQORQPGPVUCPFVJGGPIKPGGTKPIQHPQXGN EQORQPGPVUQNWVKQPU6JGEJCNNGPIG KPVJKUCTGCKUVJGCPCN[UKUQHGZKUVKPI EQORQPGPVUVJGFGTKXCVKQPQHTGSWKTGF EJCPIGUVQCFFTGUUPGYTGSWKTGOGPVUQT VJGFGXGNQROGPVQHPGYEQORQPGPVU6JG TGUWNVUQHVJKUTGUGCTEJCPFFGXGNQROGPV %QPEJKHGTCDCVVGT[RCEM CTGOGCUWTGFDCUGFQPVJGTGUWNVKPIKPƅW GPEGQPVJGXGJKENGUVTWEVWTGCRRNKECVKQP /QFGQHVTCPURQTVKFGPVKƄECVKQPKUKPENW CPFRTQFWEVKQP FGFKPVJGTGUGCTEJCEVKXKVKGUVQJQNKUVKECNN[ +PRCTVKEWNCTVJGKORCEVQHKORTQXGFGNGE VTCEMCPFTGEQTFVJGOQDKNKV[DGJCXKQTQH VTKEXGJKENGEQORQPGPVUUWEJCUNKVJKWOKQP FKHHGTGPVWUGTITQWRU6JGCKOQHVJGUG DCVVGT[U[UVGOUVJGKTGNGEVTQPKEUCPFVJG UVWFKGUKUVQFGTKXGVJGTGSWKTGOGPVUQH CHHGEVGFUGEQPFCT[EQORQPGPVUKPUKFGVJG VJGKPHTCUVTWEVWTGCPFVJGGNGEVTKEXGJKENGU XGJKENGCTGTGUGCTEJGFYKVJVJGJGNRQH VJGOUGNXGUVJCVCTGVCTIGVGFVQYCTFU UKOWNCVKQPUUVCVGQHVJGCTVRTQVQV[RGUCPF FKHHGTGPVWUGTITQWRU2TGFKEVKQPTGICTFKPI GZRGTKOGPVU CO2GOKUUKQPUTCPIGQTRNCEGOGPVQH 'NGEVTKEXGJKENGUCTGHWTVJGTTGUGCTEJGF EJCTIKPIUVCVKQPECPDGGUVCDNKUJGFCPF QPCNCTIGTUECNGYKVJCXCTKGV[QHCRRNKEC QRVKOK\GFYKVJVJGUGCRRTQCEJGU VKQPUYJKEJGZEGGFVJGXGJKENGEQPVGZV KVUGNH(NGGVVGUVUYKVJGNGEVTKEXGJKENGU Projects CTGEQPFWEVGFVQCPCN[\GVJGDGJCXKQT ■ 8'/sXKTVWCNGNGEVTQOQDKNKV[HQEWUGF QHFKHHGTGPVWUGTITQWRUVQFGVGTOKPGVJG QPVCZKCPFEQOOGTEKCNVTCHƄEKP GZRGEVGFDGJCXKQTEJCPIGQHFTKXGTU /WPKEJ Institute of Automotive Technology 125 ■ 5WPECT ■ 4CPIGGZVGPUKQPHQTGNGEVTKEECTU ■ 5WUVCKPCDNGTCYOCVGTKCNWUGHQT ■ 'PGTI[OCPCIGOGPVHQTJ[DTKFVTWEMU GNGEVTQOQDKNKV[ ■ 4GFGUKIPCPFCFCRVCVKQPQHHWNNXGJKENG ■ $WUKPGUUECUGGNGEVTKEXGJKENGU VGUVKPICPFXCNKFCVKQPHQTGNGEVTKE ■ 3WCF4CF G)#2 XGJKENGU ■ ''$CVV ■ 8KUKQ/sUOCNNXGJKENGHQTWTDCP ■ &GXGNQROGPVUKPVJGTKUMCPCN[UKUQH OQDKNKV[ GNGEVTKEXGJKENGU Vehicle Concepts 8GJKENGEQPEGRVUCTGFGXGNQRGFDCUGFQP ■ 8KTVWCNXGJKENGFGUKIPCPFCTEJKVGEVWTG CXCTKGV[QHTGSWKTGOGPVUVJCVNGCFVQCP RNCPPKPIKPVJGGCTN[EQPEGRVRJCUG CEEWTCVGOQFGNCPFRTQVQV[RG#OQPIUV ■ 6TWEMs6%1CPFGOKUUKQPQRVKOK VJGJCTFYCTGEQORQPGPVUKPHTCUVTWEVWTG \GFEQPEGRVHQTJKIJEWDGVTCPURQTVC URGEKƄEUGPXKTQPOGPVEQPFKVKQPUCPFWUGT VKQP ITQWREJCTCEVGTKUVKEUKVKUVJGTGUGCTEJ ■ 8GJKENGEQPEGRVHQT5WD5CJCTCP#HTKEC VCUMVQKFGPVKH[VJGUGXGTKV[QHVJGFKHHGTGPV ■ 8KUKQ/sUOCNNXGJKENGHQTWTDCP TGSWKTGOGPVUCPFFGVGTOKPGVJGKPƅWGPEG OQDKNKV[ QPVJGQXGTCNNVCTIGVGFEQPEGRV6QQNU ■ 4GFGUKIPCPFCFCRVCVKQPQHHWNNXGJKENG VQUWRRQTVVJKURTQEGUUCTGFGXGNQRGF VGUVKPICPFXCNKFCVKQPHQTGNGEVTKE XGJKENGRTQRGTV[RTQƄNGUCTGGNCDQTCVGFCPF XGJKENGU URGEKƄECPCN[\KPIOGVJQFUCTGGUVCDNKU ■ 4GIKQPURGEKƄECUUGUUOGPVCPFUGNGE JGF6JGFGXGNQRGFEQPEGRVUHQTXCTKQWU VKQPQHXGJKENGRQYGTVTCKPEQPEGRVU 2TGUGPVCVKQPQHVJG3WCF4CFCV OCTMGVUCTGGPIKPGGTGFCPFVGUVGFKPNQECN ■ 3WCF4CF G)#2 the ecartec CPFKPVGTPCVKQPCNUGVVKPIU ■ 1RVKOK\CVKQPCPFCUUGUUOGPVQH RTQFWEVCTEJKVGEVWTGUHQTJGCX[FWV[ Projects EQOOGTEKCNXGJKENGU ■ (CUVFGXGNQROGPVQHECTDQPEQORQUKVG XGJKENGUVTWEVWTGU $+9%(42 Driving and Driver &TKXGTKPHQTOCVKQPCPFVJGFTKXKPIVCUM FTKXGTCPFVJGGPXKTQPOGPVCUVJG[HQTO KVUGNHKUUCHGV[ETWEKCN6JGTGUGCTEJKP CUGRCTCVGENQUGFNQQREQPVTQNU[UVGO VJKUCTGCHQEWUQPCEEKFGPVRTGXGPVKQP &GXGNQRKPIPGYXGJKENGEQPVTQNU[UVGOU CPFCXQKFCPEGCPFVJGKPVGITCNUCHGV[ CPFKORNGOGPVKPIPQXGNCRRTQCEJGUKP QHXGJKENGU+PHQTOKPICPFTCKUKPIVJG XGJKENGF[PCOKEUUKOWNCVKQPCPFUVCP CVVGPVKQPQHVJGFTKXGTCTGEQXGTGFKP FCTFK\GFFTKXKPIVGUVUGPCDNGVJGSWCPVKƄ VJGRTQOKUKPICTGCQHFTKXGTCUUKUVCPEG ECVKQPQHVJGNCVGTCNXGJKENGF[PCOKEU U[UVGOU6JGQXGTCNNFGXGNQROGPVHQEWU KPVJKUƄGNFKUQPVJTGGOCLQTCTGCU VJG Projects VGEJPKECNU[UVGOUCPFVJGEQORQPGPVU ■ 74 $#0 &[PCOKEFTKXKPIUKOWNCVQT GPIKPGGTKPICPFRTQITCOOKPI VJG ■ 6GNGQRGTCVGFFTKXKPI KPVGTCEVKQPDGVYGGPVJGWUGTCPFVJG ■ 2TQRGTV[FCOCIGCPCN[UKU XGJKENGCPF VJGGXCNWCVKQPD[WUGTU ■ &TKXKPIUKOWNCVQT 6JGF[PCOKEDGJCXKQTQHXGJKENGUKUQH ■ %TCUJEQORCVKDKNKV[QHOKETQECTU GSWCNKORQTVCPEGHQTVJGFTKXKPIUCHGV[ ■ 8KUKQ/sUOCNNXGJKENGHQTWTDCP 'CEJXGJKENGKPVGTCEVUUVTQPIN[YKVJVJG OQDKNKV[ 126 Institute of Automotive Technology Research Focus Research Scientists ■ 8GJKENGEQPEGRVU &KRN+PI5VGHCP)TWDYKPMNGT ■ 5OCTVOQDKNKV[ ,QJCPPGU$GV\/5E ■ &TKXKPIF[PCOKEU &KRN+PI/QTKV\*CPP ■ &TKXGTCUUKUVCPEG &KRN+PI2CDNQ#.QRG\*KFCNIQ ■ 'NGEVTKEXGJKENGEQORQPGPVU &KRN+PI$GPGFKMV,ÀIGT &KRN+PI4QDGTV-QEJJCP Competence &KRN+PI/CTKC-WINGT ■ 'OQDKNKV[ &KRN+PI,ØTIGP.QJTGT ■ 5CHGV[ /CI5GDCUVKCP1UUYCNF ■ 'HƄEKGPE[ &KRN+PI$GPLCOKP4GWVGT ■ *WOCPXGJKENGKPVGTCEVKQP &KRN+PI5VGRJCP5EJKEMTCO ■ 6GNGQRGTCVGFFTKXKPI &KRN+PI%NCWFKC/GKU ,ÒTP#FGTOCPP/5E Infrastructure &KRN+PI/KEJCGN$CWOCPP ■ &2TKPVGT &KRN+PI2GVGT$WTFC ■ &[PCOKEFTKXKPIUKOWNCVQT &KRN2J[U(CDKCP'DGTV ■ /GEJCPKECNCPFGNGEVTKECNYQTMUJQR &KRN+PI4KEJCTF'EMN ■ &[PCOQOGVGTVGUVTKI &KRN+PI/CTVKP4*COOGT ■ $CVVGT[VGUVKPINCD &KRN+PI.QTGP\*QTNDGEM ■ *CTFYCTGKPVJGNQQRVGUVUVCPFU &KRN+PI/CVVJKCU-GTNGT ■ /GCUWTGOGPVQHFTKXKPIF[PCOKEU &KRN+PI5VGHCP/ØNNGT ■ /QDKNGFCVCECRVWTKPIXKCUOCTVRJQPGU -QTDKPKCP/ØNNGT/5E ■ %QORWVKPIENWUVGT 5VGRJCP4QJT/5E &KRN+PI(GNKZ4ÒOGT Courses &KRN+PI/QTKV\5VGHHCP ■ $CUKEUQH/QVQT8GJKENG%QPUVTWEVKQP &KRN+PI2JKNKR9CEMGT ■ 4QCF8GJKENGU &GUKIPCPF5KOWNCVKQP &KRN+PI)GQTI9CNFGT ■ &[PCOKEQH2CUUGPIGT%CTU &KRN-HO/CVJKCU9KRƅGT ■ &GUKIPQH'NGEVTKE8GJKENGU &KRN+PI2CVTKEM5VGPPGT ■ 6GEJPQNQI[QH/QVQTE[ENGU &KRN+PI5GDCUVKCP$GPFGT ■ 4CEG4CT6GEJPQNQI[ &KRN+PI#TOKP(ÒTI /KEJCGN(TKGU/5E Management &KRN+PI/CTMWU-NGKP 2TQH&T+PI/CTMWU.KGPMCOR&KTGEVQT 5CUEJC-QDGTUVCGFV/5E &T+PI(TCPM&KGTOG[GT &KRN+PI/KEJCGN5KPPKPI &KRN+PI/CTVKP5QNVGU Adjunct Professors 5QRJKG5VGKPOC»N/5E 2TQH&T+PI7NTKEJ*GKFGP$/9#) &KRN+PI#NGZCPFGT5Ø»OCPP 2TQH&T+PI-CTN8KMVQT5EJCNNGT &KRN+PI/CZKOKNKCP6UEJQEJPGT &T+PI*GTDGTV2HCD.KGDJGTT)OD* &KRN+PI(NQTKCP-QJNJWDGT &T+PI2GVGT6TQRUEJWJ#7&+#) &KRN+PI#PFTGC(KEJV &T+PI.QVJCT9GEJ6¸85ØF#WVQ 6JQTUVGP*GNHTKEJ/5E OQVKXG#) &KRN+PI&CPKGN-KNNKCP &KRN+PI5KOQP5EJOGKNGT Administrative Staff &KRN+PI#PFTGCU5EJWNV\G )CDTKGNG9GKICPF &KRN+PI#PFTGCU/9GP\GNKU 0QTKPC4WFQNRJ 6JQOCU Institute of Automotive Technology 127 &T+PI(TCPM&KGTOG[GT Technical Staff &KRN+PI6JQOCU&CWP )ØPVGT#PVJWDGT %JTKUVQRJGT(TCPM/# 0KPC,WNKWU &KRN+PI.[FKC)CWGTJQH ,CUOKP5RKEMGPGFGT &KRN+PI-NCWU)UEJYGPFVPGT #NGZC9CYTC/# &KRN+PI&CPKGN*G[GU 5VGHCP&KEJVN &KRN+PI6JQOCU*KGTNKPIGT &KRN+PI (* (NQTKCP$KGEJN #OKP*QUUGKPK/5E 5GDCUVKCP)TØNN 'OCF5CFGIJKRQWT/5E #NGZCPFGT5WEMQY &KRN/GFKGPKPH5QPLC5VQEMGTV /CZKOKNKCP-NKRRGN 6KVQ6CPI/5E 'TYKP&CTPJQHGT ,QJCPPGU9CNNPGT/5E 2GVGT5GKFKPIGT &CXKF9KVVOCPP/5E /KEJCGN-ÒPKI Publications 2013-14 ■ #NGZ/$TCFUJCY$GPLCOKP4GWVGT6JQOCU ■ #5Ø»OCPP#5EJCDGTV/.KGPMCOR #PCN[UG *COCEJGT 6JG2QVGPVKCN5ECTEKV[QH4CTG'NGOGPVU XQPMWPFGPURG\KƄUEJGP8GTDTCWEJUGKPURCTRQVGP HQTVJG'PGTIKGYGPFG )TGGP 6JG+PVGTPCVKQPCN VKCNGPFWTEJ#GTQF[PCOKM4QNNYKFGTUVCPFUWPF ,QWTPCNQH5WUVCKPCDNG'PGTI[%QPXGTUKQPCPF .GKEJVDCWOC»PCJOGP +PVGTPCVKQPCNG8&+ 5VQTCIG (CEJVCIWPI0WV\HCJT\GWIG ■ 5GDCUVKCP$GPFGT5COWGN.GG 2TQFWEVKQPRTQEGUU ■ -TGKOG[GT/(ÒTI# .KGPMCOR/ /GJTUVW QHC%(42XGJKENGUVTWEVWTGKP5KPICRQTG +%5 ƄIGOQFWNQTKGPVKGTVG$CWMCUVGPGPVYKEMNWPIHØT +PPQXCVKXG%QORQUKVGU5WOOKV 0WV\HCJT\GWIG +PVGTPCVKQPCNG8&+(CEJVCIWPI ■ -)UEJYGPFVPGT/-KUU,)YGJGPDGTIGT/ 0WV\HCJT\GWIG .KGPMCOR n+P&GRVJo5CEJUEJCFGPCPCN[UGs#PHQT ■ %JTKUVKCPG0GV\MGT4ØFKIGT.CPI.WV\3WGFGP FGTWPIGPWPF2QVGPVKCNG 6CIWPI(CJTGTCUUKU DCWO$GPGFKEV5EJQPNCW6JQOCU*KGTNKPIGT VGP\ 'NGMVTQMNGKPUVHCJT\GWIG *GTCWUHQTFGTWPICPFKG ■ *G[GU& &CWP6 128 Institute of Automotive Technology ■ 9CNFGT) %CORGUVTKPK% -QJNOGKGT5 .KGP ■ .WV\.GPPCTV5 6KVQ6CPI/CTMWU.KGPMCOR &KG MCOR/ ,QUUGP# (WPEVKQPCNKV[CPF$GJCXKQWT TGEJVNKEJG5KVWCVKQPXQPVGNGQRGTKGTVGPWPFCWVQPQ QHC&WCN-CNOCP(KNVGTKORNGOGPVGFQPC/QFWNCT OGP(CJT\GWIGP 0GWG Institute of Automotive Technology 129 ■ .WEECTGNNK/.KGPMCOR//CVV&CPF4WUUQ ■ &CWP6JQOCU, .KGPMCOR/CTMWU 8GTDWPF 5RGPC2 #WVQOQVKXG&GUKIP3WCPVKƄECVKQP RTQLGMV 8K(Cs8KTVWGNNGT(CJTVTCKPGTs'PVYKEMNWPI 2CTCOGVGTU&GƄPKPI'ZVGTKQT2TQRQTVKQPU#EEQTFKPI GKPGUXKTVWGNNGP(CJTVTCKPGTU\WT7PVGTUVØV\WPIGKPGT VQ%CT5GIOGPV 6GEJPKECN2CRGT XGTDTCWEJUWPFXGTUEJNGK»QRVKOKGTVGP(CJTYGKUG 5#'9QTNF%QPITGUU'ZJKDKVKQP ■ $GPLCOKP4GWVGT-CTN5EJÒPUVGKPGT/CTMWU9CIPGT ■ *G[GU&CPKGN &CWP6JQOCU, &ÒTPGT-CTNJGKP\ &CPKGN)NG[\GU6QDKCU/CUUKGT6JQOCU*COCEJGT .KGPMCOR/CTMWU 8GTDWPFRTQLGMV 8K(Cs8KTVWGNNGT /CTMWU.KGPMCOR .KHGE[ENGITGGPJQWUGICU (CJTVTCKPGTs'PVYKEMNWPIGKPGUXKTVWGNNGP(CJT CPCN[UKUHQTCWVQOQVKXGCRRNKECVKQPUs#ECUGUVWF[ VTCKPGTU\WT7PVGTUVØV\WPIGKPGTXGTDTCWEJUWPF HQTVCZKUKP5KPICRQTG +PVGTPCVKQPCN,QWTPCNQH5OCTV XGTUEJNGK»QRVKOKGTVGP(CJTYGKUG )TKFCPF%NGCP'PGTI[ ■ 5VGRJCP5EJKEMTCO MCOR 2CTCOGVTKUEJG%12'OKUUKQPUOQFGNNKGTWPI s2TQEGGFKPIUQHVJGVJ+PVGTPCVKQPCN%QPHGTGPEG HØTPGWG(CJT\GWIMQP\GRVG #6< QP+PHQTOCVKEUKP%QPVTQN#WVQOCVKQPCPF4QDQVKEU VJ+PVGTPCVKQPCN%QPHGTGPEGQP+PHQTOCVKEUKP ■ )GQTI9CNFGT%JTKUVKCP%CORGUVTKPK/CTMWU %QPVTQN#WVQOCVKQPCPF4QDQVKEU+%+0%1 .KGPMCOR#PFTGCU,QUUGP #FCRVKXG5VCVGCPF 2CTCOGVGT'UVKOCVKQPQH.KVJKWO+QP$CVVGTKGU ■ 6CPI68GVVGT2(KPMN5(KIGN-.KGPMCOR/ $CUGFQPC&WCN.KPGCT-CNOCP(KNVGT 6JG 6GNGQRGTCVGFTQCFXGJKENGUs6JGn(TGG%QTTKFQTo 5GEQPF+PVGTPCVKQPCN%QPHGTGPEGQP6GEJPQNQIKECN CUCUCHGV[UVTCVGI[CRRTQCEJ PF #FXCPEGUKP'NGEVTKECN'NGEVTQPKEUCPF%QORWVGT +PVGTPCVKQPCN%QPHGTGPEGQP/GEJCPKECN&GUKIP 'PIKPGGTKPI CPF2QYGT'PIKPGGTKPI+%/&2'#RRNKGF ■ *CPU/CTVKP-TQNN$$WTUEJCTFV-5EJOKFV/ /GEJCPKEUCPF/CVGTKCNU8QNWOG .KGPMCOR 7VKNKUCVKQPQHEWUVQOGTTGNGXCPVFTKXKPI DGJCXKQWTHQTTGNKCDNGHTKEVKQPRQVGPVKCNGUVKOCVKQPD[ UECNKPIPQPNKPGCTV[TGOQFGNU |+PVGT PCVKQPCNGU5VWVVICTVGT5[ORQUKWO 130 Institute of Automotive Technology Institute of Product Development Processes, methods and tools for developers of technical products ■6JGHQEWUQHVJG+PUVKVWVGKPVJGNCUVVYQ[GCTUKUTGRTGUGPVGFD[VJGƄXG HQEWUGFTGUGCTEJƄGNFU /QUVRTQLGEVUCTGUKVWCVGFKPVJGƄGNF -PQYNGFIGCPFCRRTQCEJGUHTQOU[UVGOU QHKPPQXCVKQPETGCVKXKV[6QIGVJGTYKVJ engineering are also transferred to the KPFWUVTKCNRCTVPGTUVJGKPUVKVWVGYQTMUQP TGUGCTEJƄGNFQHMPQYNGFIGOCPCIGOGPV VQRKEUNKMGWUGTGZRGTKGPEGDKQOKOGVKEU Facing the challenge of the huge amount and open innovation (represented in three QHGORNQ[GGUECTT[KPIMPQYNGFIGHQT projects). HWNƄNNKPIVCUMUVJGUVTWEVWTCNEQORNGZKV[ The institute has a long tradition in the approach helps handling these domains ƄGNFQHU[UVGOUGPIKPGGTKPICPFGPIKPGG- and deriving measures. TKPIFGUKIPRTQEGUUGU +PVJKUƄGNFVJG (KPCNN[RTQLGEVUQPVJGVQRKEQHEQUV Prof. Dr.-Ing. KPUVKVWVGYQTMUQPƄXGRTQLGEVUYKVJKPVJG management deal with the challenge of Udo Lindemann Collaborative Research Centre SFB 768 GCTN[FGVGTOKPCVKQPDWVNCUVECWUKPIQH and on several projects in collaboration costs. Contact with large companies as well as small and www.pe.mw.tum.de medium enterprises (SMEs). [email protected] Phone +49.89.289.15131 Innovation & Creativity The current research activities of the Institute of Product Development in the ƄGNFQHKPPQXCVKQPCPFETGCVKXKV[CKOCV the integration of relevant knowledge from various disciplines of product development. The institute recognizes potentials in the business environment as YGNNCUYKVJKPVJGEQORCP[TGƄPGUFGUKIP methodologies and adapts processes. An essential component of research is the application within an industrial GPXKTQPOGPV6JGKPVGTFKUEKRNKPCT[RTQFWEV UXIM model showing user experience interaction development allows the derivation of KPPQXCVKXGEQPXGTVKDNGCPFVJWUUWUVCKP- ■ $/9KRTQLGEVs+PPQ%[(GT +PVGITCVGF able product architectures. design and fabrication of customer KPFKXKFWCNK\GFRTQFWEVUKPE[DGTRJ[UK- Projects ECNOCPWHCEVWTKPIU[UVGOU ■ CAR@TUM Project – Customer experi- ■ $/$(RTQLGEVs4#-110 2TQITGUUD[ ence active collaboration in open organisa- ■ DFG project – KomBi: Communication tions platform bio-inspired design ■ BMBF project – Web 2.0-based cluster ■ -/'RTQLGEVs5/'URGEKƄECRRNKECVKQP management for MAI carbon of outside-in open innovation ■ TUM project – visio.m Institute of Product Development 131 Systems Engineering design of individual components. Metho- FQNQIKECNN[UGGPVJGKPUVKVWVGYQTMUDCUGF QPVJGCRRTQCEJQHUVTWEVWTCNEQORNGZKV[ management. Projects ■ &()5($RTQLGEV#s#PCN[\KPIVJG F[PCOKEUQHE[ENKEKPVGTCEVKQPUKP255 ■ +PFWUVT[RTQLGEVs&GXGNQROGPVQHC #UQEKQVGEJPKECNRGTURGEVKXGQHEQORNGZKV[KP255 OCTMGVFTKXGPU[UVGOCPFRTQFWEV UVTCVGI[HQTDTCMGEQPVTQNU[UVGOU The Institute of Product Development ■ EU project – Amisa: Architecting has a long tradition of integrated product OCPWHCEVWTKPIU[UVGOUCPFKPFWUVTKGU FGXGNQROGPV+PTGEGPV[GCTUTGUGCTEJ HQTCFCRVCDKNKV[ CEVKXKVKGUQHU[UVGOUGPIKPGGTKPIYGTG ■ +PFWUVT[RTQLGEVs#PCN[UKUCPFSWCPVK- performed to react on the increasing inter- ƄECVKQPQHEQORNGZKV[QHC%6RTQFWEV FKUEKRNKPCTKV[QHRTQFWEVFGXGNQROGPVCPF HCOKN[ VQDGPGƄVHTQOU[PGTIKGU4GUGCTEJHQEWU ■ +PFWUVT[RTQLGEVs4CKUED: Raising of the department is the development of VJGGHƄEKGPE[QHFTKNNKPIRTQEGUUGUD[ product architectures as an important KORTQXKPIU[UVGOCTEJKVGEVWTG NKPMDGVYGGPTGSWKTGOGPVUCPCN[UKUCPF Engineering Design Processes Research activities on engineering design processes focus on the development of GHƄEKGPVRTQEGFWTGUHQTVJGFGUKIPQHEQO- RNGZVGEJPKECNRTQFWEVUCPFUGTXKEGU[U- tems (PSS). The most important premise YJGPCPCN[\KPICPFKORTQXKPIRTQEGUUGU KUVJGEQORCP[CPFUKVWCVKQPURGEKƄE UWRRQTVQHFGXGNQRGTU+PRCTVKEWNCTVJG WPFGTN[KPIRTQFWEVUVTWEVWTGVJGQTICPK- \CVKQPCNEQPFKVKQPUCPFVJGF[PCOKEUQH internal and external factors for a targeted design process are taken into account. Projects ■ DFG SFB project A2 – Modeling and evaluating development relationships %[ENGQTKGPVGFFGXGNQROGPVRTQEGUUGU across disciplines ■ &()5($RTQLGEV$s%[ENGQTKGPVGF ■ &()5($RTQLGEV6s/GVJQFQNQI[ planning and coordination of develop- HQTETGCVKPIE[ENGTQDWUVOQFWNGCPF ment processes platform strategies ■ &()5($RTQLGEV%s.KHGE[ENGFTKXGP ■ KME project – Lean development in FGEKUKQPOGVJQFQNQI[KPRTQFWEVUGT- SMEs XKEGU[UVGORNCPPKPI 132 Institute of Product Development Knowledge Transfer & Management is providing the information on best UQNWVKQPUYKVJKPVJGEQORCP[CPFCETQUU companies at the right time to the right GORNQ[GGU&WGVQVJGKPETGCUKPIƅQY of information and growing amount of WPUVTWEVWTGFFCVCVJKUQHVGPKUCPWP manageable challenge. The institute faces this challenge with approaches HTQOU[UVGOGPIKPGGTKPI Projects -PQYNGFIGƅQYUKPRTQFWEVFGXGNQROGPVCPF ■ BFS project FORPRO2 – Methodolo- application IKECNVQQNMKVHQTU[UVGOCVKEGXCNWCVKQP of design solutions In addition to knowledge transfer between ■ BFS project FORPRO2 – Simulation- GORNQ[GGUCPFVJGOCKPVGPCPEGQH oriented requirements engineering MPQYNGFIGRQTVHQNKQVJGTGUGCTEJHQEWU ■ -/'RTQLGEVs5[UVGOCVKEFGXGNQROGPV KPVJKUƄGNFKUOCMKPIGZKUVKPIMPQYNGFIG QHCEQORCP[oUMPQYNGFIG QHIQQFUQNWVKQPUCXCKNCDNG#MG[HCEVQT ■ BMBF project – ConImit: Protection for successful product development CICKPUVRTQFWEVRKTCE[ Cost Management +PVJGCTGCQHEQUVOCPCIGOGPVVJGGCTN[ RJCUGUQHVJGRTQFWEVNKHGE[ENGVJGEQUV TGURQPUKDKNKV[QHFGUKIPGTUCPFVJGPGEGU- UCT[EQQRGTCVKQPDGVYGGPXCTKQWUKPVGTPCN departments and external corporate points are emphasized. Designers and GPIKPGGTUCTGUWRRQTVGFD[VJGTGUGCTEJ activities of the department for product FGXGNQROGPVKPXCTKQWUCTGCU6JWU methods and tools are designed to enable EQUVGUVKOCVGUFWTKPIGCTN[RJCUGUQH product development and to make them thorough and reliable. Projects Cost analysis and optimization ■ &()RTQLGEVs+8' %QUVCPCN[UKUCPF optimization of mechatronic products D[GXCNWCVKPICPFFGUKIPKPIRTQFWEV structures ■ BMWi project: – AIDA: Estimation of KPFKTGEVEQUVUKPFTKXGVGEJPQNQI[ Institute of Product Development 133 Research Focus Management ■ +PPQXCVKQPETGCVKXKV[ 2TQH&T+PI7FQ.KPFGOCPP&KTGEVQT ■ 5[UVGOUGPIKPGGTKPI Dr.-Ing. Markus Mörtl ■ Engineering design processes GO2TQH&T+PI-NCWU'JTNGPURKGN ■ Knowledge transfer & management Emeretius ■ Cost management Adjunct Professors Competence Prof. PD Dr. Werner Seidenschwarz ■ 5VTWEVWTGFCPCN[VKECNCRRTQCEJ ■ Support holistic understanding Administrative Staff ■ /CPCIGUVTWEVWTCNEQORNGZKV[ Edith Marquard-Schmitt ■ Methods in engineering design Brigitte Erhardt ■ Cost optimization in engineering design Katja Zajicek ■ Process pragmatism Eva Körner Robert Weiß Infrastructure Christian Adlberger ■ Precision engineering workshop Michael Riedl ■ Innovation lab for student projects with 3D printer Research Scientists Dipl.-Ing. David Allaverdi Courses Dipl.-Ing. Wolfgang Bauer ■ Product Design and Development Dipl.-Ing. Florian Behncke ■ Methods of Product Development Dipl.-Ing. Annette Böhmer ■ Management of Product Development Dipl.-Ing. Cristina Carro Saavedra ■ Cost Management in Product Develop- Dipl.-Ing. Nepomuk Chucholowski ment &T*WIQ&o#NDGTV ■ %QORNGZKV[/CPCIGOGPVHQT+PFWUVTKCN (CVQU'NG\K/5E Applications #NGZCPFGT)QNQXCVGPMQ/5E ■ Management of Business Strategies Dipl.-Ing. Matthias Gürtler Dipl.-Ing. Helena Hashemi Farzaneh Lectures in Collaboration with Further Dr.-Ing. Bergen Helms Institutes: Dipl.-Biol. Katharina Helms ■ Basics of Engineering Design and Dipl.-Ing. Christoph Hollauer 2TQFWEVKQP5[UVGOU /CKM*QNNG/5E ■ Modeling and Simulation Dipl.-Ing. Daniel Kammerl ■ 3WCNKV[/CPCIGOGPV Dipl.-Ing. Daniel Kasperek Dr.-Ing. Maximilian Kissel Dipl.-Ing. Simon Kremer Dipl.-Ing. Alexander Lang Dipl.-Ing. Sebastian Maisenbacher Dipl.-Ing. Ioanna Michailidou %JTKUVQRJGT/ØP\DGTI/5E &T/C[CFC1OGT Dipl.-Ing. Michael Roth Dipl.-Ing. M.Sc. Constantin v. Saucken Dipl.-Ing. Lisa Schmid Dipl.-Ing. Danilo Schmidt Dipl.-Ing. Christian Schmied Dipl.-Ing. Florian Schöttl Dr. Srinivasan Venkataraman &QOKPKM9GKFOCPP/5E Dipl.-Ing. Martina Wickel ,WNKCP9KNDGTI/5E 134 Institute of Product Development Publications 2013-14 ■ #NNCXGTFK&*GTDGTI#.KPFGOCPP7 .KHGE[ENG ■ )ØTVNGT/4.KPFGOCPP7 5KVWCVKXGQRGP RGTURGEVKXGQPWPEGTVCKPV[CPFXCNWGTQDWUVPGUUKP innovation – A model for selecting the right external VJGQHHUJQTGFTKNNKPIKPFWUVT[ 5[U%QPs CEVQTUCPFKPXQNXKPIVJGOKPCPGHƄEKGPVYC[ VJ#PPWCN+'''+PVGTPCVKQPCN5[UVGOU%QPHGTGPEG Proceedings of the International Conference on 2TQEGGFKPIUCTVPQRR 'PIKPGGTKPI&GUKIP+%'&&5RR ■ $GJPEMG()*'JTJCTFV,.KPFGOCPP7 ■ )ØTVNGT/4.KPFGOCPP7 7UKPIDQQNGCPQRGTC- /QFGNUHQTVJGQRVKOK\CVKQPQHUWRRN[EJCKPUC tors for modeling complex logical dependencies in literature review. (2013) IEEE International Confer- OCVTKEGU VJ+PVGTPCVKQPCN&GRGPFGPE[ ence on Industrial Engineering and Engineering CPF5VTWEVWTG/QFGNNKPI%QPHGTGPEG&5/ /CPCIGOGPVCTVPQRR pp. 117-123. ■ $GJPEMG()*'KEJKPIGT,.KPFGOCPP7 ■ *CUJGOK(CT\CPGJ*-CKUGT/-.KPFGOCPP7 Involvement of procurement in the product creation +PƅWGPEGQHEQOOWPKECVKQPGNGOGPVUCPFEQIPKVKXG RTQEGUU #U[UVGOCVK\CVKQPUEJGOGQHOGCUWTGU effects on creative solution search in groups. (2013) 2TQEGFKC%+42RR Proceedings of the International Conference on ■ $GJPEMG()**QNUVGKP,.KPFGOCPP7 'PIKPGGTKPI&GUKIP+%'&&5RR /GVJQFHQTVJGUWRRNKGTUGNGEVKQPKPUWRRN[EJCKP ■ *GT\DGTIGT2$GJPEMG()*5EJGPMN5 PGVYQTMU #PCRRTQCEJQHUVTWEVWTCNEQORNGZKV[ .KPFGOCPP7 +PVGTCEVKXGOQFGNKPICPFGXCNWCVKQP management. (2014) 8th Annual IEEE International QH2TQFWEV5GTXKEG5[UVGOU 2TQEGGFKPIUQH 5[UVGOU%QPHGTGPEG5[U%QPs2TQEGGFKPIU VJG+PVGTPCVKQPCN%QPHGTGPEGQP'PIKPGGTKPI&GUKIP CTVPQRR +%'&&5RR ■ $GJPEMG()*-ØDGN6.KPFGOCPP7 5WRRNKGT ■ -CURGTGM&%JWEJQNQYUMK0/CKUGPDCEJGT5 GXCNWCVKQPDCUGFQPCRTQFWEVoUCTEJKVGEVWTG .KPFGOCPP7/CWTGT/ #OGVJQFHQTKORCEV Reducing Risk in Innovation: Proceedings of the CPCN[UKUQHE[ENKEEJCPIGUYKVJKPKPPQXCVKQPRTQEGU- VJ+PVGTPCVKQPCN&5/%QPHGTGPEG/GNDQWTPG UGUQH255 2TQEGFKC%+42RR #WUVTCNKC#WIWUVRR ■ -GTPUEJOKFV-$GJPEMG(%JWEJQNQYUMK0 ■ $GJPEMG()*/CWTGT&5EJTGPM.5EJOKFV 9KEMGN/$C[TCM).KPFGOCPP78QIGN &/.KPFGOCPP7 %NWUVGTKPIVGEJPKSWGHQT *GWUGT$ #PKPVGITCVGFCRRTQCEJVQCPCN[\G &5/U VJ+PVGTPCVKQPCN&GRGPFGPE[ change-situations in the development of production CPF5VTWEVWTG/QFGNNKPI%QPHGTGPEG&5/ U[UVGOU 2TQEGFKC%+42RR pp. 177-186. ■ -GTPUEJOKFV-9QNHGPUVGVVGT6/ØP\DGTI% ■ $GJPEMG()*9CNVGT(/#.KPFGOCPP7 -COOGTN&)QUYCOK5.KPFGOCPP7-TEOCT 2TQEGFWTGVQOCVEJVJGUWRRN[EJCKPPGVYQTM *8QIGN*GWUGT$ %QPEGRVHQTCPKPVGITCVKQP design with a products‘ architecture. (2014) HTCOGYQTMVQGPCDNGVJGETQUUFKUEKRNKPCT[FGXGNQR- 2TQEGFKC%+42RR OGPVQHRTQFWEVUGTXKEGU[UVGOU +''' ■ %JCMTCDCTVK#5TKPKXCUCP84CPLCP$5% International Conference on Industrial Engineering .KPFGOCPP7 #ECUGHQTOWNVKRNGXKGYUQH CPF'PIKPGGTKPI/CPCIGOGPVCTVPQ HWPEVKQPKPFGUKIPDCUGFQPCEQOOQPFGƄPKVKQP pp. 340-345. #TVKƄEKCN+PVGNNKIGPEGHQT'PIKPGGTKPI&GUKIP ■ -KUUGN/.KPFGOCPP7 5[UVGOCTEJKVGEVWTG #PCN[UKUCPF/CPWHCEVWTKPI #+'&#/ change decisions in multi-variant product portfolios. pp. 271-279. (2013) Proceedings of the International Conference ■ %JWEJQNQYUMK0.CPIGT5$GJPEMG(.KPFG- QP'PIKPGGTKPI&GUKIP+%'&&5RR OCPP7 %QORCTKUQPQHGPIKPGGTKPIEJCPIGECWUG ■ -QJP#.KPFGOCPP7/CWTGT/ -PQYNGFIG CPCN[UKUKPNKVGTCVWTGCPFKPFWUVTKCNRTCEVKEG base for supporting the handling of product models Proceedings of the International Conference on in engineering design. (2013) Proceedings of the 'PIKPGGTKPI&GUKIP+%'&&5RR +PVGTPCVKQPCN%QPHGTGPEGQP'PIKPGGTKPI&GUKIP ■ 'NG\K(/CKGT6).KPFGOCPP7 'PIKPGGTKPI +%'&&5RR change management challenges and management ■ -TGOGT5/KEJCKNKFQW+8QP5CWEMGP%.KPFG- E[DGTPGVKEU 5[U%QPsVJ#PPWCN+''' OCPP7 7UGTGZRGTKGPEGOKNGUVQPGUUVTWEVWTKPI +PVGTPCVKQPCN5[UVGOU%QPHGTGPEG2TQEGGFKPIUCTV the development of experience products. (2014) PQRR Lecture Notes in Computer Science (including ■ 'NG\K(4GUEJ&6QOOGNGKP+&$CWGT9 UWDUGTKGU.GEVWTG0QVGUKP#TVKƄEKCN+PVGNNKIGPEG /CWTGT/.KPFGOCPP7 #XKCDNGU[UVGOOQFGN CPF.GEVWTG0QVGUKP$KQKPHQTOCVKEU .0%5 perspective on variant management based on a 2#46| RR 5VTWEVWTCN%QORNGZKV[/CPCIGOGPVCRRTQCEJ ■ -WJNOCPP(*CPPGOCPP,6TCWD/$ÒJOG VJ+PVGTPCVKQPCN&GRGPFGPE[CPF5VTWEVWTG % Institute of Product Development 135 ■ /KEJCKNKFQW+8QP5CWEMGP%-TGOGT5.KPFG- ■ 4QVJ/-CURGTGM&.KPFGOCPP7 8GTKH[KPI OCPP7 #WUGTGZRGTKGPEGFGUKIPVQQNMKV the abstraction level of structural models. (2014) Lecture Notes in Computer Science (including 2TQEGFKC%QORWVGT5EKGPEGRR UWDUGTKGU.GEVWTG0QVGUKP#TVKƄEKCN+PVGNNKIGPEG ■ 5EJGPMN5#$GJPEMG()**GRRGTNG% CPF.GEVWTG0QVGUKP$KQKPHQTOCVKEU .0%5 .CPIGT5.KPFGOCPP7 /CPCIKPIE[ENGUQH 2#46| RR KPPQXCVKQPRTQEGUUGUQHRTQFWEVUGTXKEGU[UVGOU ■ /KEJCKNKFQW+8QP5CWEMGP%.KPFGOCPP7 (2013) Proceedings – 2013 IEEE International 'ZVGPFKPIVJGRTQFWEVURGEKƄECVKQPYKVJGOQVKQPCN %QPHGTGPEGQP5[UVGOU/CPCPF%[DGTPGVKEU aspects: Introducing user experience stories. (2013) 5/%CTVPQRR Proceedings of the International Conference on ■ 5EJGWTOCPP'/CWTGT/5EJOKFV&.KPFG- 'PIKPGGTKPI&GUKIP+%'&&5RR OCPP7 4GFWEKPITKUMKPKPPQXCVKQP 2TQEGGF ■ /KEJCKNKFQW+8QP5CWEMGP%.KPFGOCPP7 ings of the 15th International DSM Conference *QYVQETGCVGCWUGTGZRGTKGPEGUVQT[ /GNDQWTPG#WUVTCNKC#WIWUV Lecture Notes in Computer Science (including pp. 1-143. UWDUGTKGU.GEVWTG0QVGUKP#TVKƄEKCN+PVGNNKIGPEG ■ 5EJQGVVN($CWGT9.KPFGOCPP7 &GUKIPHQT CPF.GEVWTG0QVGUKP$KQKPHQTOCVKEU .0%5 U[UVGONKHGE[ENGRTQRGTVKGU5WRRQTVQHRNCPPKPI 2#46| RR RTQEGUUGUD[OQFWNCTK\CVKQPQHUVCMGJQNFGT ■ 0KGU$,4QDGTV1.KPFGOCPP7 %WUVQOGT PGVYQTMU VJ+PVGTPCVKQPCN&GRGPFGPE[ HQEWUGFTGSWKTGOGPVGPIKPGGTKPICPFU[UVGOFGUKIP CPF5VTWEVWTG/QFGNNKPI%QPHGTGPEG&5/ HQTRNWIKPJ[DTKFGNGEVTKEXGJKENGU 2*'8 pp. 125-132. Proceedings of the International Conference on ■ 5EJQGVVN(.KPFGOCPP7 &GUKIPHQTU[UVGO 'PIKPGGTKPI&GUKIP+%'&&5RR NKHGE[ENGRTQRGTVKGUs#IGPGTKECRRTQCEJHQT ■ ²NOG\/.KPFGOCPP7 &GEKUKQPOCMGT OQFWNCTK\KPIU[UVGOU 2TQEGFKC%QORWVGT modeling for decision support application. (2014) 5EKGPEGRR (TQPVKGTUKP#TVKƄEKCN+PVGNNKIGPEGCPF#RRNKECVKQPU ■ 5EJQGVVN(2CGHIGP/%.KPFGOCPP7 RR Approach for measuring change-induced com- ■ ²NOG\/.KPFGOCPP7 /CPCIKPICVVTKDWVG RNGZKV[DCUGFQPVJGRTQFWEVKQPCTEJKVGEVWTG EQORNGZKV[HQTWUGTEGPVGTGFFGEKUKQPUWRRQTV 2TQEGFKC%+42RR U[UVGOU 2TQEGFKC%QORWVGT5EKGPEG ■ 5EJTKGXGTJQHH2.KPFGOCPP7 /CPCIKPIC pp. 130-137. OGVJQFQNQI[FGXGNQROGPVTGSWKTGOGPVRTQEGUU ■ 1TCYUMK4*GKP%2QNGPQX&*QNNG/ – best practices and lessons learned. (2013) 5EJGPMN5/ÒTVN/.KPFGOCPP7 4GWUGQH Proceedings of the International Conference on requirements: An approach with a generic require- 'PIKPGGTKPI&GUKIP+%'&&5RR ments pool. (2013) Proceedings of the International ■ 5K[CO)+-KTPGT-9[PP&%.KPFGOCPP %QPHGTGPEGQP'PIKPGGTKPI&GUKIP+%'&&5 7%NCTMUQP2, .GCPRTQFWEVFGXGNQROGPV RR in practice: Insights from 4 companies. (2013) ■ 4GKM#.KPFGOCPP7 #PCN[\KPIYJKEJVGEJPQ- Proceedings of the International Conference on NQI[TGNCVGFKPHQTOCVKQPKUTGSWKTGFCVYJKEJUVCIG 'PIKPGGTKPI&GUKIP+%'&&5RR of product planning: A literature-based approach ■ 5VGKPJCGWUUGT6'NG\K(6QOOGNGKP+& VQKPVGITCVGVGEJPQNQI[OCPCIGOGPVKPVQUVTCVGIKE .KPFGOCPP7 /CPCIGOGPVE[DGTPGVKEUCUC product planning. (2014) 2014 International Confer- theoretical basis for lean thinking. (2013) 21st GPEGQP'PIKPGGTKPI6GEJPQNQI[CPF+PPQXCVKQP Annual Conference of the International Group for Engineering Responsible Innovation in Products .GCP%QPUVTWEVKQP+).%RR CPF5GTXKEGU+%'CTVPQ ■ 8QP5CWEMGP%/KEJCKNKFQW+-TGOGT5 ■ 4GKM#7-KPI/.KPFGOCPP7 +PXGUVKICVKQPQH .KPFGOCPP7 /QVKXGQTKGPVGFFGUKIPJGNRKPI VJGKPHQTOCVKQPIGPGTCVGFD[VGEJPQNQI[OCPCIG- automobile engineers to take the user‘s perspec- ment tools and links to strategic product planning tive! (2014) Lecture Notes in Computer Science stages. (2013) IEEE International Conference on KPENWFKPIUWDUGTKGU.GEVWTG0QVGUKP#TVKƄEKCN Industrial Engineering and Engineering Manage- +PVGNNKIGPEGCPF.GEVWTG0QVGUKP$KQKPHQTOCVKEU OGPVCTVPQRR .0%5 2#46 RR ■ 4QGNQHUGP,(WEJU5&(WEJU&-.KPFGOCPP ■ 8QP5CWEMGP%/KEJCKNKFQW+.KPFGOCPP7 U.: Implementing an internal development process Emotional mental model. (2013) IEEE International benchmark using PDM-data. (2014) Competitive Conference on Industrial Engineering and Engineer- Design – Proceedings of the 19th CIRP Design KPI/CPCIGOGPVCTVPQRR %QPHGTGPEGRR ■ 8QP5CWEMGP%/KEJCKNKFQW+.KPFGOCPP7 ■ 4QVJ/-CURGTGM&.KPFGOCPP7 (WPEVKQPCN How to design experiences: Macro UX versus CPCN[UKUCPFOQFGNKPIQHEQORNGZGXQNWVKQPCT[ Micro UX approach. (2013) Lecture Notes in ITQYPOGEJCVTQPKERTQFWEVU +'''+PVGT- Computer Science (including subseries Lecture national Conference on Industrial Engineering and 0QVGUKP#TVKƄEKCN+PVGNNKIGPEGCPF.GEVWTG0QVGUKP 'PIKPGGTKPI/CPCIGOGPVCTVPQ $KQKPHQTOCVKEU .0%5 2#46 RR pp. 346-350. ■ 4QVJ/-CURGTGM&.KPFGOCPP7 +FGPVKH[KPI the adequate level of abstraction within structural modeling. (2014) 8th Annual IEEE International 5[UVGOU%QPHGTGPEG5[U%QPs2TQEGGFKPIU CTVPQRR 136 Institute of Product Development Institute of Automatic Control Model based analysis and design are ‘enablers’ to successful control of complex dynamical systems ■6JGKPUVKVWVGKUCEVKXGKPOGVJQFUFGXGNQROGPVCPFCRRNKECVKQP0GY OGVJQFUQHPQPNKPGCTEQPVTQNGPGTI[DCUGFOQFGNKPICPFFGUKIPOQFGN QTFGTTGFWEVKQPCFCRVKXGCPFRTGFKEVKXGEQPVTQNCTGFGXGNQRGFKPQTFGT VQUWRRQTVCPGHƄEKGPVEQPVTQNQHVGEJPKECNU[UVGOU9KVJKPC%QNNCDQTCVKXG 4GUGCTEJ%GPVTGOGVJQFUCTGFGXGNQRGFVQGXGPOQFGNCPFCPCN[\G PQPVGEJPKECNRTQEGUUGU*KIJN[EJCNNGPIKPICRRNKECVKQPUCTGKPCWVQOQ- VKXGCPFXKDTCVKQPRTQDNGOUKPTQDWUVOWNVKEQRVGTƅKIJVEQPVTQNWPUVCDNG TQDQVUEQPVTQNCPFKPHGGFDCEMEQPVTQNQHKPFWUVTKCNRTQEGUUGU Prof. Dr.-Ing. habil. Active and Semi-active Suspension Control Boris Lohmann 6JKUTGUGCTEJƄGNFFGCNUYKVJVJGEQPƄ- Contact IWTCVKQPCPFEQPVTQNQHCEVKXGUWURGPUKQP YYYTVOYVWOFG U[UVGOUKPXGJKENGU6JGOCKPVCUMUCTGC UGMTGVCTKCV"TVOYVWOFG YKFGOKPKOK\CVKQPQHXKDTCVKQPUCEVKPIQP 2JQPG RCUUGPIGTUCPFVJGTGFWEVKQPQHWREQO KPIF[PCOKEYJGGNNQCFFGXKCVKQPUYJKNG EQORN[KPIYKVJVJGVGEJPKECNDQWPFCT[ EQPFKVKQPU6JGRQUUKDKNKVKGUQHUVCPFCTF RCUUKXGUWURGPUKQPU[UVGOUCTGNKOKVGF FWGVQVJGEQPƅKEVQHQDLGEVKXGUKPVJG FGUKIPRTQEGUU UGGEQPƅKEVFKCITCO +PVTQFWEKPICEVKXGCPFQTUGOKCEVKXG UWURGPUKQPEQORQPGPVUVQIGVJGTYKVJCP 'ZRGTKOGPVUCTGRGTHQTOGFCVVYQSWCTVGTECTVGUV UVCPFUCXCKNCDNGKPVJG+PUVKVWVGQH#WVQOCVKE%QPVTQN CRRTQRTKCVGEQPVTQNUVTCVGI[CNNQYUDGVVGT TGURQPUGVQTQCFFKUVWTDCPEGUUQVJCV TKFGEQOHQTVCPFTQCFJQNFKPICDKNKVKGUCTG %QPƅKEVFKCITCOHQTFKHHGTGPVUWURGPUKQPEQPƄIWTC- UKIPKƄECPVN[KORTQXGF VKQPU Vibration Control in the Drive Train #TQVCVKPIOGEJCVTQPKECEVWCVQTKPVGITCVGF KPVQVJGVYQOCUUƅ[YJGGNECPUKIPKƄ- ECPVN[TGFWEGVJGKPƅWGPEGQHGPIKPG KPFWEGFXKDTCVKQPKPVJGFTKXGVTCKPYJKNG 6YQOCUUƅ[YJGGNYKVJKPVGITCVGFOGEJCVTQPKE MGGRKPIGPGTI[EQPUWORVKQPNQY CEVWCVQT Institute of Automatic Control 137 Model-based Control in Electro-Chemical Machining RQNCTK\GFOGVCNNKEECVJQFGYKVJCFGƄPGF UJCRG VQQNGNGEVTQFG KUCFXCPEGF VQYCTFUVJGOGVCNNKECPQFG YQTMRKGEG YJKNGVJGKPVGTGNGEVTQFGICRKUƄNNGFYKVJ UWKVCDNGGNGEVTQN[VG6JGYQTMRKGEGKUVJGP UJCRGFD[EQPVTQNNGFCPQFKEFKUUQNWVKQP $[UVCVGQDUGTXCVKQPCPFUQRJKUVKECVGF CWVQOCVKEEQPVTQNVJGRGTHQTOCPEGKU 'NGEVTQEJGOKECNOCEJKPKPIUGVWR 'NGEVTQEJGOKECNOCEJKPKPIKUCPQP UKIPKƄECPVN[KORTQXGF KPEQQRGTCVKQP CPFQRGTCVKPIRTKPEKRNG EQPXGPVKQPCNOGVCNOCEJKPKPIVGEJPKSWG YKVJVJG+PUVKVWVGQH/CVGTKCNU5EKGPEGCPF DCUGFQPGNGEVTQN[UKU#PGICVKXGN[ /GEJCPKEUQH/CVGTKCNU Parametric Model Order Reduction 6JGOCKPIQCNQHRCTCOGVTKEOQFGN QTFGTTGFWEVKQPQHNKPGCTU[UVGOUKUVQ ƄPFCOWEJUOCNNGT TGFWEGF OQFGN VJCVRTGUGTXGUVJGRCTCOGVGTFGRGP- FGPE[VJWUCNNQYKPICXCTKCVKQPQHCP[ QHVJGRCTCOGVGTUYKVJQWVVJGPGGFVQ TGRGCVVJGTGFWEVKQPUVGR+PCFFKVKQP VJGOGVJQFUUJQWNFDGPWOGTKECNN[ GHƄEKGPVVQDGUWKVCDNGHQTVJGTGFWEVKQP QHNCTIGUECNGU[UVGOUCPFCVVJGUCOG VKOGKVUEQORWVCVKQPCNEQUVUJQWNFDG NQYGPQWIJVQMGGRVJGTGFWEVKQPUVGR +55CUCPGZCORNGQHCJKIJQTFGTƅGZKDNGUVTWEVWTG PWOGTKECNN[LWUVKƄGF 2JQVQ 0#5# Energy Based Modeling and Control 6JGTGUGCTEJQPFKHHGTGPVCURGEVUQH GPGTI[DCUGFOGVJQFUHQTOQFGNKPI CPFEQPVTQNJCUDGGPCOCLQTVQRKECV VJG+PUVKVWVGQH#WVQOCVKE%QPVTQNKPVJG NCUVHGY[GCTU7UKPIGPGTI[CUVJGNKPM DGVYGGPRJ[UKECNFQOCKPUGPGTI[DCUGF CRRTQCEJGUNKMGVJGRQTV*COKNVQPKCP HQTOCNKUORTQXKFGCWPKH[KPIHTCOGYQTM HQTKPVGTFKUEKRNKPCT[OQFGNKPIQHEQORNGZ F[PCOKECNU[UVGOU4GNGXCPVƄGNFUQH CRRNKECVKQPCTGTQDQVKEUCPFVJGQRGTCVKQP 6YQWPUVCDNGF[PCOKEU[UVGOUCUGZRGTKOGPVCNUGVWRU QHPGVYQTMUQHVTCPUOKUUKQPU[UVGOU HQTGPGTI[DCUGFEQPVTQNCPF6CMCIK5WIGPQFGUKIP 138 Institute of Automatic Control Switched Systems Control and Takagi-Sugeno Systems 5YKVEJKPIEQPVTQNNGT CTEJKVGEVWTG 5YKVEJGFU[UVGOUCTGQHRTCEVKECN DCUGFCUYGNNCU6CMCIK5WIGPQOQFGN TGNGXCPEGKPPWOGTQWUƄGNFU1PVJG DCUGFCRRTQCEJGUCTGFGXGNQRGF QPGJCPFOCP[VGEJPKECNU[UVGOUECP 9KVJKPVJG%QNNCDQTCVKXG4GUGCTEJ%GPVTG DGFGUETKDGFD[VJKUMKPFQHOQFGNU1P n<[MNGPOCPCIGOGPVXQP+PPQXCVKQPU- VJGQVJGTJCPFEQORCTGFVQVTCFKVKQPCN RTQ\GUUGPoQHVJG)GTOCP4GUGCTEJ EQPVTQNOGVJQFUEQPUKFGTCDNGRGTHQT- %QWPEKN &() VJGOQFGNKPICPFCPCN[UKU OCPEGDGPGƄVUECPDGCEJKGXGFD[WUKPI QHPQPVGEJPKECNF[PCOKECNU[UVGOUKU UYKVEJKPIEQPVTQNNGTUVTWEVWTGU'PGTI[ KPXGUVKICVGF Research Focus Courses ■ 0QPNKPGCTEQPVTQNVJGQT[ ■ 4GIGNWPIUVGEJPKM $CEJGNQT/9 ■ 'PGTI[DCUGFOQFGNNKPICPFEQPVTQN ■ #FXCPEGF%QPVTQN /CUVGT/52' ■ /QFGNTGFWEVKQP ■ 5[UVGOVJGQTKGKPFGT/GEJCVTQPKM ■ #WVQOQVKXGCPFCEVKXGXKDTCVKQPEQPVTQN $CEJGNQT/9 ■ /QFGTPG/GVJQFGPFGT4GIGNWPIU- Competence VGEJPKMDKU /CUVGT ■ /GEJCVTQPKEU[UVGOUFGUKIPCPF ■ 0QPNKPGCT%QPVTQN /52' EQPVTQN ■ #DVCUVTGIGNWPIWPF%QORWVGT#NIGDTC ■ (GGFDCEMEQPVTQNKPRTQFWEVKQP /CUVGT U[UVGOU ■ %QPVTQNCPFQRVKOK\CVKQP ■ /QFGNKPICPCN[UKUCPFEQPVTQNQH VGEJPKECNCPFPQPVGEJPKECNRTQEGUUGU ■ #FCRVKXGCPFOQFGNRTGFKEVKXGEQPVTQN ■ /QFGNKPICPFOQFGNCPCN[UKU Infrastructure ■ 6YQSWCTVGTECTVGUVUVCPFU ■ &KXGTUGOGEJCVTQPKEVGUVTKIU ■ %QPVTQNU[UVGOUFGUKIPNCD ■ 'NGEVTKECNCPFOGEJCPKECNYQTMUJQR Institute of Automatic Control 139 Management &KRN+PI-NCWU,&KGRQNF 2TQH&T+PI$QTKU.QJOCPP&KTGEVQT &KRN+PI1NKXGT(TKVUEJ &KRN+PI/CVVJKCU)GW»/5E Administrative Staff 4KEJCTF-GTP/5E 4GIKPG/CTMYQTV &KRN+PI6QDKCU-NQKDGT &KRN+PI2JKNKRR0KGTOG[GT Research Scientists &KRN+PI*GKMQ2CP\GT &T+PI2CWN-QV[E\MC *GCFQH'PGTI[ &KRN+PI2GVGT2JKNKRR $CUGF%QPVTQN)TQWR &KRN+PI0KNU2NGVUEJGP -NCWU#NDGTV/5E &KRN+PI5GDCUVKCP5RKTM &KRN+PI5KOQP#NVOCPPUJQHGT &KRN+PI$GPLCOKP5VCJN &KRN+PI/CTMWU$QZJCOOGT &KRN+PI6JQOCU9QNH #NGUUCPFTQ%CUVCIPQVVQ/5E /CTKC%TW\8CTQPC/5E Technical Staff &KRN+PI5GTIKQ&GNICFQ 6JQOCU*WDGT &KRN+PI2CWN&G/QPVG 4CNH*ØDPGT Publications 2013-14 ■ $QZJCOOGT/ #NVOCPPUJQHGT5 /QFGN2TGFKE- ■ (TKVUEJ1 *GP\G$ .QJOCPP$ (CUVCPF VKXG%QPVTQNKP2WNUGF'NGEVTQEJGOKECN/CEJKPKPI 5CVWTCVKPI6JTWUV&KTGEVKQP%QPVTQNHQTC3WCFTQVQT ,QWTPCNQH2TQEGUU%QPVTQN *GNKEQRVGTCV#WVQOCVKUKGTWPIUVGEJPKM ■ $QZJCOOGT/ .W, /QFGNNKPICPF5VCVG 'UVKOCVKQPKP2WNUGF'%/YKVJ8CTKCDNG'NGEVTQN[VG ■ (TKVUEJ1 6TQODC& .QJOCPP$ %CUECFGF %QPFWEVKXKV[-G['PIKPGGTKPI/CVGTKCNU 'PGTI[$CUGF6TCLGEVQT[6TCEMKPI%QPVTQNQHC RR 3WCFTQVQTCV#WVQOCVKUKGTWPIUVGEJPKM ■ &G/QPVG2 .QJOCPP$ 2QUKVKQP6TCLGEVQT[ 6TCEMKPIQHC3WCFTQVQTDCUGFQP.#FCRVKXG ■ )GW»/ $WVPCTW& 2GJGTUVQTHGT$ $WPICTV\ %QPVTQNCV#WVQOCVKUKGTWPIUVGEJPKM * .QJOCPP$ 2CTCOGVTKE/QFGN1TFGT4GFWE- VKQPD[5RCTUG)TKF$CUGF+PVGTRQNCVKQPQP/CVTKZ ■ &G/QPVG2 .QJOCPP$ 2QUKVKQP6TCLGEVQT[ /CPKHQNFUHQT/WNVKFKOGPUKQPCN2CTCOGVGT5RCEGU 6TCEMKPIQHC3WCFTQVQT*GNKEQRVGTDCUGFQP. 2TQEGGFKPIUQHVJG'WTQRGCP%QPVTQN%QPHGTGPEG #FCRVKXG%QPVTQN2TQEGGFKPIUQHVJG'WTQRGCP %QPVTQN%QPHGTGPEG ■ )GW»/ %JQK% .QJOCPP$ %QPVTQNQH ■ &G/QPVG2 .QJOCPP$ 6TCLGEVQT[6TCEMKPI 2CTCOGVGTFGRGPFGPV*KIJQTFGT5[UVGOUWUKPI %QPVTQNHQTC3WCFTQVQT*GNKEQRVGTDCUGFQP 2CTCOGVTKE/QFGN4GFWEVKQPCV#WVQOCVKUKGTWPIU- $CEMUVGRRKPIWUKPIC&GEQWRNKPI3WCVGTPKQP2CTC- VGEJPKM OGVTK\CVKQP2TQEGGFKPIUQHVJG+'''/GFKVGTTCPGCP ■ )GW»/ 2CP\GT* %NKHHQTF+ .QJOCPP$ %QPHGTGPEGQP%QPVTQNCPF#WVQOCVKQP 2CTCOGVTKE/QFGN1TFGT4GFWEVKQP7UKPI2UGWFQ ■ &GNICFQ5 -QV[E\MC2 1XGTEQOKPIVJG KPXGTUGUHQTVJG/CVTKZ+PVGTRQNCVKQPQH&KHHGTGPVN[ &KUUKRCVKQP%QPFKVKQPKP2CUUKXKV[$CUGF%QPVTQNHQT 5K\GF4GFWEGF/QFGNU2TQEGGFKPIUQHVJGVJ C%NCUUQH/GEJCPKECN5[UVGOU2TQEGGFKPIUQHVJG +(#%9QTNF%QPITGUU VJ+(#%9QTNF%QPITGUU ■ )GW»/ 2CP\GT* .QJOCPP$ 1P2CTCOGVTKE ■ &KGRQNF-, #NDGTU# )WIIGOQU6 (NCEJ- /QFGN1TFGT4GFWEVKQPD[/CVTKZ+PVGTRQNCVKQP JGKVUDCUKGTVG6TCLGMVQTKGPQRVKOKGTWPIGPVNCPI 2TQEGGFKPIUQHVJG'WTQRGCP%QPVTQN%QPHGTGPEG XQP9GIRWPMVGPHØTGKPNKPGCTGU$CNNDQV5[UVGO CV#WVQOCVKUKGTWPIUVGEJPKM ■ )GW»/ 2CP\GT* 9QNH6 .QJOCPP$ ■ &KGRQNF-, #NDGTV- .QMCNG5VCDKNKVÀVUCPCN[UG 5VCDKNKV[2TGUGTXCVKQPHQT2CTCOGVTKE/QFGN1TFGT XQP6CMCIK5WIGPQ5[UVGOGPWPVGT$GTØEMUKEJ- 4GFWEVKQPD[/CVTKZ+PVGTRQNCVKQP2TQEGGFKPIUQH VKIWPIKJTGU)ØNVKIMGKVUDGTGKEJUCV#WVQOCVKUKG- VJG'WTQRGCP%QPVTQN%QPHGTGPEG TWPIUVGEJPKM s ■ )KHVVJCNGT/ 9QNH6 2CP\GT* .QJOCPP$ ■ &KGRQNF-, 2KGE\QPC5, 6TCEMKPI%QPVTQNYKVJ 2CTCOGVTKE/QFGN1TFGT4GFWEVKQPQH2QTV*COKNVQ- #FCRVKXGN[#NNQECVGF/CZKOWO+PRWV#ORNKVWFGU PKCP5[UVGOUD[/CVTKZ+PVGTRQNCVKQPCV#WVQOCVK- CPF'PNCTIGF&QOCKPQH#VVTCEVKQPHQT.KPGCT UKGTWPIUVGEJPKM 5[UVGOU2TQEGGFKPIUQHVJG+'''%QPHGTGPEG ■ -QEJ) -NQKDGT6 &TKXKPIUVCVGCFCRVKXGEQPVTQN QP&GEKUKQPCPF%QPVTQN(NQTGPEG+VCN[ QHCPCEVKXGXGJKENGUWURGPUKQPU[UVGO+''' ■ (CNEQPK) (TKVUEJ1 .QJOCPP$ *QN\CRHGN 6TCPUCEVKQPUQP%QPVTQN5[UVGOU6GEJPQNQI[ ( #FOKUUKDNG6JTWUV%QPVTQN.CYUHQT3WCFTQVQT 2QUKVKQP6TCEMKPI2TQEGGFKPIUQHVJG#OGTKECP ■ -QV[E\MC2$TCPFUVÀVGT5 +PXGTUKQPDCUGF %QPVTQN%QPHGTGPEG6JGRCRGTTGEGKXGFVJG HGGFHQTYCTFEQPVTQNHQTFKUETGVK\GFRQTV*COKNVQPKCP $GUV2TGUGPVCVKQPKP5GUUKQP#YCTF U[UVGOU2TQEGGFKPIUQHVJGUV+PVGTPCVKQPCN ■ (TKVUEJ1 *GP\G$ .QJOCPP$ (CUVCPF 5[ORQUKWOQP/CVJGOCVKECN6JGQT[QH0GVYQTMU 5CVWTCVKPI#VVKVWFG%QPVTQNHQTC3WCFTQVQT CPF5[UVGOU /605 *GNKEQRVGT2TQEGGFKPIUQHVJG'WTQRGCP%QPVTQN %QPHGTGPEG 140 Institute of Automatic Control ■ -QV[E\MC2 &KUETGVK\GFOQFGNUHQTPGVYQTMUQH ■ 2JKNKRR2 5EJPGKFGT/ #&GEGPVTCNK\GF/QXKPI FKUVTKDWVGFRCTCOGVGTRQTV*COKNVQPKCPU[UVGOU *QTK\QP1DUGTXGTHQT&KUVTKDWVGF+ORNGOGPVCVKQP 2TQEGGFKPIUQHVJGVJ+PVGTPCVKQPCN9QTMUJQRQP QH%GPVTCNK\GF%QPVTQNNGTU2TQEGGFKPIUQHVJG /WNVKFKOGPUKQPCN5[UVGOU P&5 #OGTKECP%QPVTQN%QPHGTGPEG ■ -QV[E\MC2 .QECNNKPGCTF[PCOKEUCUUKIPOGPVKP ■ 2NGJP% -QEJ, &KGRQNF-, 5VCJN$ +$%#WVQOCVKEC .QJOCP$ 4GKPJCTV) <ÀJ/ /QFGNKPICPF ■ -QV[E\MC2 1PVJGHGGFHQTYCTFEQPVTQNRTQDNGO CPCN[\KPIF[PCOKEE[ENGPGVYQTMUKPRTQFWEVKQP HQTFKUETGVK\GFRQTV*COKNVQPKCPU[UVGOU2TQ- RNCPPKPI2TQEGFKC%+42sTF%+42)NQDCN9GD EGGFKPIUQHVJGVJ+(#%9QTNF%QPITGUU %QPHGTGPEGQP2TQFWEVKQP'PIKPGGTKPI4GUGCTEJ #FXCPEGOGPVDG[QPFUVCVGQHVJGCTV ■ -QV[E\MC2 5CTTCU+ 1PVJGGSWKXCNGPEGQHVYQ ■ 2NGVUEJGP0 $CFWT2 0QPNKPGCT5VCVG'UVKOCVKQP PQPNKPGCTEQPVTQNCRRTQCEJGU +OOGTUKQPCPF+PXCTK- KP5WURGPUKQP%QPVTQN$CUGFQP6CMCIK5WIGPQ CPEGCPF+$%'WTQRGCP,QWTPCNQH%QPVTQN /QFGN2TQEGGFKPIUQHVJGVJ+(#%9QTNF%QP- 5RGEKCN+UUWGQP.CITCPIKCP/GVJQFUHQT0QPNKPGCT ITGUU6JGRCRGTYCUCYCTFGF %QPVTQN CP*QPQWTCDNG/GPVKQPCUQPGQHƄXGƄPCNKUVRCRGTU ■ -WINGT- 5VCJN$ &KGRQNF-, 4GKH, .QJ- HQTVJG;QWPI#WVJQT2TK\G OCPP$ $TQFDGEM( <[MNKUEJG6GCORTQ\GUUG ■ 2NGVUEJGP0 5RKTM5 .QJOCPP$ (TG- WPF+PPQXCVKQPUNGKUVWPIsGKPGCWH(W\\[.QIKM SWGPE[5GNGEVKXG#FCRVKXG%QPVTQNQHC*[DTKF DCUKGTVG/QFGNNKGTWPIYGEJUGNUGKVKIGT$G\KGJWPIGP 5WURGPUKQP5[UVGO2TQEGGFKPIUQHVJGVJ+(#% XGTUEJKGFGPGT2TQ\GUURJCUGP-QPITGUUFGT 5[ORQUKWOQP#FXCPEGUKP#WVQOQVKXG%QPVTQN &GWVUEJGP)GUGNNUEJCHVHØT2U[EJQNQIKG 6QM[Q,CRCP ■ 2CP\GT* ,CGPUEJ5 9QNH6 .QJOCPP$ # ■ 5RKTM5 *W% 6TCMVKQPUQTKGPVKGTVG4GIGNWPI )TGGF[4CVKQPCN-T[NQX/GVJQFHQT*2UGWFQ- CMVKXGT(CJTYGTMGOKVVGNU5VTC»GPRTQƄNCDVCUVWPI QRVKOCN/QFGN1TFGT4GFWEVKQPYKVJ2TGUGTXCVKQP QFGTTCFUVCPFDCUKGTVGT5EJÀV\WPI8&+8&' QH5VCDKNKV[2TQEGGFKPIUQHVJG#OGTKECP%QPVTQN (CEJVCIWPI#WVQTGIs5VGWGTWPIWPF4GIG- %QPHGTGPEG6JGRCRGTTGEGKXGFVJG$GUV NWPIXQP(CJT\GWIGPWPF/QVQTGP 8&+$GTKEJVG 2TGUGPVCVKQPKP5GUUKQP#YCTF 8&+6CIWPIUDÀPFG 8&+8GTNCI ■ 2CP\GT* 9QNH6 .QJOCPP$ *ACPF*AKPƄPKV[ ■ 5VCJN$ &KGRQNF-, 2QJN, )TGKVGOCPP, 'TTQT$QWPFUHQT/QFGN1TFGT4GFWEVKQPQH5GEQPF 2NGJP% -QEJ, .QJOCPP$ 4GKPJCTV) 1TFGT5[UVGOUD[-T[NQX5WDURCEG/GVJQFU /QFGNKPI%[ENKE+PVGTCEVKQPUYKVJKPC2TQFWEVKQP 2TQEGGFKPIUQHVJG'WTQRGCP%QPVTQN%QPHGTGPEG 'PXKTQPOGPVWUKPI6TCPUKVKQP#FCRVKXG4GEWTTGPV (W\\[5[UVGOU2TQEGGFKPIUQHVJG+(#%%QP- ■ 2CP\GT* 9QNH6 .QJOCPP$ 'TTQT%QPVTQNNGF HGTGPEGQP/CPWHCEVWTKPI/QFGNNKPI/CPCIGOGPV /QFGN1TFGT4GFWEVKQPQH5GEQPF1TFGT5[UVGOU CPF%QPVTQN YKVJ#FCRVKXG%JQKEGQH5JKHVUCPF1TFGT2TQ- ■ 9QNH6 2CP\GT* %WOWNCVKXGOQFGNQTFGT EGGFKPIUKP#RRNKGF/CVJGOCVKEUCPF/GEJCPKEU TGFWEVKQPCPFUQNWVKQPQH.[CRWPQXGSWCVKQPUWUKPI -T[NQXUWDURCEGUCPFCFCRVKXGUJKHVUGNGEVKQP ■ 2GNNGITKPK' 5RKTM5 &KGRQNF-, &GUUQTV4 PF9QTMUJQRQP/QFGN4GFWEVKQPQH%QORNGZ .QJOCPP$ 0QPNKPGCT%QPVTQNQHC5GOK#EVKXG &[PCOKECN5[UVGOU /QF4GF 5WURGPUKQP5[UVGO%QPUKFGTKPI#EVWCVQTCPF5VCVG ■ 9QNH6 2CP\GT* .QJOCPP$ *2UGWFQ %QPUVTCKPVU7UKPI/GVJQFUQH1RVKOCN%QPVTQN2TQ- 1RVKOCNKV[KP/QFGN1TFGT4GFWEVKQPD[-T[NQX EGGFKPIUQHVJG#OGTKECP%QPVTQN%QPHGTGPEG 5WDURCEG/GVJQFU2TQEGGFKPIUQHVJG'WTQRGCP s6JGRCRGTTGEGKXGFVJG$GUV2TGUGPVCVKQPKP %QPVTQN%QPHGTGPEG 5GUUKQP#YCTF ■ 9QNH6 2CP\GT* .QJOCPP$ /QFGN1TFGT ■ 2ƅGIJCCT, .QJOCPP$ 6JG'NGEVTKECN&WCN/CUU 4GFWEVKQPD[#RRTQZKOCVG$CNCPEGF6TWPECVKQP # (N[YJGGNsCP'HƄEKGPV#EVKXG&CORKPI5[UVGO 7PKH[KPI(TCOGYQTMCV#WVQOCVKUKGTWPIUVGEJPKM 2TQEGGFKPIUQHVJGVJ+(#%5[ORQUKWOQP #FXCPEGUKP#WVQOQVKXG%QPVTQN ■ 9QNH6 2CP\GT* .QJOCPP$ 1PVJG4GUKFWCN ■ 2ƅGIJCCT, .QJOCPP$ 6JG'NGEVTQ&WCN/CUU QH.CTIG5ECNG.[CRWPQX'SWCVKQPUHQT-T[NQX (N[YJGGNs'HƄEKGPVCEVKXGFCORKPIQHVQTUKQPCN $CUGF#RRTQZKOCVG5QNWVKQPU2TQEGGFKPIUQHVJG FTKXGVTCKPQUEKNNCVKQPU#WVQTGI8&+$GTKEJVG #OGTKECP%QPVTQN%QPHGTGPEG Institute of Automatic Control 141 Institute of Micro Technology and Medical Device Technology %QORWVCVKQPCNFGUKIPCPFTCRKFOCPWHCEVWTKPIQHEGTVKƄGFFGXKEGUOGEJCPKUOUCPFTQDQVU ■ The focus of the Institute of Micro Technology and Medical Device Technology is to accelerate the process of developing ideas into pro- ducts. In research and science, the time required for implementation is CUKIPKƄECPVHCEVQTHQTUWEEGUU6JGTGHQTGTCRKFRTQVQV[RKPICPFTCRKF manufacturing technologies are part of our main research interest. We are systematically developing and analyzing new rapid technologies, as well as applying them in the areas of precision engineering, micro tech- nology and medical device technology. We are systematically validating QWTTGUGCTEJFGXKEGUVQCEJKGXGTGNKCDNGUEKGPVKƄETGUWNVU+PVJGCTGC of medical technology, we develop according to ISO 13485, certify our Prof. Dr. Tim C. Lüth devices according to MDD/FDA and perform clinical studies according to +51| Contact 1PGJKIJNKIJVKP1EVQDGTYCUEGTVCKPN[ YYYOKOGFOYVWOFG VJGEQOOGTEKCNNCWPEJQHVJGPGYCFFKVKXG UGMTGVCTKCV"OKOGFFG 2JQPG RTQFWEVKQPU[UVGO &RTKPVGT#TDWTIHTGG- HQTOGT6JKUU[UVGOGPCDNGURTQFWEVKQPQH HWNN[HWPEVKQPCNRNCUVKERCTVUWUKPIVJGPGY CFFKVKXGOCPWHCEVWTKPIVGEJPKSWGHTQO& %#&ƄNGUQWVQHUVCPFCTFITCPWNCVGUCPF YKVJQWVCOQNF #4$74)RNCUVKEHTGGHQT- OKPIs#-(6JGTGHQTGKVQHHGTUDQWPFNGUU HTGGFQOKPVJGGHƄEKGPVRTQFWEVKQPQH KPFKXKFWCNRCTVUKPUOCNNXQNWOGDCVEJGU 6JKUFGXKEGJCUDGGPFGXGNQRGFKPENQUG EQQRGTCVKQPYKVJ/K/GF +P&GEGODGTQWTCNWOPWU&T+PIQ 'FGTGTHTQOVJGEQORCP[XQZGNLGVYCU JQPQTGFYKVJVJGVKVNGn67/'PVTGRTGPGWT QHVJG;GCToHQTJKUGPQTOQWUCEJKG- XGOGPVUKP&RTKPVKPIVGEJPQNQI[ FRTKPVKPI HTGGHQTOGT #TDWTI Mechatronic Devices for Clinical Interventions – CAS – SRS HQTVJGRCVKGPVU6QFC[oUEJCNNGPIGUHQT RJ[UKEKCPUFWTKPIRTQEGFWTGUCTGVJGNCEM QHOQDKNKV[KPVJGƅGZKDNGKPUVTWOGPVUWUGF KPUKFGVJGJWOCPDQF[2TKOCTKN[VJGCDKNKV[ VQOCPKRWNCVGVKUUWGHTQOFKHHGTGPVUKFGU VTKCPIWNCVKQPQHKPUVTWOGPVU PGGFUVQDG OCFGRQUUKDNG 9KVJQWTUKPINGRQTVTQDQVU[UVGOYGCTG HQNNQYKPICPGYRCVJVQFGXGNQRCU[UVGO &RTKPVGFƅGZKDNGUKPINGRQTVU[UVGO /K/GF for minimally-invasive surgery by using CFFKVKXGOCPWHCEVWTKPIOGVJQFUNKMG The goal in minimally-invasive surgery UGNGEVKXGNCUGTUKPVGTKPI 5.5 $[WUKPI through a single incision, such as NOTES 5.5KVKUHGCUKDNGVQETGCVGTKIKFUVTWEVWTGU PCVWTCNQTKƄEGVTCPUNWOKPCNGPFQUEQRKE YKVJNQECNƅGZWTGJKPIGUOQPQNKVJKECNN[ UWTIGT[ QTUKPINGRQTVUWTIGT[KUVQTGFWEG VJCVCTGEWUVQOOCFGCFCRVKQPUHQT VJGQRGTCVKXGCPFRQUVQRGTCVKXGUVTGUU FKHHGTGPVV[RGUQHRCVKGPVCPFUWTIKECN 142 Institute of Micro Technology and Medical Device Technology RTQEGFWTGU6QCFCRVQWTU[UVGOUVQ ■ $/$(RTQLGEVn5WTIKECNUQHVVKUUWGPCXK- FKHHGTGPVUVCPFCTFGPFQUEQRKEGSWKROGPV ICVKQPQHKPUVTWOGPVUCPFKPVTCQRGTCVKXG RTQEGFWTGUCPFRCVKGPVUYGWUGCWPKSWG KOCIKPIo RW\\NGENKROGEJCPKUOCPFVJGTGD[ETGCVG ■ Surgical navigation for veterinary CJKIJOQFWNCTK\CVKQPQHVJGU[UVGO6JG OGFKEKPG WUGFTCYOCVGTKCN2#CRQN[COKFG ■ $(5RTQLGEVn5WTIKECNNCUGTHQTFGPVCN DCUGFVJGTOQRNCUVKERQN[OGTKUEGTVKƄEC- KORNCPVQNQI[ 67//4+ o VGFCUDKQEQORCVKDNGCEEQTFKPIVQ&+0'0 ■ &()RCEMCIGTGUGCTEJn)TCFWCNN[ +516JKURTQXGUVJCVVJGRTQRQUGF CWVQOCVKQPKPUWTIGT[o /WPKEJ.GKR\KI /WNVK#TO5PCMG.KMG5.54QDQVU[UVGO ■ 1RVKOCNFGUKIPQHRTGEKUGUWTIKECN KUOWEJENQUGTVQDGKPIWUGFFWTKPI KPUVTWOGPVUHQTEQORWVGTCUUKUVGF OKPKOCNN[KPXCUKXGRTQEGFWTGUCPFJCUC UWTIGT[ %#5 high chance of reaching the ultimate goal ■ &()RTQLGEVn/GVJQFHQTGPFQNWOKPCN sENKPKECNEGTVKƄECVKQP YQWPFENQUWTGo /WPKEJ5VTCUDQWTI ■ &()RTQLGEVn#WVQOCVGFTGCNVKOG Projects KOCIKPIHQTNCRCTQUEQRKEKPVGTXGPVKQPUo ■ &()RTQLGEVn5KPINGRQTV5[UVGOHØT ■ &()RTQLGEVn5JCRGEQPVTQNQHƅGZKDNG ICUVTQGPVGTQNQIKUEJGXKU\GTCNEJKTWTIK- GPFQUEQRGUo UEJGGPFQUMQRKUEJG+PVGTXGPVKQPGPo ■ &()RTQLGEVn/KETQOCPKRWNCVQTHQT'06 ■ $/$(RTQLGEVn+PVTCQRGTCVKXGUQHV UWTIGT[o VKUUWGXKUWCNK\CVKQPUGIOGPVCVKQPCPF ■ &()RTQRQUCNn(WPEVKQPCNUKIPCNDCUGF VTGCVOGPVRNCPPKPIo RQYGTEQPVTQNQHCEVKXGKPUVTWOGPVUo 3D Printing – Direct Manufacturing – Rapid Manufacturing – Rapid Prototyping 5KPEG/K/'&VJG+PUVKVWVGQH/KETQ 6GEJPQNQI[CPF/GFKECN&GXKEG6GEJPQNQ I[JCUDGGPYQTMKPIKPVJGƄGNFQHFGUKIP RTQITCOOKPICPFCRRNKECVKQPQH&RTKPVKPI VGEJPQNQI[+PTGUGCTEJFKXGTUGVGEJPQ- NQIKGUUWEJCUHWUGFFGRQUKVKQPOQFGNKPI (&/ &RTKPVKPIUGNGEVKXGNCUGTUKPVGTKPI 5.5 UGNGEVKXGNCUGTOGNVKPI 5./ CPF FTQRKPLGEVKQPRTKPVKPI &+2 CTGWUGFQT KORTQXGF6JGEQORCP[XQZGNLGVHTQO #WIUDWTIKUCURKPQHHQHVJGKPUVKVWVG%QO- Fluid chambers build in silicon with laserablation RCPKGUUWEJCU#TDWTIHTQO.QUUDWTIWUG /K/GF QWTJCTFYCTGCPFUQHVYCTGVGEJPQNQIKGU 7UKPITCRKFVGEJPQNQIKGUCEJGOKECNTG- ■ &GXGNQROGPVQHCJKIJRTGUUWTG UKUVCPVRKG\QGNGEVTKECNN[FTKXGPOKETQFTQR JKIJVGORGTCVWTGRTKPVJGCF IGPGTCVQTECPDGHCDTKECVGFKPCEQUVCPF ■ *KIJVGORGTCVWTGUQNFGTRTKPVKPI VKOGUCXKPIOCPPGT6JWUKVKUGURGEKCNN[ ■ %JGOKECNTGUKUVCPVOKETQFTQRIGPGTCVQT UWKVCDNGCUCPGZRGTKOGPVCNRNCVHQTO ■ .CUGTUQWTEGKPFGRGPFGPVRCTCOGVGTU in micro-cutting Projects ■ (NWKFƅQYQHRQN[OGTOGNVU ■ &RTKPVKPIQHUVTWEVWTGUYKVJECNKDTCVGF ■ &RTKPVKPIQHEQPUVTWEVKXGOGEJCPKUOU stiffness ■ 56.RQUVRTQEGUUKPIHQT&RTKPVGTVCDNG ■ &RTKPVKPIQHOQFWNCTTQDQVKEU control ■ &RTKPVKPIQHOGEJCPKECNVGUVDQFKGU )CWIGU Institute of Micro Technology and Medical Device Technology 143 AgeTech 2020 – Technology for Aging Society 9GNKXGKPCYQTNFQHFTCUVKEEJCPIGU VJG DKTVJTCVGKP)GTOCP[JCUFTCOCVKECNN[ HCNNGP#VVJGUCOGVKOGQWTUQEKGV[KU UYKHVN[CIKPIYJKEJTGSWKTGUQWTDQFKGUVQ EQPVKPWGHWPEVKQPKPIHQTCNQPIGTRGTKQFQH VKOG6QFGCNYKVJVJGUGITGCVEJCNNGPIGU YGGZRGEVUEKGPEGCPFGPIKPGGTKPIVQ QXGTEQOGCP[RJ[UKQNQIKECNNKOKVCVKQPU KPENWFKPIDQFKN[OCNHWPEVKQPCPFFKUGC UGU+HOCPMKPFKUVQUWTXKXGCPFCFLWUV VQVJGUGEJCPIGUCUYGNNCUVQVJTKXG YGPGGFVQGZRNQTGPGYUQNWVKQPUVJCV /WIOGCUWTKPINKSWKFKPVCMG /K/GF QXGTEQOGPCVWTCNDKQNQIKECNEQPUVTCKPVU 6JG#IG6GEJ)TQWRJCUDGGPGUVCDNKUJGF KPGXKVCDN[KPETGCUGVJGPGGFHQTRTQHGU Wheelchair supporting patients to CVVJG(CEWNV[QH/KETQ6GEJPQNQI[CPF UKQPCNPWTUKPIJQOGU6JG#IG6GEJ)TQWR UVCPFWR /K/GF /GFKECN&GXKEG6GEJPQNQI[ /K/GF VQ UVWFKGUCPFFGXGNQRUKPFKXKFWCNK\GF RKQPGGTUVCVGQHVJGCTVVGEJPQNQIKECN OGEJCPKUOUHQTYJGGNEJCKTUCPFYGCT UQNWVKQPUVJCVCKOVQRTQNQPIVJGKPFGRGP CDNGTQDQVKEUVJCVEQORGPUCVGVJGUG FGPEGQHVJGGNFGTN[CPFUKOWNVCPGQWUN[ CIGTGNCVGFEQPUVTCKPVUUWEJCUOWUENG TGFWEGVJGFGOCPFKPIYQTMNQCFQHPWTUGU YGGMPGUUKPUVCDKNKV[GZJCWUVKQPQTUNQY KPRTQHGUUKQPCNPWTUKPIJQOGU TGƅGZGU%WTTGPVTGUGCTEJCNUQHQEWUGUQP 6JTQWIJIGPGTQWUHWPFKPID[VJG#NHTKGF RTGXGPVKQPQHFGJ[FTCVKQP6JGEQOOQP -TWRRXQP$QJNGPCPF*CNDCEJ5VKHVWPI FGETGCUKPIUGPUCVKQPQHVJKTUVKPVJG CUYGNNCUKPVGTPCVKQPCNEQNNCDQTCVKQPYKVJ GNFGT[ECPDGCJGCNVJVJTGCVCPFNGCFVQ TGEQIPK\GFTGJCDKNKVCVKQPEGPVGTUYGCTG HCVCNDQFKN[OCNHWPEVKQPKHPQVRTGXGPVGF CDNGVQRWTUWGKPVGTFKUEKRNKPCTTGUGCTEJKP CVCPGCTN[UVCIG6JG#IG6GEJITQWRKU VJGƄGNFQHCFXCPEGFVTCPUHGTCUUKUVCPEG FGXGNQRKPICPCWVQOCVGFU[UVGOYJKEJKU U[UVGOUHQTPWTUGUCPFYGCTCDNGTQDQVKEU CDNGVQOGCUWTGƅWKFKPVCMG+VEQPUKUVUQH VJCVCWIOGPVOWUEWNQUMGNGVCNFGIGPGTC CUOCTVEWRYJKEJOQPKVQTUFTKPMKPI VKQP&WGVQVJGPCVWTCNDKQNQIKECNCIKPI DGJCXKQT6JKUKPHQTOCVKQPECPDGCRRNKGF RTQEGUUJWOCPDGKPIUCTGGZRGTKGPEKPI CUFKTGEVHGGFDCEMVQVJGWUGTHCOKN[ CIGTGNCVGFJGCNVJEQPUVTCKPVUVJCV OGODGTUCPFPWTUKPIUVCHHKPECUGQH KPETGCUGVJGPGGFHQTRGTUQPCNECTGCPF KPUWHƄEKGPVƅWKFKPVCMG 144 Institute of Micro Technology and Medical Device Technology Research Focus Research Scientists ■ /GFKECNPCXKICVKQPCPFTQDQVKEU &KRN+PI-CUUKO#DFWN5CVGT ■ &RTKPVKPIQHTQDQVUCPFKPUVTWOGPVU (TCP\$CWGT/5E ■ #FFKVKXGRTQFWEVKQPVGEJPQNQI[ 5WCV%ÒOGTV/5E ■ /KETQVGEJPQNQIKECNRTQFWEVKQP &KRN+PI,QJCPPGU%Q[ ■ 5[PVJGUKUQHMKPGOCVKEU &T+PI.QTGP\Q&o#PIGNQ ■ #UUKUVCPEGU[UVGOUHQTCIKPIUQEKGV[ *QWFG&CK/5E %JTKUVKCP&KGV\/5E Competence &KRN/CVJ/CZ&KPINGT ■ #WVQOCVKE%#&EQPUVTWEVKQPOCVNCD 6CVKCPC'NKUGGXC/5E ■ 5[PVJGUKUQHLQKPVOGEJCPKUOU &KRN+PI-QPTCF'PVUHGNNPGT ■ &OGCUWTGOGPVVGEJPQNQI[ QRVKECN &KRN+PI%JGP(CPI '/ &KRN+PI/KEJCGN*QTRGT ■ 4QDQVKEU (TCP\KUMC-NGKP/5E ■ /GEJCVTQPKEEQPVTQN &KRN+PI'XC)TCH ■ 3WCNKV[OCPCIGOGPV +51 &KRN+PI,CP)WORTGEJV &KRN+PI/CTMWU-CIGTGT Infrastructure &KRN+PI,QCEJKO-TGWV\GT ■ 2TGEKUKQPOGEJCPKEUYQTMUJQR &KRN+PI+UOCKN-WTW +51 &KRN+PI6QDKCU.ØFFGOCPP ■ /KETQVGEJPQNQI[NCUGTVTGCVOGPV &KRN+PI*GPTKM.Ø»OCPP ■ #FFKVKXGOCPWHCEVWTKPIU[UVGOU &KRN+PI,CEQD0GWJÀWUGT &RTKPVKPI(&/5.5HTGGHQTOGT &KRN+PI6JQOCU1VVPCF ■ %GTVKƄGF'4 &KRN+PI,QPCU2HGKHHGT ■ 'NGEVTQPKEUYQTMUJQR ,GNGPC2TwC/5E *QPU 5COWGN4GKOGT/'PI Courses &KRN+PI&CPKGN4QRRGPGEMGT ■ /KETQU[UVGO6GEJPQNQI[ &KRN+PI&QOKPKM4WOUEJÒVVGN ■ /GFKECN&GXKEG6GEJPQNQI[ /CTVC5ECNK/5E ■ #WVQOCVKQPKP/GFKEKPG &KRN/CVJ,QJCPPGU5EJYCKIGT ■ #FOKUUKQPQH/GFKECN&GXKEGU &TVGEJP0KMKVC5JGXEJGPMQ ■ -KPGOCVKEU ,KCZK5JK/5E &KRN+PI/CVVKCU6TÀIGT Management ;CP Institute of Micro Technology and Medical Device Technology 145 2WDNKECVKQPU ■ )TCH'% 4QRRGPGEMGT&$ 6KGOCPP- ■ #DFWN5CVGT-.WGVJ6%+TNKPIGT( 5CORGT8& .WGVJ6% &GXGNQROGPVQH %QORWVGT#KFGF6CUM$CUGF-KPGOCVKE&GUKIPQH CP#PCVQOKE*GCTV/QFGNHQTVJG/KOKPCNN[+PXCUKXG .KPMCIGUs#0GY.GEVWTGHQT'PIKPGGTKPI5VWFGPVU %NQUWTGQHVJG.GHV#VTKCN#RRGPFCIG2TQEGGFKPIU KP (NQTGU2 'F VJ'WTQRGCP%QPHGTGPEGQP QHVJG+'''+PVGTPCVKQPCN%QPHGTGPEGQP4QDQVKEU /GEJCPKUO5EKGPEG '7%1/'5 /GEJCPKUO CPF$KQOKOGVKEU 41$+1 &GEGODGT CPF/CEJKPG5EKGPEG5RTKPIGT+PVGTPCVKQPCN $CNK+PFQPGUKCRR2&( 2WDNKUJKPI5YKV\GTNCPFRRs2&( ■ -CIGTGT/ /GGWY# $GTIGT, 4WOUEJQGV- ■ #DFWN5CVGT-.WGVJ6%+TNKPIGT( -KPG- VGN& .WGVJ6% +TNKPIGT( n4GNGXCPV OCVKE&GUKIPQH/KWTC1TK$CUGF(QNFKPI5VTWEVWTGU +PƅWGPEKPI(CEVQTUQP&TQRNGV%JCTCEVGTKUVKEUHQT 7UKPIVJG5ETGY#ZKUQHC4GNCVKXG&KURNCEGOGPV C2KG\QGNGEVTKECNN[&TKXGP&TQR1P&GOCPF2TKP- KP .GPCTìKì,-JCVKD1 'FU #FXCPEGUKP VJGCFo2TQEGGFKPIUQHVJG#5/'+PVGTPCVKQPCN 4QDQV-KPGOCVKEU5RTKPIGT+PVGTPCVKQPCN2WDNKUJKPI /GEJCPKECN'PIKPGGTKPI%QPITGUU'ZRQUKVKQP 5YKV\GTNCPFRR +/'%' 0QXGODGT/QPVTGCN ■ %Q[,# /GJTMGPU,* 4QRRGPGEMGT&$ %CPCFCRR2&( .WGVJ6% (KPFKPIVJG%GPVGTQH2CTMKP- ■ -COR/#DFWN5CVGT-+TNKPIGT(.WGVJ6% UQPoU&KUGCUG #0QXGN/GCUWTGOGPV&GXKEGHQT #WUNGIWPIWPF#WHDCWGKPGTURJÀTKUEJGP 3WCPVKH[KPI/QVQT5[ORVQOU&WTKPI&$55WTIGT[ 2CTCNNGN-KPGOCVKMHØT8KFGQGPFQUMQRG8&+ 2TQEGGFKPIUQHVJG+'''+PVGTPCVKQPCN%QPHGTGPEG )GVTKGDGVCIWPI$GYGIWPIUVGEJPKM5GRVGODGT QP4QDQVKEUCPF$KQOKOGVKEU 41$+1 0ØTVKPIGPRR2&( &GEGODGT$CNK+PFQPGUKCRR2&( ■ -TGWV\GT,- 5EJOKF4 4GKOGT5/( .WGVJ ■ &o#PIGNQ.6-TGWV\GT,(0GWJCGWUGT, 6% &o#PIGNQ.6 4CFKQ(TGSWGPE[ 4GKOGT5.WGVJ6% 2GTUQPCN#UUKUVKXG +FGPVKƄECVKQP$CUGF&GVGEVKQPQH(KNNKPI.GXGNUHQT &GXKEGUHQT'NFGTNKGUKP *QN\KPIGT# 146 Institute of Micro Technology and Medical Device Technology ■ 4GKOGT5/( .WGVJ6% &n#PIGNQ.6 ■ %Q[,# /K[CUJKVC- 'PVUHGNNPGT- )WORTGEJV +PFKXKFWCNK\GF#TO5JGNNU6QYCTFUCP'TIQPQOKE ,&, .WVJ6% (KTUVRWNNQWVUVTGPIVJ &GUKIPQH'ZQUMGNGVQP4QDQVU2TQEGGFKPIUQH+''' OGCUWTGOGPVUQHVJTGCFURTQFWEGFD[UGNGEVKXG +PVGTPCVKQPCN%QPHGTGPEGQP5[UVGOU/CPCPF NCUGTUKPVGTKPI+'''#5/'+PVGTPCVKQPCN%QPHGTGPEG %[DGTPGVKEU 5/% 1EVQDGT5CP&KGIQ QP#FXCPEGF+PVGNNKIGPV/GEJCVTQPKEU #+/ 9QN- 75#RR2&( NQPIQPI059#WUVTCNKC,WN[RR ■ 4GKOGT5/( 2HGKHHGT9. -TGWV\GT,( .WGVJ ■ &CK*1VVGP$/GJTMGPU,*&o#PIGNQ 6% &o#PIGNQ.6 'XCNWCVKQPQH2CVKGPV .6.WGVJ6% #0QXGN)NQXG/QPKVQTKPI 6TCPUHGT#UUKUVCPEG5[UVGOUHQT0WTUKPI2GTUQPPGN 5[UVGO7UGFVQ3WCPVKH[0GWTQNQIKECN5[ORVQOU CVC4GUKFGPVKCN*QOGHQTVJG'NFGTN[2TQEGGFKPIU &WTKPI&GGR$TCKP5VKOWNCVKQP5WTIGT[+''' QHVJG+'''+PVGTPCVKQPCN%QPHGTGPEGQP4QDQVKEU 5GPUQTU,QWTPCN CPF$KQOKOGVKEU 41$+1 &GEGODGT ■ &CK* &o#PIGNQ.6 #RQTVCDNGU[UVGOHQT $CNK+PFQPGUKCRR2&( SWCPVKVCVKXGCUUGUUOGPVQHRCTMKPUQPKCPDTCF[- ■ 4QRRGPGEMGT&$.WEKC5EJWUVGT,QJCPPGU MKPGUKCFWTKPIFGGRDTCKPUVKOWNCVKQPUWTIGT[KP #%Q[/CVVKCU(6TCGIGT-QPTCF'PVUHGNNPGT PF+PVGTPCVKQPCN%QPHGTGPEGQP#FXCPEGUKP .WGVJ6% /QFWNCT$QF[QHVJG/WNVK#TO $KQOGFKECN'PIKPGGTKPI +%#$/' 2TGUGPVGFCVVJG 5PCMG.KMG4QDQV PF+PVGTPCVKQPCN%QPHGTGPEGQP#FXCPEGUKP ■ 4WOUEJQGVVGN& -CIGTGT/ +TNKPIGT( .WGVJ $KQOGFKECN'PIKPGGTKPI +%#$/' RR 6% %QORCEV/QFGNHQTVJG%JCTCEVGTK\CVKQP ■ &CK* 1VVGP$ /GJTMGPU,* &o#PIGNQ.6 QHC2KG\QGNGEVTKE$GPF/QFG&TQRNGV)GPGTCVQT #RQTVCDNGU[UVGOHQTSWCPVKVCVKXGCUUGUU- 2TQEGGFKPIUQHVJG+'''+PVGTPCVKQPCN%QPHGTGPEG OGPVQHRCTMKPUQPKCPTKIKFKV[KP VJ#PPWCN QP4QDQVKEUCPF$KQOKOGVKEU 41$+1 International Conference of the IEEE Engineering in &GEGODGT$CNK+PFQPGUKCRR2&( /GFKEKPGCPF$KQNQI[5QEKGV[ '/$% 2TGUGPVGF ■ 4WOUEJQGVVGN& -CIGTGT/ .WGVJ6% +TNKPIGT CVVJGVJ#PPWCN+PVGTPCVKQPCN%QPHGTGPEG ( n%QORCEV/QFGNHQTVJG5VCVKECPF QHVJG+''''PIKPGGTKPIKP/GFKEKPGCPF$KQNQI[ &[PCOKE$GJCXKQTQHC2KGEQGNGEVTKE$KOQTRJ 5QEKGV[ '/$% RR #EVWCVQTHQT/KETQƅWKFKE/GOUo2TQEGGFKPIUQHVJG ■ 'PVUHGNNPGT- 6CWDGT4 4QRRGPGEMGT&$ #5/'+PVGTPCVKQPCN/GEJCPKECN'PIKPGGTKPI )WORTGEJV,&, 5VTCWUU).WGVJ6% %QPITGUU'ZRQUKVKQP +/'%' 0QXGODGT &GXGNQROGPVQH7PKXGTUCN)TKRRKPI#FCRVGTU /QPVTGCN%CPCFCRR2&( 5VGTKNG%QWRNKPIQH/GFKECN&GXKEGUCPF4QDQVU ■ 6TCGIGT/(4QRRGPGEMGT&$%Q[,(KQNMC 7UKPI4QDQVKE(KPIGTU+'''#5/'+PVGTPCVKQPCN #9KNJGNO&/GKPKPI#(GWUUPGT*.WGVJ %QPHGTGPEGQP#FXCPEGF+PVGNNKIGPV/GEJCVTQPKEU 6%(QTEGUKP/KPKOCNN[+PXCUKXG5WTIGT[ #+/ 9QNNQPIQPI059#WUVTCNKC,WN[ 4GNKCDNG/CPKRWNCVKQPQH)CUVTKE/WEQUCCPFVJG RR| 5KIOQKF%QNQP+P+'''+PVGTPCVKQPCN%QPHGTGPEGQP ■ )WORTGEJV,&, )GKIGT($ 5VQN\GPDWTI 4QDQVKEUCPF$KQOKOGVKEU 41$+1 $CNK+PFQPGUKC ,GPU7YG .WGVJ6% (NCV2CPGN7NVTCUQWPF RR VQDGRWDNKUJGF 2&( 4QDQV #0QXGN+OCIKPI%QPEGRVCPFC0QXGN ■ 6TCGIGT/(4QRRGPGEMGT&$,GPUGP$%CP /QVQTK\GF-KPGOCVKEUHQTCP7NVTCUQWPF2TQDG 5-PQNN#.WGVJ6%+PVGTFKUEKRNKPCT[ FWTKPI.CRCTQUEQRKE+PVGTXGPVKQPU+'''45, EQPEGRVQHFGUKIPCEVWCVKQPEQPVTQNCPFXKUKQP +PVGTPCVKQPCN%QPHGTGPEGQP+PVGNNKIGPV4QDQVUCPF EQORWVKPIQHCNCUGTUKPVGTGFUKPINGRQTVTQDQV+P 5[UVGOU +415 6QM[Q,CRCP0QXGODGT VJ+'''4#5'/$5+PVGTPCVKQPCN%QPHGTGPEGQP RR $KQOGFKECN4QDQVKEUCPF$KQOGEJCVTQPKEU+''' ■ )WORTGEJV,&, .WGVJ6% -JCOGUGG/KT$ RRs2&( 0CXKICVKQPQHCTQDQVKEECRUWNGGPFQUEQRG ■ 6TCGIGT/(4QRRGPGEMGT&$.GKPKPIGT/4 YKVJCPQXGNWNVTCUQWPFVTCEMKPIU[UVGO/KETQU[U- 5EJPQGU(.WGVJ6%&GUKIPQHC VGO6GEJPQNQIKGU+UUWGRR URKPGKPURKTGFMKPGOCVKEHQTVJGIWKFCPEGQHƅGZKDNG ■ -CIGTGT/ 'KNGT-. 1VVPCF6 +TNKPIGT( .WGVJ KPUVTWOGPVUKPOKPKOCNN[KPXCUKXGUWTIGT[+P 6% /KMTQVTQRHGPGT\GWIGT*GTIGUVGNNVOKV +'''45,+PVGTPCVKQPCN%QPHGTGPEGQP+PVGNNKIGPV 4CRKF/CPWHCEVWTKPI8GTHCJTGP2TQEGGFKPIUQHVJG 4QDQVUCPF5[UVGOU+'''RR2&( /KMTQ5[UVGO6GEJPKM-QPITGUU /56-QPITGUU ■ 6TCGIGT/(4QRRGPGEMGT&$.GKPKPIGT 1EVQDGT#CEJGP)GTOCP[RR /45EJPQGU(.WGVJ6% &GUKIPQHC URKPGKPURKTGFMKPGOCVKEHQTVJGIWKFCPEGQHƅGZKDNG ■ -CIGTGT/ *GNNGT$ .WGVJ6% +TNKPIGT( KPUVTWOGPVUKPOKPKOCNN[KPXCUKXGUWTIGT[+''' n1RVKOK\CVKQPQHVJG'NGEVTQ/GEJCPKECN +PVGTPCVKQPCN%QPHGTGPEGQP+PVGNNKIGPV4QDQVUCPF $GJCXKQWTQHC$KOQTRJ2KG\QGNGEVTKE#EVWCVQTHQT 5[UVGOU RR &TQR1P&GOCPF6GEJPKSWGU$CUGFQP(KPKVG 'NGOGPV/GVJQFo2TQEGGFKPIUQHVJG#5/' +PVGTPCVKQPCN/GEJCPKECN'PIKPGGTKPI%QPITGUU 'ZRQUKVKQP +/'%' 0QXGODGT ■ #DFWN5CVGT-+TNKPIGT(.WGVJ6% 5CP&KGIQ75#RR ■ (QWT2QUKVKQP5[PVJGUKUQH1TKICOK'XQNXGF -CIGTGT/ *WGFKI/.WGVJ6% +TNKPIGT 5RJGTKECNN[%QPUVTCKPGF2NCPCT44%JCKPU+HVQOO ( n/CPWCN/KETQCUUGODN[5[UVGOYKVJ +PVGTFKUEKRNKPCT[#RRNKECNVKQPUKP-KPGOCVKEU +PVGITCVGF5SWGGIGG&GXKEGHQT*QOQIGPQWUCPF 5GRVGODGT.KOC2GTW5RTKPIGTRRVQ &GƄPGF#FJGUKXG.C[GTUHQT$KOQTRJ2KG\QGNGEVTKE DGRWDNKUJGF #EVWCVQTU7UKPIKP&TQRQP&GOCPF6GEJPKSWGUo ■ #DFWN5CVGT-+TNKPIGT(.WGVJ6% 2TQEGGFKPIUQHVJG+'''+PVGTPCVKQPCN%QPHGTGPEG 6YQ%QPƄIWTCVKQP5[PVJGUKUQH1TKICOK)WKFGF QP4QDQVKEUCPF$KQOKOGVKEU 41$+1 2NCPCT5RJGTKECNCPF5RCVKCN4GXQNWVG4GXQNWVG &GEGODGT5JGP\JGP%JKPCRR %JCKPU#5/',QWTPCNQH/GEJCPKUOUCPF ■ 4QDQVKEU#WIWUV8QN -CIGTGT/ 4WOUEJQGVVGN& 1VVPCF6 .WGVJ6 ■ %Q[,# -WDCNN%/ 4QRRGPGEMGT&$ .WGVJ % +TNKPIGT( n(CUV&TQRNGV)GPGTCVKQP9KVJ 6% (NGZWTCN/QFWNWUQH.CUGTUKPVGTGF C2TKPVJGCF/CPWHCEVWTGFYKVJ4CRKFOCPWHCE- 2##5/'+PVGTPCVKQPCN/GEJCPKECN VWTKPI6GEJPKSWGU/QWPVGFQPC%CTTKGT$QCTFo 'PIKPGGTKPI%QPITGUU'ZRQUKVKQP+/'%' 2TQEGGFKPIUQHVJG#5/'+PVGTPCVKQPCN 5CP&KGIQ%#75#0QXGODGTRR /GEJCPKECN'PIKPGGTKPI%QPITGUU'ZRQUKVKQP +/'%' +/'%' 0QXGODGT5CP&KGIQ 75#RR Institute of Micro Technology and Medical Device Technology 147 ■ -TGWV\GT,( 2ƄV\GT/ &o#PIGNQ.6 ■ 4QRRGPGEMGT&$)TC\GM4%Q[,#+TNKPIGT( #EEWTCE[QHECTKPIRGTUQPPGNKPGUVKOCVKPIYCVGT .WGVJ6% (TKEVKQP%QGHƄEKGPVUCPF5WTHCEG KPVCMGDCUGFQPOKUUKPINKSWKFKPFTKPMKPIXGUUGNU 2TQRGTVKGUHQT.CUGF5KPVGTGF2CTVU+P2TQEGGF KP VJ#PPWCN+PVGTPCVKQPCN%QPHGTGPEG KPIUQHVJG#5/'+PVGTPCVKQPCN/GEJCPKECN QHVJG+''''PIKPGGTKPIKP/GFKEKPGCPF$KQNQI[ 'PIKPGGTKPI%QPITGUU'ZRQUKVKQP+/'%' 5QEKGV[ '/$% 2TGUGPVGFCVVJGVJ#PPWCN 0QXGODGT5CP&KGIQ%CNKHQTPKC International Conference of the IEEE Engineering in +/'%'RR6QDGRWDNKUJGF /GFKEKPGCPF$KQNQI[5QEKGV[ '/$% RR ■ 4QRRGPGEMGT&$2HCHH#%Q[,#.WGVJ6% /WNVK#TO5PCMG.KMG4QDQV-KPGOCVKEU+P ■ .WGVJ6% +TNKPIGT( $GTGEJPGVG'T\GWIWPI 45,+'''45,+PVGTPCVKQPCN%QPHGTGPEGQP+PVGNNK- XQPFTGKFKOGPUKQPCNGP1DGTƅÀEJGPOQFGNNGP IGPV4QDQVUCPF5[UVGOU0QXGODGT6QM[Q$KI KO56.(QTOCVCWUFGT$GUEJTGKDWPIRNCPCTGT 5KIJV,CRCPRR6QDGRWDNKUJGF /GEJCPKUOGPHØTFKG)GPGTCVKXG(GTVKIWPIFWTEJ ■ 5EJYCKIGT, .WGVJ6% +TNKPIGT( )%QFG 5GNGMVKXGU.CUGTUKPVGTP=%QORWVCVKQPCN&5WTHCEG )GPGTCVKQPHQTC0GY2TKPVKPI2TQEGUU$CUGFQP& )GPGTCVKQPQH2NCPCT/GEJCPKUOWUWUKPI56.(KNG 2NCUVKE2QN[OGT&TQRNGV)GPGTCVKQP (QTOCVHQT)GPGTCVKXG/CPWHCEVWTKPID[5GNGEVKXG ■ 5JGXEJGPMQ0)KNNGP5(GW»PGT*.ØVJ6% .CUGT5KPVGTKPI?-QNNQSWKWO)GVTKGDGVGEJPKM 'XCNWCVKQPQH%6$CUGF&2TKPVGF%QNQP 67+NOGPCW5GRVRR /QFGNUHQT5WTIKECN1RGTCVKQP2NCPPKPI6JGVJ ■ /GKPKPI# 5EJPGKFGT# 4QRRGPGEMGT& .WGVJ +#56'&+PVGTPCVKQPCN%QPHGTGPEGQP$KQOGFKECN 6 #PGYKPUVTWOGPVHQTGPFQUEQRKEUWDOWEQUCN 'PIKPGGTKPI$KQ/GF(GDTWCT[ FKUUGEVKQP YKVJXKFGQU )CUVTQKPVGUVKPCN'PFQ +PPUDTWEM#WUVTKC&1+ 2 UEQR[ ■ 5VTCWUU) 5EJCNNGT5 )QNNPKEM+ .ØVJ6% ■ 0GWJCGWUGT, &o#PIGNQ. %QNNGEVKPICPF n+PUVTWOGPVGPPCXKICVKQPKPFGTGPFQPCUCNGP FKUVTKDWVKPIYGCTCDNGUGPUQTFCVC #PGODGFFGF 5VKTPJÒJNGPEJKTWTIKG )KDVGUGKPG1RGTCVKQPWPVGT RGTUQPCNCTGCPGVYQTMVQNQECNCTGCPGVYQTM nTGKPGT0CXKICVKQPUHØJTWPI!oo.CT[PIQ4JKPQ1VQN ICVGYC[UGTXGTKP VJ#PPWCN+PVGTPCVKQPCN %QPHGTGPEGQHVJG+''''PIKPGGTKPIKP/GFKEKPG ■ 6TCGIGT/CVVKCU(-TKGIGT;CPPKEM5.WGVJ6KO CPF$KQNQI[5QEKGV[ '/$% 2TGUGPVGFCVVJG % #WVQOCVGFEQPUVTWEVKQPQHIGCTTCEMU VJ#PPWCN+PVGTPCVKQPCN%QPHGTGPEGQHVJG URWTIGCTUCPFJGNKECNIGCTUWUKPI/CVNCD56. +''''PIKPGGTKPIKP/GFKEKPGCPF$KQNQI[5QEKGV[ ƄNGUHQTTCRKFOCPWHCEVWTKPI#FXCPEGF+PVGNNKIGPV '/$% RR /GEJCVTQPKEU #+/ +'''#5/'+PVGTPCVKQPCN ■ 0GWJCGWUGT, .WGVJ6% &o#PIGNQ.6 %QPHGTGPEGQPRR 5WKVCDKNKV[QHCEQOOQP 148 Institute of Micro Technology and Medical Device Technology Institute of Nuclear Engineering Nuclear engineering and nuclear safety ■ The focus of the Institute of Nuclear Engineering in 2013-14 was on the development of experimental data and physical models for two-phase CFD codes applied to nuclear safety, the development of uncertainty methodologies in multi-physics and medical applications, the initiation of research lines on nuclear fuel behavior and on advanced molten salt reactor based concepts, and the development of a methodology for local stability analysis of nuclear reactors. Collaboration with research institutes Highlights for 2013-14 were prizes for best (CERN, KIT, ITU, GRS) and university poster in the international conferences departments was strengthened in the areas NURETH-15 (S. Al Issa) and best paper in of research of interest to the institute. ICONE-22 (L. Holt). Prof. Dr. Rafael Macián-Juan, Ph.D. Nuclear Reactor Safety Analysis Contact www.ntech.mw.tum.de Nuclear safety research is very import- is the accurate simulation of physical [email protected] ant to support the safe operation of processes of importance for the safety of Phone +49.89.289.15621 nuclear reactors. It mainly involves the the plant. The complete reactor dynamic development and use of methodologies behavior is analyzed by coupling these and physical and mathematical models codes to codes that calculate the neutro- integrated in sophisticated computer nic behavior of the reactor core. programs, which can accurately simulate Statistically based uncertainty analy- the behavior of nuclear systems under sis methodologies are also used and operation and off-operation conditions. developed at the Institute of Nuclear At the Institute of Nuclear Engineering, Engineering in order to quantify the relia- this research is carried out through bility and accuracy of the results provided projects which focus on the development by the safety analyses. of methodologies and models for state- of-the-art computer codes capable of Projects reproducing the thermal-hydraulic and ■ CIWA – Condensation induced water neutronic behavior of current and future hammer (BMBF) nuclear reactor designs. ■ Modeling of the behavior of steam turbines in NPPs (BMWi) ■ Simulation of loss of coolant accidents in PWRs (E.On) ■ Development of a PWR plant model for ATHLET (E.On) ■ Development and assessment of methodologies for the analysis of neut- ron oscillations in PWR fuel assemblies (BMWi) ■ THINS – Uncertainty analysis applied to liquid lead cooled reactors (EURATOM) Thermal-hydraulic (CFD) and neutronic (diffusion) ■ Development of a methodology for coupled simulation of a PWR fuel assembly (1/4). local BWR stability analysis (StMWFK) (Figure generated with ANSYS-CFX by C. Peña) ■ Development of neutronic and thermal- The methodologies are applicable to J[FTCWNKEOQFGNHQTVJGFWCNƅWKFTGCEVQT full plant simulations, based on system concept (Molten Salt coolant, E.On) analysis codes, or in-core local simu- ■ Model development for bubble for- NCVKQPUDCUGFQPEQORWVCVKQPCNƅWKF mation and behavior with CFD codes dynamics (CFD) codes. Their purpose (ANSYS-CFX and OpenFOAM, E.On) Institute of Nuclear Engineering 149 Experimental Two-Phase Flow Thermal-hydraulics the validation of modern Computational Fluid Dynamics codes. Two very important gas-liquid transport phenomena of safety implications in loss of coolant accidents (LOCA) have been .KSWKFƅQYTGVGPVKQPCVVJG analyzed, namely condensation of large entrance of a steam generator bubbles under atmospheric pressure con- caused by gas-liquid counter- EWTTGPVƅQYNKOKVCVKQP 2JQVQ ditions and the interfacial friction during from COLLIDER by S. Al Issa) EQWPVGTEWTTGPVƅQYKPCUECNGFOQFGNQH a Konvoi-PWR. The use of CFD codes is becoming more accepted in nuclear safety applications Projects because of the detailed description of the ■ SCUBA: Experimental Investigation of ƅQYKPVJGEQTGCPFKPQVJGTRNCPVEQO- the condensation phenomena in large ponents. However, CFD codes still need steam bubbles at atmospheric pressure substantial improvements in the modelling (E.On) QHVYQRJCUGƅQYUCPFQHVJGCUUQEKCVGF ■ COLLIDER – Experimental investigation mass and heat transfer processes, which QHEQWPVGTEWTTGPVƅQYKPCUECNGF are very important during accident and model of the hot leg of a Konvoi-PWR accident mitigation situations in determi- (E.On) ning the safety of the plant. ■ Experimental studies of condensation The laboratory for experimental thermal in the suppression pool of BWR hydraulics has been designed and built reactors (with U. Politécnica de Madrid) with the aim of producing detailed data for Medical Applications use of advanced computer programs to calculate dose distributions of photons, electrons and neutrons in treatment planning before the actual irradiation, so that doctors can better estimate the out- come of the therapy. Monte Carlo-based methods for particle transport are at the Treatment plan of head. Dose forefront of the most advanced therapy distribution from photo-neutron techniques. At the Institute, we develop and uncertainty determination. (Figure created by M. Frankl) methodologies based on these methods that can take into account the associated An important area of nuclear engineering uncertainties and produce more accurate is related to the development of medical estimates of dose distributions. They can applications for radiation. Radio- contribute to better treatment plans being dia gnos tics and radiotherapy are modern delivered to patients. tools at the disposal of medical professio- nals that allow more precise diagnostics of Projects many illnesses, the research of metabolic ■ Development of a methodology for the activity and the palliative or curative treat- SWCPVKƄECVKQPQHVJGWPEGTVCKPV[KPPGW ment of a wide variety of tumors. Modern tron and photon dose calculation with radiotherapy procedures make intensive Monte-Carlo based codes (StMWFK) 150 Institute of Nuclear Engineering Fuel Behavior Analysis The neutronic, thermal and mechanical per- formance of nuclear fuel is fundamental for nuclear power reactors in order to safely and economically. Moreover, the behavior QHVJGHWGNFWTKPICPCEEKFGPVECPUKIPKƄ- cantly impact on the severity of its progres- sion. For these reasons, the analysis of fuel behavior is an important part of nuclear Neutron radiography of irradiated safety and of fuel design and operation. fuel elements. (Photo from A. Bianco, PhD. Thesis) At the Institute of Nuclear Engineering we carry out research on the modeling of fuel and in the validation of computer codes to create a multi-physics computa- codes that simulate its behavior under a tional platform capable of performing very wide range of operating and off-operating detailed neutronic, thermal and mechanical conditions. Experimental data provided fuel performance analyses. by our collaborators in European research organizations are used to improve and Projects develop mechanical and thermal models ■ Development of models for the predic- for uranium and thorium based fuels. These tion of thorium-based fuel (E.On) models are then implemented and tested ■ Coupling of TRANSURANUS with in the code TRANSURANUS developed DYN3D (E.On) by the Institute for Transuranic Elements ■ Experimental and analytical analysis of (ITU) in Karlsruhe. Another research line the performance of nuclear fuel under is focused on coupling this code with LOCA conditions (E.On) neutronic and thermal-hydraulic analysis Institute of Nuclear Engineering 151 Research Focus Management ■ Thermal-hydraulic and neutronic Prof. Dr. Rafael Macián-Juan, Director analysis of nuclear systems ■ Reactor dynamics Adjunct Professors ■ Nuclear fuel behavior Prof. Dr. Antonino Cardella ■ 'ZRGTKOGPVCNVYQRJCUGƅQY Dr. rer. nat. Marcus Seidl ■ Radiation transport and radiation protection Administrative Staff ■ Medical applications of radiation Dipl.-Ing. (FH) Margitta Franke ■ Uncertainty analysis Petra Popp-Münich Competence Research Scientists ■ Nuclear safety analysis Dr. rer. nat. Martin Ohlerich ■ 6YQRJCUGƅQYGZRGTKOGPVCNOGCUWTG- Dipl.-Ing. Suleiman Al Issa ments Dipl.-Ing. Sabin Ceuca ■ Radiation transport and radiation Dipl.-Tech. Math. Matthias Frankl dosimetry calculations Dipl.-Ing. Stefano Gallo ■ 5KPINGCPFVYQRJCUGƅQYEQORWVC Dipl.-Ing. Dan-Ovidiu Melinte VKQPCNƅWKFF[PCOKEU Dipl.-Ing. Clotaire Geffray ■ Nuclear reactor dynamics Dipl.-Ing. Stefan Walser Jose Tijero, M.Sc. Infrastructure Xun He , M.Sc. ■ 6JGTOCNJ[FTCWNKEVYQRJCUGƅQY Xiang Wang , M.Sc. laboratory. Dipl.-Ing. Andreas Wanninger ■ Computer laboratory with state-of-the- art nuclear safety computer codes. Technical Staff ■ High perfomance computer cluster. Dipl.-Ing (FH) Jamel Rhouma Herbert Eppert Courses ■ Introduction to Nuclear Energy ■ Fundamentals of Nuclear Engineering ■ Applications of Radiation to Medicine, Research and Industry ■ Fundamentals of Thermal-hydraulics in Nuclear Systems ■ Advanced and Future Nuclear Reactor Systems Publications 2013-14 ■ Al Issa, S., Macian, R., Experimental investigation ■ Calleja, M., Jimenez, J., Imke, U., Stieglitz, R., QHEQWPVGTEWTTGPVƅQYNKOKVCVKQP %%(. KPC Herrero, J.J., Macián, R., ‘Implementation of hybrid large-diameter hot-leg pipe geometry: A detailed simulation schemes in COBAYA3/SUBCHANFLOW FGUETKRVKQPQH%%(.OGEJCPKUOUƅQYRCVVGTPU EQWRNGFEQFGUHQTVJGGHƄEKGPVFKTGEVRTGFKEVKQPQH and high-quality HSC imaging of the interfacial local safety parameters’, Annals of Nuclear Energy structure in a 1/3.9 scale of PWR geometry, Nuclear 70, 216-229 (2014). Engineering and Design (2014, in press). ■ Calleja, M., Sanchez, V., Jimenez, J., Herrero, ■ Calleja, M., Jimenez, J., Sanchez, V., Imke, U., J.J., Imke, U., Stieglitz, R., Macián, R., ‘Coup- Stieglitz, R., Herrero, J.J., Macián, R., ‘Investi- ling of COBAYA3/SUBCHANFLOW inside the gations of boron transport in a PWR core with NURESIM platform and validation using selected COBAYA3/SUBCHANFLOW inside the NURESIM benchmarks’, Annals of Nuclear Energy 71, 145-158 platform’, Annals of Nuclear Energy 66 (2014). (2014). 152 Institute of Nuclear Engineering ■ Al Issa, S., Weisensee, P., Macián-Juan, R.,‘Expe- ■ Papukchiev, A., Jeltsov, M., Geffray, C., Kööp, rimental investigation of steam bubble conden- K., Kudinov, P., Macián-Juan, R., and Lerchl, G., sation in vertical large diameter geometry under Prediction of Complex Thermal-Hydraulic Pheno- CVOQURJGTKERTGUUWTGCPFFKHHGTGPVƅQYEQPFKVKQPUo mena Supplemented by Uncertainty Analysis with International Journal of Heat and Mass Transfer 70, Advanced Multi-scale Approaches for the TALL-3D 918-929 (2014). T01 Experiment, Probabilistic Safety Assessment ■ Ceuca, C.S., Macián-Juan, R., ‘Development of a and Management PSAM 12, Honolulu, Hawaii, June 1 D hybrid HTC model using CFD simulations for (2014). the analysis of direct contact condensation as the ■ Ciriac, F., Ceuca, S.C., and Macián-Juan, R., CFD driving force for water hammers’, Kerntechnik 78 Simulation of horizontal Flow Regimes with the (1), 25-30 (2013). OpenFOAM, 45th Jahrestagung Kerntechnik, May ■ Geffray, C. and Macian-Juan, R., ‘A Study of Differ- (2014). ent Approaches for Multi-Scale Sensitivity Analysis ■ Albrecht, R., Walser, S., Roshan, P., and Macián- of the TALL-3D Experiment Using Thermal-Hydrau- Juan, R., Optimized Nodalization for the BWR lic Computer Codes’, 10th International Topical Stability Analysis with TRACE/PARCS., 45th Meeting on Nuclear Thermal Hydraulics, Operation Jahrestagung Kerntechnik May (2014) and Safety (NUTHOS-10), December 14-18, 2014 ■ Wanninger, A., Seidl, M., and Macián-Juan, R., Okinawa, Japan. Paper NUTHOS10-1052 (Accep- Understanding future Research Needs to better ted). describe Fuel Assembly Bow in PWRs, 45th ■ Geffray, C., Papukchiev, A, and Macian-Juan, R. Jahrestagung Kerntechnik May (2014). ‘Multi-Scale Uncertainty and Sensitivity Analysis of ■ Holt, L., Rhode, U., ,Seidl, M., Schubert, A., van the TALL-3D Experiment Using Thermal-Hydraulic Uffelen, P., ,Macián-Juan, R., Getting the Details Coupled Codes’, 10th International Topical Meeting of Fuel Rod Simulation in Reactor Safety Analysis on Nuclear Thermal Hydraulics, Operation and right: performmance of the coupling DYN3D Tran- Safety (NUTHOS-10), December 14-18, 2014 Oki- suranus for RIA, 45th Jahrestagung Kerntechnik nawa, Japan. Paper NUTHOS10-1103 (Accepted). May (2014). ■ Al Issa, S., Macian R., Experimental investigation ■ Dibon, M., Baldzuhn, J., Beck, M., Cardella, A., CPF%(&XCNKFCVKQPQHEQWPVGTEWTTGPVƅQYNKOKVCVKQP Köchl, F., Kocsis, G., Lang, P., Macián-Juan, R., (CCFL) in a large-diameter hot-leg PWR geometry, Plöckl, B., Szepesi, T., and Weisbart, W., Blower 10th International Topical Meeting on Nuclear Ther- Gun pellet injection system for W7-X, DPG Confe- mal Hydraulics, Operation and Safety (NUTHOS-10) rence, Berlin, March 17-21 (2014). December 14-18, 2014 Okinawa, Japan. Paper ■ Ceuca, S.C., Macián-Juan, R., Validation of a hybrid NUTHOS10-1211 (Accepted). surface renewaltheory based HTC model for the ■ Al Issa, S., Macian R., Experimental Investigation simulation of condensation induced water hammer, and CFD validation of CCFL in large diameter hot- International Conference on Nuclear Engineering, leg geometry. CFD German Network Meeting, GRS, ICONE21 July 29-August 2, Chengdu, China (2013). Garching, 19-20 March (2014) ■ Al Issa, S., Macian R., Experimental investigation ■ Al Issa S., Weisensee P., Macián-Juan R., Experi- of CCFL in large diameter hot-leg geometry, mental investigation of steam bubble condensation Proceedings of the 21th International Conference KPƅQYKPIUWDEQQNGFYCVGT%(&)GTOCP0GVYQTM on Nuclear Engineering ICONE21 July 29-August 2, Meeting, GRS, Garching, 19-20 March (2014). Chengdu, China (2013). ■ Geffray, C. and Macián-Juan, R., Multi-Scale ■ Al Issa S., Weisensee P., Experimental investi- Uncertainty and Sensitivity Analysis of the TALL 3D ICVKQPQHUVGCODWDDNGEQPFGPUCVKQPKPƅQYKPI Facility with ATHLET – ANSYS CFX, CFD German sub-cooled water with two different injection nozzle Network Meeting, GRS, Garching, 19-20 March geometries, Proceedings of the 21th International (2014). Conference on Nuclear Engineering ICONE21 July ■ Ceuca, S.C. and Macián-Juan, R., CFD-Simulation 29-August 2, Chengdu, China (2013). of Direct Contact Condensation as the Driving ■ Al Issa, S., Moreno-Prosper, M., Developing a Force for Water Hammer, CFD German Network procedure for calculation of bubble parameters, Meeting, GRS, Garching, 19-20 March (2014). diameter, velocity, aspect ratio and path depending ■ Yamoah, S., Martínez, R., Chiva, S. and Macián- upon shadowgraph technique and high speed ,WCP4#FKCDCVKEVYQRJCUGƅQYOQFGNKPIKP camera recordings for multiple bubbles and diluted vertical pipes using the homogeneous MUSIG DWDDN[ƅQYU2TQEGGFKPIUQHVJGVJ+PVGTPCVKQPCN model in ANSYS-CFX, CFD German Network Topical Meeting on Nuclear Reactor Thermal- Meeting, GRS, Garching, 19-20 March (2014) Hydraulics, NURETH-15, Pisa, Italy, May 12-17, ■ Holt, L., Rhode, U., Seidl, M., Schubert, A., van (2013). Uffelen, P., Macián-Juan, R., Two-Way Coupling ■ Al Issa, S., Weisensee P., Experimental investigation Between the Reactor Dynamics Code DYN3D and QHUVGCODWDDNGEQPFGPUCVKQPKPƅQYKPIUWDEQQ- the Fuel Performance Code TRANSURANUS at led water in vertical large diameter geometry under Assembly Level, ICONE 22, Prague, Czech Rep., atmospheric pressure, Proceedings of the 15th July (2014). International Topical Meeting on Nuclear Reactor ■ Geffray, C., Macián-Juan, R., Multi-Scale 2D-Sen- Thermal-Hydraulics, NURETH-15, Pisa, Italy, May sitivity Analysis of the TALL-3D Experiment, ICONE 12-17 (2013). 22, Prague, Czech Rep., July (2014). ■ Ceuca, C.S and Macian-Juan, R., Benchmark of ■ Papukchiev,A., Lerch, G., Geffray, C., Macián-Juan, Surface Renewal Theory based Heat Transfer R., Jeltsov,M., Kööp, K., and Kudinov, P., Coupled %QGHƄEKGPVHQTVJG5KOWNCVKQPQH&KTGEV%QPVCEV 1D-3D Thermal-Hydraulic Simulations Of A Liquid Condensation in Pipes using the 1D and 3D Appro- Metal Experiment Supplemented By Uncertainty ach, Proceedings of the 15th International Topical And Sensitivity Analysis, OECD/NEA & IAEA Work- Meeting on Nuclear Reactor Thermal-Hydraulics, shop: ‘Application of CFD/CMFD Codes to Nuclear NURETH-15, Pisa, Italy, May 12-17 (2013). Reactor Safety and Design and their Experimental Validation’, Zürich, Switzerland, September (2014). Institute of Nuclear Engineering 153 Plasma Material Interaction Group Properties and optimisation of materials facing high temperature plasmas and heat loads ■ The focus of the Plasma Material Interaction Group in 2013-14 was to study the PWI processes – erosion, material mixing with other plasma constituents and hydrogen retention. about 7 m divertor section transfer section target exchange box and front-end drive Prof. Dr. Rudolf Neu Divertor manipulator system for the testing of plasma facing components in the Tokamak ASDEX Upgrade Contact A highlight was the commissioning of the components must withstand severe www.pmw.mw.tum.de &KXGTVQT/CPKRWNCVQT++KPKPVJGHWUKQP thermal and mechanical loads. In order [email protected] experiment ASDEX Upgrade. to understand and to test material 2JQPG 6JGPGYOCPKRWNCVQTU[UVGOKUVJGƄTUVQH RTQRGTVKGUCXCTKGV[QHRTGRCTCVKQP KVUMKPFYJKEJCNNQYUGZRQUWTGQHHWNNUK\G OGVJQFUHQTEQCVKPIUCPFVJKPCNNQ[ƄNOU target plate samples and sample exchange CTGWUGFCUYGNNCUCEQORTGJGPUKXG KPDGVYGGPGZRGTKOGPVFC[UD[OGCPU UGVQHVGEJPKSWGUHQTRJ[UKECNEJGOKECN of an airlock system without breaking the CPFOGEJCPKECNEJCTCEVGTK\CVKQPCPF vacuum vessel. It also includes an active OQFGNNKPI/QTGQXGTJKIJJGCVƅWZVGUVU VKNGEQQNKPIU[UVGOCNNQYKPIFGFKECVGF at relevant power loads on mock-ups tests of target concepts under reactor rele- as well as on complete actively cooled vant thermal load conditions and realistic components were performed in the ion OCIPGVKEƄGNFIGQOGVT[ beam test facility GLADIS operated by $GUKFGUDGKPIGTQUKQPTGUKUVCPVVJG the group. armour materials of the plasma facing Erosion and Retention Investigations in the High Heat Flux Facility GLADIS of heat and particles can be generated in IPP’s facility GLADIS (Garching Large Divertor Sample Test Facility). Tungsten components can be exposed to RCTVKENGCPFJGCVƅWZGUQHWRVQ/9 m². Admixture of a few per cent helium to the hydrogen already causes the formation Electron-microscopic image of of complex structures on the surfaces of a W surface originally polished VJGEQORQPGPVUYJKEJECPKPƅWGPEGVJGKT after testing in GLADIS at surface temperatures reaching up to wear behaviour and therefore their lifetime. 2000° C. 6JGKPXGUVKICVKQPUEQORTKUGURGEKƄECNN[ In fusion reactors tungsten will presumably VJGPGCTUWTHCEGOQTRJQNQI[VJGGTQUKQP be employed as protective material for DGJCXKQWTCPFVJGCOQWPVQHJ[FTQIGP RNCUOCHCEKPIEQORQPGPVU5RGEKƄECNN[ and helium atoms retained in the material. the divertor components are exposed to Various tungsten materials and alloys are the strong impact of plasma particles – being investigated with GLADIS. hydrogen and in a power plant also the The inventory of hydrogen retained in the fusion product helium – and correspond- material after loading can be determined ingly to a high thermal load. Such loads in IPP’s tandem accelerator laboratory. 154 Plasma Material Interaction Group Since the temperature-dependent outgas- changes and erosion to obtain a better sing of hydrogen can be well described estimate of divertor component lifetimes. D[EQORWVGTOQFGNUFGXGNQRGFCV+22 the experimental results can be integrated Projects into predictions of the hydrogen isotope ■ 5WRRQTVGFD['(&# CPF balance of future power plants. One of '741HWUKQP the objectives is modelling of structural Making Brittle Material Pseudo-ductile: 6WPIUVGPƄDTGTGKPHQTEGF6WPIUVGP Its combination of unique properties makes tungsten a promising candidate for use on directly plasma-facing components KPCHWVWTGHWUKQPRQYGTRNCPV*QYGXGT its inherent brittleness and corresponding lack of damage tolerance considerably limit its use. A possible approach to a solution is to Cross-section of WfW composite: incorporate in the material structures with The circular structures with diametres of about 150 μm are NQECNUVTGUUTGFKUVTKDWVKQPVJWURTQF cross-sections of the tungsten WEKPICMKPFQHVQWIJPGUUXK\KPETGCUGF ƄDTGU resistance to failure. This externally anisms of toughness increase work in KPVTQFWEGFGPJCPEGFVQWIJPGUUQT RTKPEKRNGCPFVJCVVJGUVCDKNKV[VQGODTKV nRUGWFQFWEVKNKV[oECPDGCEJKGXGFD[HQT tlement increases indeed. Bending tests KPUVCPEGKPEQTRQTCVKPIGODGFFGFƄDTGU on larger samples showed stable crack YJKEJECPDTKFIGQTFGƅGEVETCEMUQTRNC- RTQRCICVKQPFQWDNKPIQHVJGNQCFDGC- UVKECNN[FGHQTO%GTCOKEƄDTGTGKPHQTEGF TKPIECRCDKNKV[CPFVJGTGHQTGFQWDNKPI ceramics are an example of successful of the toughness. The results of these implementation of this concept. investi gations showed that the idea of In the research group this idea was VWPIUVGPƄDTGTGKPHQTEGOGPVQHVWPIUVGPKU applied to tungsten. The metal is rein- basically applicable (‘proof of principle’). HQTEGFYKVJEQCVGFNQPIƄDTGUHTQOFTCYP tungsten wires. Samples of the new Projects material have already been produced on ■ 5WRRQTVGFD['(&# CPF a laboratory scale. Tomographic inves- '741HWUKQP tigations with high-energy synchrotron radiation demonstrated that the mech- Plasma Material Interaction Group 155 Research Focus Courses ■ Detailed understanding of complex ■ Plasma Physics for Engineers interaction processes between plasma ■ 2NCUOC/CVGTKCN+PVGTCEVKQP and material ■ Development of novel materials with Research Group at: improved properties /CZ2NCPEM+PUVKVWVHØT2NCUOCRJ[UKM ■ Integration of new materials into HWPFGFD[/2)*)(CPFUWRRQTVGFD[ plasma-facing components '(&#'741HWUKQP Competence Management ■ /GCUWTGOGPVCPFOQFGNNKPIQHGTQUKQP Prof. Dr. Rudolf Neu surface composition and hydrogen retention of materials Research Scientists ■ Thermo-mechanical analysis of high (MPI für Plasmaphysik) JGCVƅWZEQORQPGPVU &T/CTVKP$CNFGP Dipl.-Ing. Stefan Elgeti Infrastructure Dipl.-Ing. Henri Greuner ■ Accelerator for surface analysis Dipl.-Phys. (FH) Till Höschen ■ *KIJJGCVƅWZKQPDGCOVGUVUVCPF Dipl.-Chem. Freimut Koch ■ /CPKRWNCVQTKPVJGHWUKQPFGXKEG#5&': Dr. Karl Krieger Upgrade &T*CPU/CKGT ■ Scanning electron microscopy &KRN+PI#NGZCPFGTXQP/ØNNGT ■ Focused ion beam Dr. Johann Riesch ■ Confocal laser microscope Dr. Volker Rohde ■ /CIPGVTQPURWVVGTFGXKEGU apl. Prof. Dr. Jeong-Ha You ■ Vacuum ovens for thermal desorption Technical Staff Dipl.-Ing. (FH) Bernd Böswirth )CDTKGNG/CVGTP 156 Plasma Material Interaction Group 2WDNKECVKQPU ■ ,9%QGPGP--TKGIGT$.KRUEJWNV\6.WPV4 0WEN(WUKQP &WZGVCNn'XQNWVKQPQHUWTHCEGOGNVFCOCIGKVU ■ (4QOCPGNNK+#DGN8#HCPGU[GX/#HVCPCU KPƅWGPEGQPRNCUOCRGTHQTOCPEGCPFRTQURGEVUQH )#ICTKEKGVCNn1XGTXKGYQHVJG,'6TGUWNVUYKVJ TGEQXGT[o,QWTP0WEN/CVGT 5 VJG+6'4NKMGYCNNo0WEN(WUKQP ■ #*CMQNC5-QKXWTCPVC,.KMQPGP/)TQVJ6 ■ 62ØVVGTKEJ4&WZ40GW/$GTPGTV/0# -WTMK5WQPKQGVCNn)NQDCNOKITCVKQPQH%KP $GWTUMGPUGVCNn1DUGTXCVKQPUQPVJG9VTCPURQTV JKIJFGPUKV[.OQFGRNCUOCUCV#5&':7RITCFGo KPVJGEQTGRNCUOCQH,'6CPF#5&':7RITCFGo ,QWTP0WEN/CVGT 5 2NCUOC2J[UKEU%QPVTQNNGF(WUKQP ■ 22GVGTUUQP/4WDGN#*CMQNC)2QUUPGTV- ■ #*CMQNC/+#KTKNC%$LÒTMCU&$QTQFKP -TKGIGTGVCNn&GXGNQROGPVCPF4GUWNVUQH6TCEGT 5$TG\KPUGMGVCNn)NQDCNOKITCVKQPQHKORWTKVKGU 6GEJPKSWGUYKVJ0KVTQIGPo,QWTP0WEN/CVGT KPVQMCOCMUo2NCUOC2J[UKEU%QPVTQNNGF(WUKQP 5 ■ <;CPI--TKGIGT6.WPV4&WZ#,CP\GTGV ■ /0#$GWTUMGPU,5EJYGKP\GT%#PIKQPK# CNn&6TCLGEVQTKGU4GEQPUVTWEVKQPQH6WPIUVGP $WTEMJCTV%&%JCNNKUGVCNn6JG'HHGEVQHC/GVCN &TQRNGVUFWTKPI%QPVTQNNGF6WPIUVGP/GNVKPIKP 9CNNQP%QPƄPGOGPVKP,'6CPF#5&':7RITCFGo #5&':7RITCFGo,QWTP0WEN/CVGT 2NCUOC2J[UKEU%QPVTQNNGF(WUKQP 5 ■ ',QHHTKP/$CTW\\Q/$GWTUMGPU%$QWTFGNNG ■ /.CWZ25KGOTQVJ//CTZ40GW84QJFG 5$TG\KPUGMGVCNn5EGPCTKQFGXGNQROGPVCV,'6 GVCNn.CDQTCVQT[+PXGUVKICVKQPUQP#TEKPIQH YKVJVJGPGY+6'4NKMGYCNNo0WEN(WUKQP 9EQCVGF)TCRJKVG%QORQPGPVUo,QWTP0WEN /CVGT 5 ■ #*CMQNC,-CTJWPGP5-QKXWTCPVC,.KMQPGP ■ ),XCP4QQKL,9%QGPGP5$TG\KPUGM /$CNFGPGVCNn.QPIVGTOGTQUKQPQHRNCUOC /%NGXGT4&WZGVCNn6WPIUVGPFKXGTVQTGTQUKQP facing materials with different surface roughness in all metal devices: lessons from the ITER-like wall KP#5&':7RITCFGo2J[UKEC5ETKRVC6 QH,'6CPFVJGCNNVWPIUVGP#5&':7RITCFGo,QWTP 0WEN/CVGT 5 ■ -5WIK[COC//C[GT#*GTTOCPP--TKGIGT ■ /1DGTMQƅGT&&QWCK6&KVVOCT',QHHTKP 84QJFGGVCNn&GWVGTKWOTGVGPVKQPKPVWPIUVGP 5$TG\KPUGMGVCNn(KTUV0KVTQIGPUGGFKPI'ZRGTK- used in ASDEX Upgrade: comparison of tokamak OGPVUKP,'6YKVJVJG+6'4NKMG9CNNo,QWTP0WEN CPFNCDQTCVQT[UVWFKGUo2J[UKEC5ETKRVC6 /CVGT 5 ■ 40GW#-CNNGPDCEJ/$CNFGP8$QDMQX ■ 22GVGTUUQP/4WDGN)2QUUPGTV5$TG\KP- ,9%QGPGPGVCNn1XGTXKGYQXGTRNCUOCQRG- UGM#-TGVGTGVCNn1XGTXKGYQH0KVTQIGP TCVKQPYKVJHWNNVWPIUVGPYCNNKP#5&':7RITCFGo application as a tracer gas for material migration ,QWTP0WEN/CVGT 5 CPFTGVGPVKQPUVWFKGUKPVQMCOCMUo2J[UKEC5ETKRVC ■ 8N$QDMQX)#TPQWZ5$TG\KPUGM,9%QGPGP 6 .%QNCUGVCNn+%4(URGEKƄERNCUOCYCNNKPVGTCE- ■ /./C[QTCN8$QDMQX#%\CTPGEMC+&C[# VKQPUKP,'6YKVJVJG+6'4NKMGYCNNo,QWTP0WEN 'MGFCJNGVCNn1PVJGEJCNNGPIGQHRNCUOCJGCVKPI /CVGT 5 YKVJVJG,'6OGVCNNKEYCNNo0WEN(WUKQP ■ 40GW)#TPQWZ/$GWTUMGPU8$QDMQX 5$TG\KPUGMGVCNn(KTUV1RGTCVKQPYKVJVJG,'6 ■ )2/CFFKUQP%)KTQWF$#NRGT)#TPQWZ +6'4.KMG9CNNo2J[U2NCUOCU +$CNDQCGVCNn%QPVTCUVKPI*OQFGDGJCXKQWT ■ )6CTFKPK%*ÒJDCWGT4(KUEJGT40GW#5&': with deuterium fuelling and nitrogen seeding in 7RITCFG6GCOn5KOWNCVKQPQHVJGPGWVTQPRTQFWE- VJGCNNECTDQPCPFOGVCNNKEXGTUKQPUQH,'6o0WEN VKQPKP#5&':7RITCFG*OQFGFKUEJCTIGUo0WEN (WUKQP (WUKQP ■ 40GW5$TG\KPUGM/$GWTUMGPU8$QDMQX ■ %)KTQWF)2/CFFKUQP5,CEJOKEJ(4KOKPK 2FG8TKGUGVCNn'ZRGTKGPEGUYKVJ6WPIUVGP /0#$GWTUMGPUGVCNn+ORCEVQHPKVTQIGP Plasma Facing Components in ASDEX Upgrade UGGFKPIQPEQPƄPGOGPVCPFRQYGTNQCFEQPVTQNQH CPF,'6o+'''6TCPUCEVKQPQP2NCUOC5EKGPEG JKIJVTKCPIWNCTKV[,'6'./[*OQFGRNCUOCYKVJC OGVCNYCNNo0WEN(WUKQP ■ /0#$GWTUMGPU.(TCUUKPGVVK%%JCNNKU ■ ,9%QGPGP5$TG\KPUGM/%NGXGT+%QHHG[ %)KTQWF55CCTGNOCGVCNn)NQDCNCPFRGFGUVCN 4&WZGVCNn'XQNWVKQPQH+ORWTKV[5QWTEGU EQPƄPGOGPVKP,'6YKVJC$G9OGVCNNKEYCNNo0WEN Composition and Transient Impurity Events with (WUKQP VJG+6'4NKMG9CNNCV,'6o0WEN(WUKQP ■ /$CNFGP0'PFUVTCUUGT84QJFG6.WPV ($TQEJCTFGVCNn&WUV2CTVKENG%NCUUKƄECVKQPCPF ■ 5$TG\KPUGM6.QCTGT82JKNKRRU*)'UUGT 8KFGQ6TCEMKPIHTQO(WNN6WPIUVGP#5&':7RITCFGo 5)TØPJCIGPGVCNn(WGN4GVGPVKQP5VWFKGUYKVJ 0WEN(WUKQP VJG+6'4NKMG9CNNKP,'6o0WEN(WUKQP ■ 49GPPKPIGT/$GTPGTV6'KEJ'(CDNG )(GFGTKEKGVCNn&'/1FKXGTVQTNKOKVCVKQPUFWTKPI ■ 75VTQVJ,#FCOGM.#JQ/CPVKNC5 MÀUNQO- CPFKPDGVYGGP'./Uo0WEN(WUKQP RQNQ%#OFQTGVCNn1XGTXKGYQH#5&':7RITCFG 4GUWNVUo0WEN(WUKQP ■ 2&GX[PEM%)KTQWF2,CESWGV/.GJPGP ■ 26.CPI&(TKIKQPG#)GTCWF6#NCTEQP2$GP- '.GTEJGGVCNn6JGUECNKPIQHTCFKCVGFRQYGT PGVVGVCNn'./RCEKPICPFVTKIIGTKPXGUVKICVKQPU KPVJGDWNMRNCUOCQH,'6o2NCUOC2J[U%QPVTQN CV,'6YKVJVJGPGY+6'4NKMGYCNNo0WEN(WUKQP (WUKQP ■ 8$QDMQX/$CNFGP4$KNCVQ($TCWP4&WZGV CNn+%4(QRGTCVKQPYKVJKORTQXGFCPVGPPCUKPCHWNN 9YCNN#5&':7RITCFGUVCVWUCPFFGXGNQROGPVUo Plasma Material Interaction Group 157 Thermo-Fluid Dynamics Group /QFGNNKPICPFUKOWNCVKQPQHVJGTOQƅWKFF[PCOKERJGPQOGPCKPGPGTI[CPFRTQEGUUVGEJPQNQI[ ■ Focus of the Thermo-Fluid Dynamics group in 2013-14 was the analysis CPFSWCPVKVCVKXGEJCTCEVGTK\CVKQPQHƅQYƅCOGCEQWUVKEKPVGTCEVKQPUKP combustion dynamics. Highlights ■ Participation in the 2014 Summer ■ Organized international Summer School Programm of the Center for Turbulence & Workshop ‘n3l-– Non-normal and Resarch at Stanford University with two nonlinear effects in aero- and thermo- RTQLGEVUQPKFGPVKƄECVKQPQHEQODWUVKQP CEQWUVKEUoKP,WPGYKVJ|RCTVKEK- noise and intrinsic thermo-acoustic pants from 15 countries, see feedback http://www.tfd.mw.tum.de/n3l Prof. ■ Prof. Arun Tangirla (IIT Madras, Indien) Wolfgang Polifke, Ph.D. visted as guest professor Contact www.tfd.mw.tum.de [email protected] Flow-Flame-Acoustic Interactions in Combustion Dynamics Phone +49.89.289.16216 +49.89.289.16217 Autoignition, heat release and high- frequency combustion dynamics at ele vated pressures and temperatures was investigated in several PhD research projects, funded by Alstom Power and the research initiative KW21. Mathieu Zellhuber received the SIEMENS Energy Award 2014 for his dissertation Distribution of intensity and relative phase of ‘High Frequency Response of Auto- ƅWEVWCVKQPUQHJGCVTGNGCUGTCVGQHCJKIJHTGSWGPE[ tangential mode in a combustion chamber Ignition and Heat Release to Acoustic Perturbations’ Projects ■ Alstom Twin, KW21 BY 13 GV, AG Turbo COOREFLEX-turbo 2.1.2, An intrinsic feedback mechanism be- VYGGPEQPXGEVKXGƅQYRGTVWTDCVKQPU JGCVTGNGCUGD[VJGƅCOGCPFCEQWUVKE YCXGUIGPGTCVGFD[ƅWEVWCVKQPUKPJGCV release rate was discovered. This is – as a reviewer of one of our publications remarked – ‘a textbook changer’. Implica- tions of intrinsic feedback for combustion noise, interpretation of empirical data and Structure of the intrinsic feedback loop with character- combustor design principles are under KUVKEYCXGCORNKVWFGUHIƅQYXGNQEKV[WƅCOG way. VTCPUHGTHWPEVKQP(CPFJGCVTGNGCUGTCVGŚ3 Projects ■ DFG Po 710/12, TUM-IAS Hans Fischer Fellowship 158 Thermo-Fluid Dynamics Group Research Focus Management ■ Combustion dynamics Prof. Wolfgang Polifke, Ph. D. ■ Thermo- and aero-acoustics ■ Stability analysis Administrative Staff ■ /KZKPICPFTGCEVKQPKPVWTDWNGPVƅQYU Helga Bassett ■ 2QN[FKURGTUGOWNVKRJCUGƅQYU Dipl.Ing. (FH) Sigrid Schulz-Reichwald Competence Research Scientists ■ 6JGTOQƅWKFF[PCOKEU Alp Albayrak, M.Sc. ■ Combustion modelling Alexander Avdonin, M.Sc. ■ Large eddy simulation Dipl.-Ing. Ralf Blumenthal ■ 5[UVGOKFGPVKƄECVKQP Dipl.-Ing. Sebastian Bomberg ■ Stability analysis Dipl.-Ing. Alejandro Cardenas Miranda ■ Low-order acoustic modelling Fredéric Collonval, M.Sc. Dipl.-Ing. Patrick Dems Infrastructure Kilian Förner, M.Sc. ■ Compute cluster Dipl.-Ing. Stefan Jaensch Joohwa Sarah Lee, M.Sc. Courses Dipl.-Ing. Moritz Schulze ■ Engineering Thermodynamics Camilo Silva, Ph.D. ■ Wärmetransportphänomene Dipl.-Ing. Thomas Steinbacher ■ Wärme- und Stoffübertragung Lin Strobio Chen, M.Sc. ■ Grundlagen der Mehrphasenströmung Ahtsham Ulhaq, M.Sc. ■ 0WOGTKUEJG6JGTOQƅWKFF[PCOKM+ Dipl.-Ing. Armin Witte ■ 0WOGTKECN6JGTOQƅWKFF[PCOKEU++ Dipl.-Ing. Mathieu Zellhuber ■ Computational Thermo-Fluid Dynamics with Opensource Tools Publications 2013-14 ■ Albayrak, A.; Ulhaq, A.; Blumenthal, R. S. & Polifke, ■ Cárdenas Miranda, A. & Polifke, W. (2013), On the W. (2014), Analytical derivation of laminar premixed 4GƅGEVKQP6TCPUOKUUKQP%QWRNKPICPF&CORKPI ƅCOGKORWNUGTGURQPUGVQGSWKXCNGPEGTCVKQ of Non-Plane Acoustic Modes by Resonator Rings, perturbations, in ‘21st International Congress on in ‘5th European Conference for Aeronautics and Sound and Vibration (ICSV21)’. Space Sciences’. ■ Blumenthal, R. S.; Subramanian, P.; Sujith, R. & ■ Cárdenas Miranda, A. & Polifke, W. (2014), Polifke, W. (2013), ‘Novel Perspectives on the ‘Combustion Stability Analysis of Rocket Engines Dynamics of Premixed Flames’, Combustion and with Resonators Based on Nyquist Plots’, Journal Flame 160(7), 1215-1224. of Propulsion and Power 30(4), 962-977. ■ Blumenthal, R. S.; Subramanian, P.; Sujith, R. & ■ Collonval, F. & Polifke, W. (2014), Modelling the For- Polifke, W. (2013), A Time Domain Perspective mation of Oxides of Nitrogen in Premix Combustion an the Response of Premixed Flames to Flow by Extending Tabulated Chemistry with Algebraic Perturbations, in ‘EUROMECH Colloquium 546 – Relations, in ‘Proceedings of ASME Turbo Expo Combustion Dynamics and Combustion Noise’. 2014’. ■ Blumenthal, R. S.; Tangirala, A. K.; Sujith, R. & ■ Courtine, E.; Selle, L.; Nicoud, F.; Polifke, W.; Silva, Polifke, W. (2014), ‘Energy Norms and Transient C.; Bauerheim, M. & Poinsot, T. (2014), Causality Growth in Thermoacoustics’, submitted to Int. J. and intrinsic thermoacoustic instability modes, in Spray Combust. Dyn.. ‘Proceedings of the 2014 Summer Program’. ■ Blumenthal, R. S.; Tangirala, A. K.; Sujith, R. & ■ Dems, P. & Polifke, W. (2013), BY 14 GV: Flam- Polifke, W. (2013), A Contribution to the Discussion mendynamik bei der Verbrennung von Flüssig- on Thermoacoustic Energy from a Systemic brennstoffen, in T. Sattelmayer & M. Aigner, ed., Perspective, in ‘n3l Workshop on Non-Normal and ‘Abschlussbericht Forschungsinitiative ‘Kraftwerke Nonlinear Effects in Aero- and Thermoacoustics’. des 21. Jahrhunderts (KW21)’’, pp. 770-791. ■ Bollweg, P. & Polifke, W. (2013), ‘Transient two- ■ Emmert, T.; Bomberg, S. & Polifke, W. (2014), phase boundary layer modeling for hollow cone Flame-Intrinsic and Acoustic Modes of a Premix sprays’, Int. J. of Multiphase Flow 52, 1–12. Combustor, in ‘EFMC10 – 10th European Fluid ■ Bomberg, S.; Emmert, T. & Polifke, W. (2014), Ther- Mechanics Conference’. mal Versus Acoustic Response of Velocity Sensitive Premixed Flames, in ‘35th International Symposium on Combustion’. Thermo-Fluid Dynamics Group 159 ■ Emmert, T.; Jaensch, S.; Sovardi, C. & Polifke, ■ Lacombe, R.; Föller, S.; Jasor, G.; Polifke, W.; W. (2014), taX-– a Flexible Tool for Low-Order #WTÅICP;/QWUUQW2 n+FGPVKƄECVKQP Duct Acoustic Simulation in Time and Frequency of Aero-Acoustic Scattering Matrices from Large Domain, in ‘7th Forum Acusticum’. 'FF[5KOWNCVKQP #RRNKECVKQPVQ9JKUVNKPI1TKƄEGUKP ■ Emmert, T.; Jaensch, S.; Sovardi, C. & Polifke, Duct’, J. Sound Vibration 332(20), 5059-5067. W. (2014), taX-– a Flexible Tool for Low-Order ■ Lee, J. S. & Polifke, W. (2014), Untersuchung von Duct Acoustic Simulation in Time and Frequency Geräuschquellen im Fahrzeug-Kältekreislauf, in Domain, in ‘DEGA Workshop Fahrzeugakustik/ ‘DEGA Workshop Fahrzeugakustik/Strömungs- Strömungsakustik’. akustik – Stuttgart’. ■ Föller, S.; Selimefendigil, F. & Polifke, W. (2013), ■ Müller, R. A. J.; Hermann, J. & Polifke, W. (2014), ‘The linear response of heat transfer from a cylinder ‘Control authority over a combustion instability KPETQUUƅQYVQXGNQEKV[ƅWEVWCVKQPUoUWDOKVVGFVQ investigated in CFD’, submitted to Int. J. Spray Heat and Mass Transfer. Combust. Dyn.. ■ Förner, K.; Cárdenas Miranda, A. & Polifke, W. ■ Müller, R. A. J.; Temmler, C.; Widhopf-Fenk, R.; /CRRKPIVJG+PƅWGPEGQH#EQWUVKE4GUQPC- Hermann, J.; Polifke, W. & Stopford, P. (2013), tors on Rocket Engine Combustion Stability, in N. A. CFD-based feasibility study of active control on Adams; R. Radespiel; T. Sattelmayer; W. Schröder a combustion instability, in ‘20th International & B. Weigand, ed., ‘Annual Report’, Sonderfor- Congress on Sound and Vibration (ICSV20)’. schungsbereich/Transregio 40, pp. 33-45. ■ Mondal, S.; Mukhopadhyay, A.; Sen, S. & Polifke, ■ Hassabou, A. H.; Spinnler, M. & Polifke, W. (2014), W. (2014), Characterization of Mixing and Flow ‘The Role Of Conductive Packing In Direct Contact Properties From Numerical Simulation of Cold Flow *GCV'ZEJCPIGTU+P*WOKFKƄECVKQP&GJWOKFKƄ- in Non-Premixed Combustor, in ‘Proceedings of cation Cycles-– Part I: Experimental Analysis’, ASME 2014 Gas Turbine India Conference’. submitted to Desalination. ■ Mukhopadhyay, A.; Carneiro, J.; Jasor, G. & Polifke, ■ Hassabou, A. H.; Spinnler, M. & Polifke, W. (2014), W. (2014), ‘A Comparative Assessment of Presumed Thermodynamic analysis of heat and mass trans- Function and Quadrature Methods of Moments with port phenomina in phase change regenerators with Size-Dependent Particle Velocities for Simulation conductive packing, in ‘Qatar Foundation Annual of Polydisperse Flows’, submitted to Applied Math. Research Conference’. Modelling (APM-D-13-02490). ■ Hassabou, A. H.; Spinnler, M. & Polifke, W. ■ 2QNKHMG9 n$NCEMDQZU[UVGOKFGPVKƄECVKQP (2013), ‘Tecnoeconomic Analysis of Medium and for reduced order model construction’, Annals of Large-sacle Desalination Plants Driven by Concen- Nuclear Energy 67C(0), 109-128. trated Solar Systems in the Mena Region’, Energy ■ Polifke, W. (2014), Microphone Measurements Procedia 42(0), 735-744. in (Thermo-)Acoustics, in ‘TANGO Workshop ■ Holzinger, T.; Emmert, T. & Polifke, W. (2014), ‘Opti- ‘Experimental Methods in Thermoacoustics’’. mizing thermoacoustic regenerators for maximum ■ 2QNKHMG9 #RRNKECVKQPUQH5[UVGO+FGPVKƄ- CORNKƄECVKQPQHCEQWUVKERQYGTo6JG,QWTPCNQHVJG cation in Aero- and Thermoacoustics, in ‘FlowAirs Acoustical Society of America 136(5), 2432–2440. 9QTMUJQRn5[UVGO+FGPVKƄECVKQPoo ■ Jaensch, S.; Emmert, T. & Polifke, W. (2014), A ■ Polifke, W. (2014), ‘IJSCD Special Issues – Edito- )TG[$QZ+FGPVKƄECVKQP#RRTQCEJHQT6JGTOQ rial’, Int. J. Spray Comb. Dynamics 6(3), i-iii. acoustic Network Models, in ‘Proceedings of ASME ■ Polifke, W. (2013), Tackling Combustor Design Turbo Expo 2014’. Problems with Large Eddy Simulation of Reacting ■ Jaensch, S.; Emmert, T.; Sovardi, C. & Polifke, W. Flows, in ‘MUSAF II Colloquium’. +FGPVKƄECVKQPQH(NCOG6TCPUHGT(WPEVKQPU ■ 2QNKHMG9 $NCEM$QZ5[UVGO+FGPVKƄMCVKQP in the Presence of Intrinsic Feedback and Noise, für die Erstellung reduzierter Modelle, in ‘Garchinger in ‘EFMC10 – 10th European Fluid Mechanics Seminare’. Conference’. ■ Ramdane, M. Z. D.; Holzinger, T. & Polifke, W. ■ Jaensch, S. & Polifke, W. (2014), CFD-basierte, (2014), ‘Validation of CFD Simulation of a Thermo- niedrigdimensionale Modellierung der nichtlinearen acoustic Device’ &[PCOKMXQP8QTOKUEJƅCOOGPKPn+PHQTOCVKQPU ■ Ramdane, M. Z. D.; Holzinger, T. & Polifke, W. tagung Turbomaschinen’. (2013), Validation of CFD Simulation of a Thermo- ■ Jasor, G.; Wacker, U.; Beheng, K. D. & Polifke, acoustic Device, in ‘AIA-DAGA 2013 Conference on W. (2014), ‘Modeling artifacts in the simulation of Acoustics’. the sedimentation of raindrops with a quadrature ■ Rouwenhorst, D.; Hermann, J. & Polifke, W. (2014), method of moments’, Meteorologische Zeitschrift On the Performance of Stability Margin Measures 23(4), 369-385. for Thermoacoustic Instabilities In Turbulent Com- ■ Karban, U.; Ogus, G.; Kucukcoskun, K.; Schram, C.; bustion Systems, in ‘21st International Congress on Sovardi, C. & Polifke, W. (2014), Noise Produced by Sound and Vibration (ICSV21)’. a Tandem Diaphragm: Experimental and Numerical ■ Schmid, M.; Blumenthal, R.; Schulze, M.; Polifke, Investigations, in ‘20th AIAA/CEAS Aeroacoustics W. & Sattelmayer, T. (2013), Quantitative Stability Conference’. Analysis Using Real Frequency Response Data, in ■ Kulkarni, R.; Bunkute, B.; Biagioli, F.; Düsing, M. ‘Proceedings of ASME Turbo Expo 2013’. & Polifke, W. (2014), Large Eddy Simulation of ■ Schmid, M.; Blumenthal, R.; Schulze, M.; Polifke, ALSTOM’s Reheat Combustor using Tabulated W. & Sattelmayer, T. (2013), ‘Quantitative Stability Chemistry and Stochastic Fields Combustion Analysis Using Real Frequency Response Data’, Model, in ‘Proceedings of ASME Turbo Expo 2014’. J. Eng. Gas Turbines Power 135(12), 121601. ■ Kulkarni, R.; Zellhuber, M. & Polifke, W. (2013), ‘LES ■ Selimefendigil, F. & Polifke, W. (2014), ‘A nonlinear, based Investigation of Autoignition in Turbulent proper-orthogonal-decomposition-based model of %Q(NQY%QPƄIWTCVKQPUo%QODWUVKQP6JGQT[CPF HQTEGFEQPXGEVKQPJGCVVTCPUHGTKPRWNUCVKPIƅQYo Modelling 17(2), 224-259. AIAA Journal 52(1), 131-145. ■ Kulkarni, R.; Zellhuber, M. & Polifke, W. (2013), ‘A ■ Silva, C. F.; Emmert, T.; Jaensch, S. & Polifke, W. Model for Auto-Ignition and Heat Release in Tur- (2014), ‘Numerical study on intrinsic thermoacoustic bulent Flows and its Application to Thermoacoustic KPUVCDKNKV[QHCNCOKPCTRTGOKZGFƅCOGoUWDOKVVGF Analysis’, Ercoftac Bulletin 96, 29–34. to Combustion and Flame. 160 Thermo-Fluid Dynamics Group ■ Silva, C. F.; Föller, S.; Emmert, T.; Ulhaq, A. & ■ Wo-Chong, L. T. & Polifke, W. (2013), ‘Large Eddy Polifke, W. (2013), Signal Generation and its 5KOWNCVKQP$CUGF5VWF[QHVJG+PƅWGPEGQH6JGTOCN +PƅWGPEGQPVJG%QPEWTTGPV+FGPVKƄECVKQPQH $QWPFCT[%QPFKVKQPCPF%QODWUVQT%QPƄPGOGPV Flame Transfer Function and Combustion Noise, on Premix Flame Transfer Functions’, J. Eng. Gas in ‘EUROMECH Colloquium 546 – Combustion Turbines Power 135(2), 021502. Dynamics and Combustion Noise’. ■ Zellhuber, M.; Meraner, C.; Kulkarni, R.; Polifke, W. ■ Silva, C. F.; Polifke, W.; O’Brian, J. & Ihme, M. & Schuermans, B. (2013), ‘Large Eddy Simulation of 6QYCTFUEQPEWTTGPVKFGPVKƄECVKQPQHƅCOG Flame Response to Transverse Acoustic Excitation dynamics and combustion noise of enclosed in a Model Reheat Combustor’, J. Eng. Gas ƅCOGUKPn2TQEGGFKPIUQHVJG5WOOGT Turbines Power 135(9), 091508-1–9. Program’. ■ Zellhuber, M. & Polifke, W. (2013), BY 13 GV: ■ Sovardi, C.; Jaensch, S.; Förner, K.; Selimefendigil, Hochfrequente Instabilitäten der Verbrennung mit F. & Polifke, W. (2013), Parametric vs. Nonparame- Selbstzündung, in T. Sattelmayer & M. Aigner, ed., VTKE+FGPVKƄECVKQPQH0QPNKPGCT#EQWUVKE5ECVVGTKPI ‘Abschlussbericht Forschungsinitiative ‘Kraftwerke at Duct Discontinuities based on LES Data, in des 21. Jahrhunderts (KW21)’’, pp. 750-769. ‘Sonderforschungsbereich/Transregio 40 – Summer ■ Zellhuber, M. & Polifke, W. (2013), Large Eddy Program Report 2013’. Simulation of High Frequency Flame Dynamics in ■ Sovardi, C.; Jaensch, S.; Silva, C. F. & Polifke, W. Perfect Premixed Combustors with Elevated Inlet +FGPVKƄECVKQPQH5QWPF5QWTEGUKP+PVGTPCN Temperatures, in ‘DLES-9 Workshop’. Ducted Flows: A Large Eddy Simulation – System ■ Zellhuber, M.; Schuermans, B. & Polifke, W. (2014), +FGPVKƄECVKQP#RRTQCEJKPnUV+PVGTPCVKQPCN ‘Impact of Acoustic Pressure on Auto-Ignition and Congress on Sound and Vibration (ICSV21)’. Heat Release’, Combustion Theory and Modelling ■ 5QXCTFK%2QNKHMG9 +FGPVKƄECVKQP 18(1), 1-31. of sound sources in internal non-reactive ■ Zellhuber, M.; Schwing, J.; Schuermans, B.; VWTDWNGPVƅQYU C.'55+&/&CRRTQCEJKPn Sattelmayer, T. & Polifke, W. (2014), ‘Experimental DGLR-Fach-Symposium der STAB’. and Numerical Investigation of Thermo-Acoustic ■ 5QXCTFK%2QNKHMG9 +FGPVKƄECVKQPQH Sources Related to High-Frequency Instabilities’, sound sources in internal non-reactive turbulent Int. J. Spray and Combustion Dynamics 6(1), 1-34. ƅQYUKPn&).4&')#:0QKUG9QTMUJQR5VTÒ- ■ Ziemer, C.; Jasor, G.; Wacker, U.; Beheng, K. D. mungsakustik’. & Polifke, W. (2014), ‘Quantitative Comparison ■ Strobio-Chen, L.; Bomberg, S. & Polifke, W. (2014), of Presumed-Number-Density and Quadrature On the Jump Conditions for Flow Perturbations Moment Methods for the Parameterisation of Drop Across a Moving Heat Source, in ‘21st International Sedimentation’, Meteorologische Zeitschrift 23(4), Congress on Sound and Vibration (ICSV21)’. 411-423. Thermo-Fluid Dynamics Group 161 Assistant Professorship of Safe Embedded Systems 5RGEKƄECVKQPQHHCWNVVQNGTCPVU[UVGOUXGTKƄECVKQPCPFXCNKFCVKQPQHUCHGV[ETKVKECNU[UVGOU ■ The Assistant Professorship of Safe Embedded Systems was created in October 2013. During this start-up phase, the group employed two scientists. In the period 2013-2014, the focus of the Assistant Professor- UJKRYCUQPVTKIIGTKPITGUGCTEJKPKVKCVKXGUKPVJGƄGNFUQHFGUKIPVQVGUV methods and fault-tolerant control of distributed applications. &GUKIPVQ6GUV Validation by testing is a mandatory ing the testability of controllers and 2TQH&T,WNKGP2TQXQUV procedure for safety-critical controllers. reducing the additional human workload However, the validation of a logic con- TGSWKTGFVQVTWUVHWNN[VGUVETKVKECNNQIKE %QPVCEV troller is often only considered in the later controllers. phases of its development. Thus, if speci- www.ses.mw.tum.de [email protected] ƄEPQPHWPEVKQPCNTGSWKTGOGPVUTGNCVGFVQ Projects Phone +49.89.289.16424 testing are not initially considered in the ■ TUM – design-to-test approach for URGEKƄECVKQPFGƄPKVKQPUVJKUEQWNFNGCFVQ black-box testing of programmable the impossibility of validating the behavior controllers of a controller by means of testing. Design-to-test approaches aim at improv- (CWNVVQNGTCPV%QPVTQNQH&KUVTKDWVGF#RRNKECVKQPU The control of automated systems is tation. The group’s strength lies, amongst increasingly achieved by distributed con- others, in the formalization of standardized trollers. However, the global behavior of a languages for distributed applications and system should remain the same indepen- VJGKTCWVQOCVGFXGTKƄECVKQP dently of the distribution of its implemen- 162 Assistant Professorship of Safe Embedded Systems 4GUGCTEJ(QEWU %QWTUGU ■ Fault-tolerant systems ■ Basics of Dependable Systems ■ (QTOCNXGTKƄECVKQPXCNKFCVKQP ■ Design and Analysis of Embedded ■ Distributed control systems Systems ■ Diagnosis of automated systems ■ Control of Discrete Event Systems %QORGVGPEG Management ■ Control of discrete event systems Prof. Dr. Julien Provost ■ Conformance testing Elke Reichardt, Secretary ■ Supervisory control theory ■ Fault-free analysis Research Scientist Canlong Ma, M.Sc. +PHTCUVTWEVWTG ■ Test bench for (safety) programmable logic controllers ■ Didactic platform for diagnosis (under construction) 2WDNKECVKQPU ■ Provost, J; Roussel, J.-M.; Faure, J.-M.: Generation QH5KPING+PRWV%JCPIG6GUV5GSWGPEGUHQT%QP- formance Test of Programmable Logic Controllers (2014). IEEE Transactions on Industrial Informatics, 10 (3), pp. 1696-1704. ■ Provost, J; Roussel, J.-M.; Faure, J.-M.: Technical report on Conformance Test of Programmable Logic Controllers – Execution of Minimum-Length Test 5GSWGPEGU Assistant Professorship of Safe Embedded Systems 163 Institute for Industrial Management and Assembly Technologies Perspectives for production ■ In 2013-14, the Chair for Industrial Management and Assembly Techno- logy with its two locations in Augsburg and Garching considered in parti- cular the possibilities of how humans can be integrated into the objectives of Industry 4.0. In addition, the further development of electromobility at VJGRTQFWEVKQPUKVG)GTOCP[YCUURGEKƄECNN[VCTIGVGF Electromobility 9KVJVJGGZRCPUKQPQHVJGTGUGCTEJƄGNF n$CVVGT[RTQFWEVKQPoVJG%JCKTVCTIGVUVJG RTQFWEVKQPQHGHƄEKGPVCPFEQUVGHHGEVKXG Prof. Dr.-Ing. energy storage systems. A particular Gunther Reinhart highlight this year was the inauguration of the research production line for lithium-ion Contact cells. Together with press representatives CPFCNNKPXQNXGFRTQLGEVRCTVPGTUVJGƄTUV www.iwb.tum.de [email protected] complete production line of its kind was 2JQPG started up at the Technical University This will be achieved through the develop- /WPKEJKP,WN[ ment of an open-innovation platform, which would enable the integration of Industry 4.0 the creativity and innovation potential of As a result of demographic changes, the customers in the product development average age in producing companies will process. One important research con- continue to increase in the future. With tent is the planning and control of an n+PFWUVT[oVJGKYDPQVQPN[OGCPU autonomous production that is based on the interconnection of systems, but also cyber-physical systems, where the custo- how humans are safe in the production mer-innovated products will be produced. environment and how they can effectively It is linked directly to the open-innovation use their skills and know-how. platform to ensure that the customer is always well informed of the feasibility of Locations Augsburg and Garching his design, and at the same time receives In close cooperation with the project a delivery schedule and cost estimate. ITQWRn4GUQWTEG'HƄEKGPV/GEJCVTQPKE The expected results offer companies a 2TQEGUUKPI/CEJKPGUoCV(TCWPJQHGT very innovative business model with the IWU in Augsburg and four additional opportunity to position themselves on the partners, major milestones were reached market with customer-innovated products, over the last few years, for example, and to strengthen Germany’s position as a YKVJVJGRTQLGEVn+PPQ%[(GTs+PVGITCVGF business location in the long term. &GUKIPCPF(CDTKECVKQPQH%WUVQOGT +PFKXKFWCNK\GF2TQFWEVUKP%[DGT2J[UKECN With the iwb Application Center Augsburg, Manufacturing Systems’ supported by the the Bavarian-Swabian location has been )GTOCP(GFGTCN/KPKUVT[QH'EQPQOKEU DGPGƄVKPIHQT[GCTUHTQOVJGn2TQFWE- and Energy (BMW) as the lead sponsor in tion Experts’. That way, the technology VJG&.4URQPUQTGFRTQLGEV transfer in Augsburg and surrounding area The scientists are working together to will be ensured with the scientists there. achieve the goal to enable the integrated design and production of customer- innovated products. 164 Institute for Industrial Management and Assembly Technologies Assembly Technology and Robotics The area of Assembly Technology and 4QDQVKEUCFFTGUUGUVJGCUUGODN[CUVJG last step in the value-creation chain within the production process. Here, the costs CPFSWCNKV[QHRTQFWEVUCTGKPƅWGPEGFKP COCLQTYC['HƄEKGPVCUUGODN[RTQEGU- ses, innovative system technology and assembly systems, and also the targeted use of industrial robots are the key to a that, economic and quality examinations EQUVGHƄEKGPVRTQFWEVKQP6JGTGUGCTEJGTU validate the applicability of the solutions. KPVJG#UUGODN[6GEJPQNQI[CPF4QDQVKEU 2CTVKEWNCTCVVGPVKQPKUDGKPIRCKFVQVJG group are therefore working on new industrial robot as a universal tool for the UQNWVKQPUVQURGEKƄERTQDNGOUKPVJGUG automation of processes in production. CTGCU5KIPKƄECPVN[CTGCNUQVJGEWTTGPV trends in production. A large part of the Projects work is therefore orientated towards the ■ 'Z Production Management and Logistics 6JGTGUGCTEJITQWR2TQFWEVKQP/CPCIG- ment and Logistics is working on projects with the objective to increase effective- PGUUCPFGHƄEKGPE[QHRTQFWEVKQP6JG research focuses mainly on the design of an effective change management in RTQFWEVKQPCPFVJGKFGPVKƄECVKQPGCTN[ detection and assessment of production technologies. In addition, the working group is researching the effective use of human capabilities and skills as well is bionics in production organization as know-how against the background addressing production-related technical of constantly changing parameters in problems (e.g. layout and route planning) production. An additional area of research by transferring solutions derived from Institute for Industrial Management and Assembly Technologies 165 PCVWTG(TQOVJGUGCTGCUQHTGUGCTEJ Technology Sequences and Equipment and former research focal points evolves HQT#UUGODN[2TQEGUUGUo wide-ranging expertise of the working ■ &GUKIPKPIƅGZKDNGHCEVQT[NC[QWVUDCUGF group in all areas of production manage- on rough planning data. OGPVCPFNQIKUVKEU(WTVJGTOQTGVJG ■ 8KUKQ/s8GJKENGEQPEGRVHQTWTDCP YQTMKPIITQWRYKVJVJG/QFGN(CEVQT[HQT GNGEVTQOQDKNKV[#2n#UUGUUOGPVQH .GCP2TQFWEVKQP .52 KURTQXKFGFYKVJC 2TQFWEVKQPo real production environment that is used ■ (.':5s(NGZKDNGKPVGITCVKQPQHXCNWG within the framework of research, teaching creation-oriented collaboration in the and training on the topic of man and service sector based on eBusiness production and lean management. standards ■ /#067/s'HƄEKGPVRTGRTQFWEVKQP Projects development of variant-rich small series ■ 5($s/CPCIKPIE[ENGUKPKPPQ- production vation processes, sub-projects B3 ■ $/967/s%QPƄIWTCVKQPCPFFKOGP- n&[PCOKE2TQFWEVKQP6GEJPQNQI[ sioning of production networks based 2NCPPKPIo$n&[PCOKE2TQFWEVKQP on bionic principles 5VTWEVWTG2NCPPKPIoCPF$n%[ENKECNN[ ■ +PPQ%[(GTs+PVGITCVGF&GUKIPCPF 1TKGPVGF&GUKIPQH8GTUCVKNG2TQFWEVKQP (CDTKECVKQPQH%WUVQOGT+PFKXKFWCNK\GF 4GUQWTEGUoKPVJGHWPFKPIRJCUG++ 2TQFWEVUKP%[DGT2J[UKECN/CPWHCEVW- CPFVJGVTCPUHGTRTQLGEV6n%[ENKECNN[ ring Systems 1TKGPVGF#UUGUUOGPVCPF2NCPPKPIQH Research Focus Infrastructure ■ 2TQFWEVKQPOCPCIGOGPVCPFNQIKUVKEU ■ 2TQFWEVKQPNKPGHQTDCVVGT[EGNNU ■ Assembly technology and robotics ■ Industrial robots ■ Automation ■ Environmental/safety and teaching laboratories Competence ■ Energetic and geometrical parameters ■ Value creation network and locations ■ Material analysis systems ■ Technology planning ■ Simulation environments ■ (CEVQT[RNCPPKPI ■ Lean management ■ 4GUQWTEGGHƄEKGPVRTQFWEVKQP ■ Knowledge management and didactics ■ System simulation ■ Development and optimization of automation concepts ■ 2GTHQTOKPIDGPEJOCTMUCPFVGEJPQ logical research ■ 2TQFWEVKQPRNCPPKPICPFEQPVTQN systems ■ Assembly-friendly design and produc- tion ■ Assembly planning and scenario evaluation ■ 2TQEGUUCPFOQEMWRFGXGNQROGPV ■ Analysis and optimization of operating behaviour ■ (GGFKPICPFJCPFNKPIVGEJPQNQI[ 166 Institute for Industrial Management and Assembly Technologies Courses Research Scientists ■ #WVQOQDKNG2TQFWEVKQP Nicolas Billot, M.Eng. ■ (CEVQT[2NCPPKPI Dipl.-Ing. Simone Dietrich ■ *WOCP(CEVQTUKP2TQFWEVKQP'PIKPGG- &KRN+PI(CDKCP&KUVGN ring Christiane Dollinger, B.Sc. ■ Methods of Company Management Benny Drescher, M.Sc. ■ Assembly, Handling and Industrial &KRN+PI#NGZCPFGT(WEJU 4QDQVU Dipl.-Ing. Josef Greitemann ■ /CPCIGOGPVQH2TQFWEVKQP'PVGTRTKUGU Till Günther, M.Eng. for Teachers Dipl.-Ing. Veit Hammerstingl ■ 2TCEVKECN%QWTUG%#&%#/5[UVGOU Sven Hawer, M.Sc. ■ 2TCEVKECN%QWTUG'425[UVGOU &KRN+PI (* &CPKGN*QHOCPP ■ 2TCEVKECN%QWTUG+PFWUVTKCN4QDQVU &KRN+PI(NQTKCP-CTN ■ 2TCEVKECN%QWTUG2TQFWEVKQP2NCPPKPI Dipl.-Ing. Thorsten Klein and Control Dipl.-Ing. Thomas Knoche ■ 2TCEVKECN%QWTUG'PGTI[2TQFWEVKXKV[ Dipl.-Ing. Jonas Koch ■ 2TCEVKECN%QWTUG.GCP2TQFWEVKQP Dipl.-Ing. Jakob Kurfer ■ 5GOKPCT2TQFWEVKQP/CPCIGOGPV Dipl.-Ing. Christopher Lock ■ 2TCEVKECN5QHV5MKNNUHQT/GEJCVTQPKE Dipl.-Ing. Edgars Locmelis 2TQEGUUGUKP&GXGNQROGPVCPF2TQFWE- &KRN2J[U)TGIQT.WZ tion &KRN+PI,CP(CDKCP/GKU ■ Seminar Mechatronic Development of Dipl.-Ing. Joachim Michniewicz 2TQFWEVKQP5[UVGOU Dipl.-Wirt.-Ing. Michael Niehues &KRN9KTV+PI%JTKUVKCP2NGJP Management &KRN+PI/CTMWU2TÒRUVGT 2TQH&T+PI)WPVJGT4GKPJCTV&KTGEVQT &KRN9K+PI-KTUVGP4GKUGP Beatrix Kain, Secretary Dipl.-Ing. Benedikt Sager Dipl.-Ing. Johannes Schmalz Adjunct Professors #NGZCPFGT5EJÒPOCPP/5E 2TQH&T+PI,QCEJKO/KNDGTI Dipl.-Ing. Ulrich Teschemacher *QP2TQH&KRN+PI,QEJGP2NCV\ Marco Ulrich, M.Sc. Dipl.-Wirtsch.-Ing. Susanne Vernim Visiting Lectures Dipl.-Ing. Markus Westermeier &T+PI4QDGTV4GKVGT Dipl.-Ing. Carola Zwicker &T+PI4CKPGT5VGVVGT Technical Staff Administrative Staff Armin Braun &KRN+PI (* (TKV\)TKOOGT Gerhard Brethack &KRN+PI (* 1NKXGT*QN\OCPP Andreas Grünwald Nadja Kirmayer Stefan Seidl Tanja Mayer &KRN+PI (* #PFTGCU5GGDCNF Institute for Industrial Management and Assembly Technologies 167 Publications 2013-14 ■ $TCWPTGWVJGTGVCN$TCWPTGWVJGT5 9KGFGP- ■ 4GKPJCTVGVCN4GKPJCTV) +TTGPJCWUGT6 OCPP4 5EJOCN\, 9GUVGTOGKGT/ 4GKPJCTV 4GKUGP- 4GKPJCTFV5 $NGKUVGKPGT6 4COKTG\ G. Auswirkungen von Laserbestrahlung auf #$GYGTVWPIFGU4(+&'KPUCV\GUKOCWVQOQDKNGP .KVJKWO+QPGP 168 Institute for Industrial Management and Assembly Technologies Institute of Applied Mechanics Development, simulation and experimental investigation of complex dynamical and mechatronical systems ■ The focus of the Institute of Applied Mechanics in 2013-14 was to FGXGNQRPGYPWOGTKECNVGEJPKSWGUHQTGHƄEKGPVN[OQFGNKPICPFFGUKIPKPI VJGF[PCOKECNOGEJCPKECNU[UVGOU DQVJHQTOWNVKDQF[F[PCOKEUCPF HQTXKDTCVKQPCPCN[UKU VQKPXGUVKICVGPGYVGEJPKSWGUVQEQPVTQNJWOC- PQKFTQDQVUCPFKPFWUVTKCNOCPKRWNCVQTUCPFVQCFXCPEGGZRGTKOGPVCN VGEJPKSWGUHQTKPXGUVKICVKPIVJGXKDTCVKQPCNDGJCXKQTQHUVTWEVWTGU The research combines theoretical research groups: Dynamic Simulation investigations, design and construction of and Numerical Techniques, Robotics and hardware as well as testing. The institute Mechatronics, and Experimental Dyna- organizes its research activities in three mics. Prof. dr. ir. Daniel Rixen Experimental Dynamics Contact www.amm.mw.tum.de [email protected] Phone +49.89.289.15220 'ZRGTKOGPVCNEJCTCEVGTKUCVKQPQHCVGUVYKPFVWTDKPG 4QVQTVGUVDGPEJYKVJUGPUQTUVQOQPKVQTFGHGEVU #/ EQORQPGPVU #/ Dynamic testing is regularly performed in #UCPWNVKOCVGUWDUVTWEVWTKPICRRNKECVKQP our labs in order to validate models and we also investigate so-called real-time test construction. In addition experimen- substructuring methods, where a hard- tal dynamic techniques are part of our ware component is interacting real-time TGUGCTEJYJGTGYGKORTQXGKFGPVKƄECVKQP with a numerical model. We investigate methods. In one project techniques to novel modeling, sensing and control detect defects in rotors are developed: strategies for such challenging hardware- combining measured displacements and the-loop technology. HQTEGUQPVJGDGCTKPIUYKVJURGEKƄEOQFGNU of the rotor dynamics, defects such as Projects: unbalance, misalignment or shaft curvature ■ Model-based monitoring of rotor (DFG) ECPDGFGVGEVGFCPFKFGPVKƄGF#PQVJGT ■ Real-time substructuring for complex important research topic is experimental systems (internal) substructuring: based on the measured ■ Substructuring methodology for dynamics of components, a full model transfert path analysis (BMW) KUDWKNVPWOGTKECNN[D[URGEKƄECUUGODN[ ■ Four-pole models of car subsystems to techniques. Obtaining an accurate assem- set component requirements (BMW) bled numerical model from measured ■ Experimental substructuring evaluation components requires special measurement on an wind turbine testbench (Iranian techniques and signal processing steps. fellowship) #RRNKECVKQPUECPDGHQWPFKPVJGFGUKIP ■ Dynamic Identifying of a multi-me- of cars or pump assemblies. In our lab we gawatt turbine direct-drive generator test substructuring strategies on a small using operational modal analysis wind turbine as part of an international (XEMC Darwind BV) benchmarking activity for substructuring. Institute of Applied Mechanics 169 Robotics and Mechatronics /GEJCVTQPKEUKUVJGƄGNFFGCNKPIYKVJ targeted spraying of pesticides. In addition vibrating structures or multibody dynami- to the optimization of the mechatronical cal systems actuated and sensed in a design and special attention to modula- EQPVTQNNGFYC[KPQTFGTVQCEJKGXGURGEKƄE TKV[VJGTGUGCTEJCNUQKPXQNXGFURGEKƄE functions. In our institute we develop for trajectory planning of the manipulator for KPUVCPEGCPGPFFGƅGEVQTHQTGPFQUEQRGU operation for instance in greenhouses. in order to enable surgery through a single PCVWTCN QTKƄEG6JGOGEJCPKECNFGUKIPQH Projects VJGFGƅGEVQTPGGFUVQDGEQODKPGFYKVJ ■ Design and control of manipulators for precise actuation in order to allow the single port surgery (DFG) UWTIGQPVJGPGEGUUCT[FGZVGTKV[#URGEKƄE ■ Real-time planning for robust walking application of mechatronics can be found of a humanoid robot (DFG) in robots. Our institute has a long tradition ■ Robust walking for a humanoid robot of designing, constructing and controlling under disturbances (DFG) TQDQVUHQTPQPEQOOQPCRRNKECVKQPU# ■ Gait control of a humanoid robot in JWOCPQKFVYQNGIIGFTQDQV .1.# YCU WPGXGPVGTTCKP &##& built over the last years where state-of- ■ CROPS – Clever Robots for Crops: the-art knowhow is brought together to simulation and control (EU-FP7) advance the design of biped robots and ■ CROPS – Clever Robots for Crops: to develop new control strategies and design, construction and optimization VTCLGEVQT[RNCPPKPINQQMKPIURGEKƄECNN[ of a robotic manipulator (EU-FP7) at methods for stable and autonomous ■ CROPS – Clever Robots for Crops: walking in uneven terrain or under perturba- predictive trajectory planning and VKQPU#NUQQXGTVJGNCUV[GCTUVJGKPUVKVWVG tactile envelope (EU-FP7) has designed and built a manipulator for ■ Biologically inspired control of huma- agricultural applications. This manipulator noid robots (internal) The manipulator for automated was part of a large European project ■ #FCRVKXGHQTEGRQUKVKQPEQPVTQNQHC JCTXGUVKPICPF.1.#VJG (CROPS) focusing on automated harvesting robot for investigative manipulation of JWOCPQKF4QDQV #/ of e.g. peppers, apples or grapes and at human joints (MRI) Dynamic Simulation and Numerical Techniques To obtain accurate dynamical system models multiphysical effects need to be included for instance to account for lubri- ECVKQPƄNOU GNCUVQJ[FTQF[PCOKEU HQT vibro-acoustic interaction or for electro- &[PCOKEOQFGNQHCEQPVKPWQWUN[ magnetical coupling. We also investigate XCTKCDNGVTCPUOKUUKQPVQGXCNWCVG URGEKƄEVKOGKPVGITCVKQPVGEJPKSWGUHQT NQCFKPIQPRWUJDGNVGNGOGPVU #/ the non-smooth dynamics appearing for instance when components are in contact. Designing and optimizing high-tech sys- Models used to analyze the dynamics of VGOUPGEGUUKVCVGUCEEWTCVGCPFGHƄEKGPV structures often contain several millions of modeling. The expertise and research degrees of freedom. We develop methods focus of the institute is mainly in model to characterize the dynamics of linear and reduction aspects, parallel computing non-linear structural models with only a strategies and numerical techniques simu- reduced set of unknowns so that models lating the dynamic of contact between can be used for optimization, design DQFKGUKPENWFKPINWDTKECVKQPVJTQWIJƄNOU XCNKFCVKQPQTCUƅGZKDNGEQORQPGPVUKP 170 Institute of Applied Mechanics multibody dynamic simulations. ■ Finite element tearing and interconnec- In order to use the power of modern ting: preconditioners for heterogeneous multiprocessor computers, we develop problems (Michelin) solution algorithms based on the para- ■ Hybrid and semi-explicit time- digm of domain decomposition: if the integration strategies for non-smooth problem is partitioned in different domains dynamics (internal) (regions of a structural model), the solution ■ Validation of a pushbelt continuously is found by iterating on the interface variable transmission using multibody solution while the behavior in the domains dynamics (Bosch Transmission Techno- are computed independently by different logy BV) processors. We improve those methods ■ Electromagnetic coupling in the dyna- to make them robust for real-life problems mics of generator in direct-drive wind that include for instance high heterogenei- turbines (XEMC Darwind BV) ties, or complex dynamics. ■ Elasto-hydrodynamic models in joint models of multibody dynamical Projects systems (internal) ■ Component reduction and coupled ■ 08*QHVWTDQU ƅQCVKPITKPIDGCTKPIU simulation of off-shore wind turbines and rotordynamics modeling (MHI /QFGNKPIQHVJGRTGUUWTGKP (Siemens Wind Power) Equipment Europe BV) NWDTKECVKQPƄNOQHCƅQCVKPITKPI DGCTKPI 4'NKPI67&GNHV ■ Dual substructuring techniques in linear ■ Modeling of common-rail injectors for and multibody dynamics (internal) HCWNVUFGVGEVKQPCPFEQPVTQNTGEQPƄIW- ■ Varying manifolds as reduction basis ration (DFG) for geometrically non-linear structures ■ Multiscale strategy for noise prediction (internal) QHVKTGU )QQF[GCT5# ■ Domain decomposition techniques for ■ Design and construction of a synchro- dynamic problems (internal) nous centrifugal pendulum absorber ■ FETI method for non-linear multibody (BMW) dynamics (internal) ■ Modeling of gears with defects in system descriptions (DLR) Research Focus Courses ■ Modeling and simulation of dynamical ■ Technical Mechanics (Statics, Elasticity systems and Dynamics) ■ Vibration analysis and rotordynamics ■ Technical Mechanics for Electro- ■ Mechatronics and robotics technique ■ Experimental dynamics ■ Machine Dynamics ■ Simulation of Mechatronical Systems Competence ■ Mechanical Vibration Lab ■ Finite element modeling in dynamics ■ Vibration Measurement Lab ■ Model reduction and substructuring ■ Technical Dynamics ■ Time integration and solvers ■ Robot Dynamics ■ Multiphysical modeling ■ Multibody Dynamics ■ Trajectory planning and control of robots ■ Multibody Dynamics Lab ■ Biped robots ■ Structural Dynamics ■ /QFCNKFGPVKƄECVKQP ■ 'ZRGTKOGPVCN8KDTCVKQP#PCN[UKU ■ Operational modal analysis ■ 5GOKPCTUKP#RRNKGF/GEJCPKEU Infrastructure ■ Mechanical and electronic workshop ■ Vibration and dynamic test lab ■ Robotic lab ■ Dynamics teaching lab Institute of Applied Mechanics 171 Management: Dipl.-Ing. Christoph Schütz Prof. dr. ir. Daniel Rixen, M.Sc., Ordinarius Dipl.-Ing. Robert Wittmann PD Dr.-Ing. habil. Thomas Thümmel, Rob Eling, M.Sc., external candidate Director (TU Delft) Maarten van der Seijs, M.Sc., external Administrative Staff candidate (TU Delft) Manuela Müller-Philipp Dipl.-Ing. Michael Kirschneck, external Rita Schneider candidate (TU Delft) Dipl.-Ing. Michael Kirschneck, external Research Scientists candidate (TU Delft) &KRN+PI#PFTGCU$CTVN Paul van der Valk, M.Sc., external candi- Dipl.-Ing. Jörg Baur date (TU Delft) Dr.-Ing. Thomas Buschmann Dipl.-Ing. Martin Münster, external Dipl.-Math. Eva-Maria Dewes candidate &KRN+PI#NGZCPFGT'YCNF Dipl.-Ing, Constantin von Deimling Fabian Gruber, M.Sc. Frans ven der Linden, M.Sc. external Dipl.-Ing. Kilian Grundl candidate &KRN+PI#TPG%JTKUVQRJ*KNFGDTCPFV Romain Pennec, M.Sc. Dipl.-Ing. Gerald Horst Karamooz Morteza, M.Sc. Dipl.-Ing. Benedikt Huber Daniel Wahrmann, M.Sc. &KRN+PI#PFTGCU-TKPPGT Oliver Hofmann, M.Sc. Dipl.-Ing. Michael Leistner Dipl.-Ing. Johannes Mayet Technical Staff Dipl.-Ing. Julian Pfaff Simon Gerer Dipl.-Ing. Markus Roßner Georg König Dipl.-Ing. Johannes Rutzmoser Georg Mayr Dr.-Ing. Thorsten Schindler Publications 2013-14 ■ $CTVJ4 $CWT, $WUEJOCPP6 'FCP; ■ *KNFGDTCPFV#TPG%JTKUVQRJ 9KVVOCPP4QDGTV *GNNUVTÒO6 0IW[GP6 4KPIFCJN1 5CG[U9 9CJTOCPP&CPKGN 'YCNF#NGZCPFGT $WUEJOCPP 5CNKPCU% 8KV\TCDKP' 7UKPI415HQT#ITKEWNVWTCN 6JQOCU 4GCN6KOG&%QNNKUKQP#XQKFCPEGHQT Robotics – Design Considerations and Experiences. $KRGF4QDQVU+'''45,+PVGTPCVKQPCN%QPHGTGPEG 2TQEGGFKPIUQHVJG5GEQPF4*'#+PVGTPCVKQPCN on Intelligent Robots and Systems (IROS), 2014 %QPHGTGPEGQP4QDQVKEUCPF#UUQEKCVGF*KIJVGEJ- ■ *WDGT$ 7NDTKEJ* /QFGNKPICPF'ZRGTKOGPVCN PQNQIKGUCPF'SWKROGPVHQT#ITKEWNVWTG Validation of the Solenoid Valve of a Common Rail ■ $CWT, &GPFQTHGT5 2HCHH, 5EJWGV\% &KGUGN+PLGEVQT5#'6GEJPKECN2CRGT $WUEJOCPP6 7NDTKEJ* 'ZRGTKOGPVCN(TKEVKQP ■ *WDGT$ 7NDTKEJ* 'ZRGTKOGPVCN'XCNWCVKQPQH +FGPVKƄECVKQPKP4QDQV&TKXGU4QDQVKEUCPF#WVQ- the Static Magnetic Force and Dynamic Investiga- OCVKQP +%4# +'''+PVGTPCVKQPCN%QPHGTGPEG tion of the Solenoid Valve of a Common Rail Diesel on, 2014 +PLGEVQT2TQEGGFKPIUQHVJG(+5+6#9QTNF ■ $CWT, 5EJWGV\% 2HCHH, $WUEJOCPP6 #WVQOQVKXG%QPITGUU Ulbrich, H.: Path Planning for a Fruit Picking ■ *WDGT$ 7NDTKEJ* 5KOWNCVKQPCPF8CNKFCVKQP /CPKRWNCVQT+PVGTPCVKQPCN%QPHGTGPEGQH#ITKEWNVWTCN of a Common Rail Diesel Injector. Proceedings of Engineering, 2014 the Ninth International Conference on Engineering ■ $CWT, 5EJWGV\% 2HCHH, 7NDTKEJ* /QFGNKPI Computational Technology, 2014 CPF%QPVTQNQH2PGWOCVKE#TVKƄEKCN/WUENGUKPCP ■ -KTUEJPGEM/ 4KZGP&, 2QNKPFGT*GPM #PVCIQPKUVKE5GVWR2TQEGGFKPIUQHVJG+/5& Ostayen, Ron van: Effects of Magneto-Mechanical #%/& %QWRNKPIQP5VTWEVWTCN/QFCN2CTCOGVGTU+/#% ■ $QPVUGOC, *GOOKPI, 2GMMGTKGV' 5CG[U :::++ +PVGTPCVKQPCN/QFCN#PCN[UKU%QPHGTGPEG 9 'FCP; 5JCRKTQ# *QìGXCT/ *GNNUVTÒO Orlando, FL, 2014 6 1DGTVK4 #TOCFC/ 7NDTKEJ* $CWT, ■ -TKPPGT# 6JØOOGN6 2GVW[C8CPF2KPVQ% &GDKNFG$ $GUV5 'XCKP5 )CWEJGN9 and Lovasz E.-C. (Hrsg.): Non-smooth Behaviour Ringdahl, O.: CROPS: high tech agricultural robots. of a Linkage Mechanism with Revolute Clearance +PVGTPCVKQPCN%QPHGTGPEGQH#ITKEWNVWTCN'PIKPGGTKPI Joints. Band Mechanisms and Machine Science. 2014 5RTKPIGT8GTNCI #Wƅ 172 Institute of Applied Mechanics ■ /C[GV, )TWDGT( 2GPPGE4 4KZGP& 7NDTKEJ ■ 5EJWGV\% 2HCHH, $CWT, $WUEJOCPP6 H.: Numerical Investigation of Centrifugal Pendulum 7NDTKEJ* #/QFWNCT4QDQV5[UVGOHQT#ITK- 8KDTCVKQP#DUQTDGT4GURQPUGU'01% EWNVWTCN#RRNKECVKQPU+PVGTPCVKQPCN%QPHGTGPEGQH ■ /C[GV, 7NDTKEJ* 6CWVQEJTQPKEEGPVTKHWICN #ITKEWNVWTCN'PIKPGGTKPI pendulum vibration absorbers. Journal of Sound ■ 5EJWGV\%JTKUVQRJ $WUEJOCPP6JQOCU $CWT CPF8KDTCVKQP ,QGTI 2HCHH,WNKCP 7NDTKEJ*GKP\ 2TGFKEVKXGQPNKPG ■ /WGPUVGT/CTVKP .GJPGT/KEJCGN 4KZGP&CPKGN, inverse kinematics for redundant manipulators. Requirements for the Response to Disturbance of 4QDQVKEUCPF#WVQOCVKQP +%4# +''' Steering and Suspension Systems based on Vehicle International Conference on, 2014 Targets. 14. Internationalen Stuttgarter Symposium, ■ 5GKLU/8XCPFGT 8CNM2.%XCPFGT *QTUV6 2014 XCPFGT 4KZGP&, 6QYCTFU&[PCOKE5WDUVTWEVWT ■ 1DGTVK4 /CTEJK/ 6KTGNNK2 %CNECPVG# +TKVK ing using Measured Impulse Response Functions. / *QìGXCT/ $CWT, 2HCHH, 5EJWGV\% +/#%:::++ +PVGTPCVKQPCN/QFCN#PCN[UKU%QPHGT 7NDTKEJ* %4125#ITKEWNVWTCN4QDQV #RRNKECVKQP ence, Orlando, FL, 2014 to Selective Spraying of Grapevine’s Diseases. ■ 8CNM2CWN.%XCPFGT 4KZGP&CPKGN, 6QYCTFU 2TQEGGFKPIUQHVJG5GEQPF4*'#+PVGTPCVKQPCN a parallel time integration method for nonlinear %QPHGTGPEGQP4QDQVKEUCPF#UUQEKCVGF*KIJVGEJ- U[UVGOU+/#%:::++ +PVGTPCVKQPCN/QFCN#PCN[UKU PQNQIKGUCPF'SWKROGPVHQT#ITKEWNVWTG Conference, Orlando, FL, 2014 ■ 2HCHH, $CWT. 5EJWGV\% $WUEJOCPP6 ■ 9KVVOCPP4QDGTV *KNFGDTCPFV#TPG%JTKUVQRJ 7NDTKEJ* &GUKIPQH&TKXG7PKVUHQT#ITKEWNVWTCN 'YCNF#NGZCPFGT $WUEJOCPP6JQOCU #P 4QDQVU+PVGTPCVKQPCN%QPHGTGPEGQH#ITKEWNVWTCN 'UVKOCVKQP/QFGNHQT(QQVUVGR/QFKƄECVKQPUQH Engineering, 2014 $KRGF4QDQVU+'''45,+PVGTPCVKQPCN%QPHGTGPEG ■ 2HGKHHGT(TKGFTKEJ 5EJKPFNGT6JQTUVGP 'KPHWGJTWPI on Intelligent Robots and Systems (IROS), 2014 in die Dynamik. Springer, 2014 ■ XCPFGT8CNM2CWN.% 4KZGP&CPKGN, #P+ORWNUG ■ 4QUUPGT/ 6JWGOOGN6 7NDTKEJ* 1PNKPG Based Substructuring method for coupling impulse 4QWPFPGUU'TTQT+FGPVKƄECVKQPCPF/QFGNDCUGF TGURQPUGHWPEVKQPUCPFƄPKVGGNGOGPVOQFGNU Monitoring for Rotors. 10th International Confe- %QORWVGT/GVJQFUKP#RRNKGF/GEJCPKEUCPF rence on Vibration Engineering and Technology of 'PIKPGGTKPI Machinery (Vetomac), 2014 ■ $CWT, 2HCHH, 5EJWGV\% 7NDTKEJ* &[PCOKE ■ 4QUUPGT/ 6JWGOOGN6 7NDTKEJ* +PENWUKQP modeling and realization of an agricultural manipu- of Unsteady Bow in a Model-Based Monitoring lator. Proceedings of XV International Symposium System for Rotors. 9th IFToMM International QP&[PCOKE2TQDNGOUQH/GEJCPKEU&+0#/' Conference on Rotor Dynamics, 2014 ■ $QUEJ#NNGTV 5EJOGJN4QNCPF 6KUQ2CQNQCPF ■ 4WV\OQUGT,QJCPPGU$ 4KZGP&CPKGN, /QFGN 4KZGP&CPKGN 0QPNKPGCTCGTQGNCUVKEKV[ƅKIJV Order Reduction for Geometric Nonlinear Structures F[PCOKEUCPFEQPVTQNQHCƅGZKDNGOGODTCPG with Variable State-Dependent Basis. Dynamics of VTCEVKQPMKVGs+P 4QNCPF5EJOGJN7YG#JTGPU Coupled Stuctures (Conference Proceedings of the CPF/QTKV\&KGJN *TUI #KTDQTPG9KPF'PGTI[ Society for Experimental Mechanics Series), 2014 5RTKPIGT8GTNCIs ■ Schindler, Thorsten: Consistent high-frequency ■ $WUEJOCPP6'YCNF# 5EJYKGPDCEJGT/ FCORKPIHQTPQPUOQQVJƅGZKDNGOWNVKDQF[ (CXQV8 7NDTKEJ* *WOCPQKFG.CWHOCUEJKPGP U[UVGOU#DUVTCEVUQH6JGVJ#+/5%QPHGTGPEG CVs#WVQOCVKUKGTWPIUVGEJPKM on Dynamical Systems, Differential Equations and ■ 'NKPI4 XCP1UVC[GP4 4KZGP&, &[PCOKEU #RRNKECVKQPU of rotors on hydrodynamic bearings. Comsol ■ Schindler, Thorsten: Timestepping schemes based %QPHGTGPEG4QVVGTFCO on discontinuous Galerkin methods. Proceeding ■ 'XGTFKL(2: .NQDGTCU8CNNU1 5KOQPG# 4KZGP of the 11th World Congress on Computational &, 5NW[U., &QOCKP&GEQORQUKVKQPCPF Mechanics, 2014 2CTCNNGN&KTGEV5QNXGTUCUCP#FCRVKXG/WNVKUECNG ■ Schindler, Thorsten: Consistent higher order Strategy for Damage Simulation in Materials. KPVGITCVKQPQHPQPUOQQVJOGEJCPKECNU[UVGOU#DU- Domain Decomposition DD22, Lugano, Switzerland, VTCEVUQH6JGVJ#+/5%QPHGTGPEGQP&[PCOKECN 5[UVGOU&KHHGTGPVKCN'SWCVKQPUCPF#RRNKECVKQPU ■ 'XGTFKL(2: .NQDGTCU8CNNU1 5KOQPG# 4KZGP 2014 &, .CODGTVWU,5 &QOCKP&GEQORQUKVKQPCPF ■ 5EJKPFNGT6JQTUVGP #ECT[8KPEGPV 6KOGUVGRRKPI 2CTCNNGN&KTGEV5QNXGTUCUCP#FCRVKXG/WNVKUECNG schemes for nonsmooth dynamics based on Strategy for Damage Simulation in Quasi-Brittle FKUEQPVKPWQWU)CNGTMKPOGVJQFU &GƄPKVKQPCPF /CVGTKCNU outlook. Mathematics and Computers in Simulation ■ /CTVÉPG\* 1DUV6 7NDTKEJ* $WTIMCTV4 # 95, 2014, 180-199 novel application of direct force control to perform ■ 5EJQGFGT5XGPLC 7NDTKEJ*GKP\ 5EJKPFNGT in-vitro biomechanical tests using robotic techno- Thorsten: Discussion of the Gear-Gupta-Leim- NQI[,QWTPCNQHDKQOGEJCPKEU 5 kuhler method for impacting mechanical systems. /WNVKDQF[5[UVGO&[PCOKEU ■ 5EJWGV\% $CWT, 2HCHH, $WUEJOCPP6 Ulbrich, H.: Multipurpose Redundant Manipulators HQT#ITKEWNVWTCN6CUMU#WUVTKCP4QDQVKEU9QTMUJQR .KP\#WUVTKC Institute of Applied Mechanics 173 Institute of Thermodynamics 6GEJPQNQI[FTKXGPVJGTOQƅWKFF[PCOKEUTGUGCTEJ ■1WTTGUGCTEJIWKFGNKPGKUVJGRTQRQUKVKQPVJCVUEKGPVKƄETGUGCTEJKPCP engineering school should be focussed on problems with high technologi- cal relevance. A key to realizing our mission is the close cooperation with the industry in general and in particular with partners who – developing their high class global products to the leading edge of technology – have encountered barriers that might be overcome by fundamental research. Our partner industries are optimizing their ting engines require basic understanding technologies towards lower carbon foot- QHOWNVKRJCUGRJGPQOGPC#NVGTPCVKXG print, integration with renewable power thermal comfort systems are explored to UQWTEGUCPFGPXKTQPOGPVCNEQORCVKDKNKV[ KORTQXGVJGGHƄEKGPE[QHOQDKNKV[CRRNKEC- Prof. Dr.-Ing. 6JGKTTGUGCTEJPGGFUCTGTGƅGEVGFKPQWT VKQPU Thomas Sattelmayer HQWTTGUGCTEJITQWRU6JGKPETGCUGQHHWGN The appreciation of this approach in the GHƄEKGPE[CPFQRGTCVKQPCNƅGZKDKNKV[CVNQY VGEJPKECNEQOOWPKV[KUTGƅGEVGFD[VJG Contact pollutant emissions pursued in the power ƄXG$GUV6GEJPKECN2CRGT#YCTFUQWT industry requires fundamental research in research group has received from the YYYVFOYVWOFG $CUUGVV"VFOYVWOFG the areas of combustion fundamentals, #5/'+PVGTPCVKQPCN)CU6WTDKPG+PUVKVWVG 2JQPG emissions and reliability and combustion Combustion and Fuels Committee during KPUVCDKNKVKGU2QNNWVCPVTGFWEVKQPCPFHWGN VJGRCUVƄHVGGP[GCTU ƅGZKDKNKV[FGXGNQROGPVKPNCTIGTGEKRTQEC- Combustion Fundamentals Projects ■ Piloted natural gas combustion in large bore reciprocating engines with internal and external fuel air mixing Investigation of the correlation ■ (NCOGCEEGNGTCVKQPCPFFGƅCITCVKQPVQ between heat release and OH* detonation transition radiation ■ Chemiluminescence and heat release ■ Thermal luminescence in high tempera- Turbulence-chemistry interaction is the VWTGƅCOGU common research topic of this work group ■ Supersonic combustion in scramjets with applications from scramjets to reheat ■ Low oxygen combustion in gas turbines EQODWUVQTUCUYGNNCUƅCOGCEEGNGTCVKQP with exhaust gas recirculation CPFFGƅCITCVKQPFGVQPCVKQPVTCPUKVKQPKP ■ 6WTDWNGPVƅCOGRTQRCICVKQPKPNGCP EQPƄPGOGPVUCPFTGEKRTQECVKPIGPIKPGU J[FTQIGPƅCOGU The group shares common numerical and experimental approaches to describe the RTQEGUUGUQHWPUVGCF[EQODWUVKQP 174 Institute of Thermodynamics Combustion Emissions and Reliability #NVGTPCVKXGHWGNUCTGCEJCNNGPIGHQT ■ Premixed swirl burner aerodynamics gas turbine combustors with respect to ■ Lean blowout and emissions combustion emissions, stability, autoigni- ■ Staged premixed combustion VKQPCPFƅCUJDCEMUCHGV[6JKUYQTMITQWR ■ CO quenching in staged gas turbine investigates the fundamental processes combustors at part load and develops rules applicable to new ■ +ORTQXGOGPVQHICUVWTDKPGRCTVNQCF combustor designs with respect to low emissions by on-board fuel reforming GOKUUKQPHWGNƅGZKDNGQRGTCVKQP ■ Power augmentation of gas turbines Visible light-emissions of with premixed combustors and water WPEQPƄPGFUYKTNGFOGVJCPGCPF J[FTQIGPƅCOGU Projects injection ■ 9CNNƅCUJDCEM ■ Premixed hydrogen combustion at ■ Combustion induced vortex breakdown ultra-high combustor inlet temperatures ■ Flame stabilization at the fuel injectors of premix burners ■ Syngas combustion in premixed swirl burners Combustion Instabilities and Noise The strong coupling of acoustics and JGCVTGNGCUGKPEQPƄPGFƅCOGUNGCFUVQC feedback loop which can result in violent EQODWUVKQPKPUVCDKNKVKGU6JGUGCTGC threat for gas turbines, rocket motors and other combustion devices because they result in substantial pressure oscillations, Instantaneous pressure distri- structural vibrations and increased heat bution in a rocket motor nozzle related to higher order acoustic VTCPUHGT%QODWUVKQPKPUVCDKNKVKGUTGFWEG modes the lifetime, limit the operation range or even lead to severe damage of combus- VKQPU[UVGOU6JKUTGUGCTEJITQWRWUGU numerical and experimental techniques on ■ High frequency instabilities in gas a wide range of topics from combustion turbine combustors KPUVCDKNKV[NKMGƅCOGVQƅCOGKPVGTCEVKQP ■ #EQWUVKEVTCPUHGTHWPEVKQPUQHICU prediction of combustion instability, active VWTDKPGCPFTQEMGVOQVQTƅCOGU KPUVCDKNKV[EQPVTQNCPFƅCOGPQKUG ■ #EQWUVKENQUUGUKPEQODWUVKQP chambers Projects ■ Passive damping of combustion ■ Combustor design for thermoacoustic instabilities UVCDKNKV[ &'6#5 ■ 4QEMGVOQVQTFCORKPIOGEJCPKUOU ■ Thermoacoustic stability of annular gas ■ 4QEMGVOQVQTƅCOGF[PCOKEUCPF turbine combustors stability ■ Thermoacoustics of aeroengine com- ■ Combustion noise generation and bustors propagation in vehicle auxiliary heaters and aeroengine combustors Institute of Thermodynamics 175 Multiphase Phenomena Projects ■ +PƅWGPEGQHVWTDWNGPEGCPFUGEQPFCT[ ƅQYUQPUWDEQQNGFƅQYDQKNKPI ■ %TKVKECNJGCVƅWZKPVYQRJCUGƅQYU ■ 6TCPUKVKQPHTQOUVTCVKƄGFVQRNWIUNWI Stereo-PIV measurements of the ƅQY transition regime from plug to ■ NOx-generation in partially premixed UNWIƅQY sprays ■ Selective catalytic NOx-removal /WNVKRJCUGƅQYUCPFU[UVGOURNC[CP ■ #VQOK\CVKQPCPFOKZKPICVGZVTGOG important role in numerous applications injection and air pressures KPRTQEGUUCPFRQYGTGPIKPGGTKPI ■ Concentration of liquid residues from While seemingly diverse this research biogas plants ITQWRQPOWNVKRJCUGƅQYETGCVGUUVTQPI ■ +PPQXCVKXGUQNCTFGUCNKPCVKQPRTQEGUUGU synergies in modeling and experimental ■ /GODTCPGFKUVKNNCVKQPYKVJEQPEGPVTCV VQQNU4GUGCTEJVQRKEUTCPIGHTQODQKNKPI KPI286 and condensation phenomena to water ■ Solar thermal hydrogen and nitrogen desalination and from droplet dynamics extraction from regolith to transport in porous media, transport of gas-liquid mixtures, spray research and GZJCWUVICUENGCPKPI Energy and Environmental Technologies Projects ■ Passenger comfort and thermal management of future electric vehicles ■ Low cost heating for electric vehicles ■ *8#%HQTXGJKENGUKPJWOKFENKOCVG ■ #RRNKECVKQPQH286J[DTKFUQNCTEQNNGE- tors in desalination 2-axis tracker for testing solar ■ Reverse osmosis desalination powered installations (heliostat) on the D[VTCPUKGPVJ[DTKFRJQVQXQNVCKEVJGTOCN mechanical engineering faculty roof solar systems ■ 5OCNNUECNGJWOKFKƄECVKQPFGJWOKFKƄ- The research topics of this work group cation-plant for solar seawater desali- cover conventional as well as solar nation driven desalination processes, chemical ■ Solar-powered air-conditioning using storage for solar and wind energy, new thermal-regenerative liquid sorbents applications of photovoltaic and solar ■ Dehydrogenation of carbazole and thermal collectors, thermal comfort in thermal oils used for hydrogen storage electric and hybrid vehicles and green DWKNFKPIUQNWVKQPU6JGITQWRQRGTCVGU a Solar Research Center, where novel solar applications are investigated under TGCNKUVKECODKGPVEQPFKVKQPU 176 Institute of Thermodynamics Research Focus Courses ■ Combustion instabilities and noise ■ 6JGTOQF[PCOKEU+ ++ ■ 4GCEVKXGƅQYU ■ Combustion ■ 6YQRJCUGƅQYU ■ Desalination ■ 'PGTI[U[UVGOU ■ 'PGTI[1RVKOK\CVKQPQH$WKNFKPIU ■ 5QNCT'PIKPGGTKPI Competence ■ #WVQOQVKXG#KT%QPFKVKQPKPI ■ 'ZRGTKOGPVCNCPFVJGQTGVKECNUVWF[QH ■ Thermo-Fluiddynamics Lab combustion and thermo-acoustics ■ Combustion Technology Lab ■ Stability analysis of combustion ■ Solar Technology Lab systems ■ &CVC#ESWKUKVKQP%QPVTQNU.CD ■ 'ZRGTKOGPVCNCPFVJGQTGVKECNUVWF[QH low-emission constant pressure and Management constant volume combustion 2TQH&T+PI6JQOCU5CVVGNOC[GT ■ 5KOWNCVKQPQHƅQYJGCVVTCPUHGTCPF Director combustion 2TQHGO&T+PI&T+PI'J(TCP\ ■ 'ZRGTKOGPVCNCPFVJGQTGVKECNUVWF[QH /C[KPIGT'OGTKVWU VYQRJCUGƅQYCPFDQKNKPI 2TQHK4&T+PI&T+PIJCDKN,QJCPPGU 5VTCWD'OGTKVWU Infrastructure ■ /GEJCPKECNYQTMUJQRGNGEVTQPKEU Senior Scientists workshop &T+PI%JTKUVQRJ*KTUEJ ■ %QODWUVKQPEQODWUVKQPKPUVCDKNKV[ &T+PI/CTMWU5RKPPNGT research: Test cells for experiments from lab to engine scale, 40bar laminar Lecturers ƅCOGTKICVOQURJGTKEUKPINGDWTPGT &T+PI,ØTIGP$NWOGPDGTI TKIUM9CPPWNCTEQODWUVQT &T+PI#NGZCPFGT-QND M9*2TKIDCTM9YCVGT &T+PI*GKP\)ØPVJGT5QPPGPDWTI EJCPPGNHQTƅWKFF[PCOKEUCPFOKZKPI UVWFKGUOOTCRKFEQORTGUUKQP Administrative Staff machines, dynamical constant volume Helga Bassett combustion cell, detonation channel &KRN+PI (* 5KITKF5EJWN\4GKEJYCNF ■ 6YQRJCUGƅQYTGUGCTEJ DQKNKPINQQR water-air two-phase loop, test rigs for Research Scientists studies of catalytic process &KRN+PI&GPKUG#JTGPU/# ■ 6QQNU JKIJURGGF *5 2+82+8.&8 &KRN+PI5VGHCP$CWGT 2&#*5.+(%9NCUGTU*5ECOGTCU &KRN+PI/CZ$CWOIÀTVPGT MHRUKPVGPUKƄGTUURGEVTQOGVGTU (TGFGTKM$GTIGT/5E ƄNVGTUFKIKVCNJQNQITCRJ[GOKUUKQP /KEJCGN$GV\/5E analyzers, dynamical temperature /QTKV\$TWFGT/5E and pressure probes, cluster for &KRN+PI.QTGP\$ÒEM UEKGPVKƄEEQORWVKPIPWOGTQWUEQFGU &KRN+PI6JQOCU(KCNC %(&.05'.''CEQWUVKEUTGCEVKQP &KRN+PI)GQTI(KPM MKPGVKEU|e &KRN+PI/CTEWU)TQEJQYKPC &KRN+PI$CNDKPC*CORGN &KRN+PI,QUGH*C»NDGTIGT &KRN+PI/KEJCGN*GTVYGEM 0QTDGTV*GWDNGKP/5E &KRN+PI8GTC*QHGTKEJVGT 6QDKCU*WOOGN/5E &KRN+PI-CVTKP,QJÅ /KEJCGN,WF/5E 2GVGT-CV\[/5E Institute of Thermodynamics 177 (NQTKCP-KGHGT/5E Technical Staff 0QCJ-NCTOCPP/5E Bernhard Strobl &KRN+PI/KEJCGN-QND (NQTKCP-TKUV &KRN+PI#NGZCPFGT-TQK» Thomas Schleussner 5VGRJCP.GNNGM/5E ,GPU*ØOOGT &KRN+PI-QPTCF/CMQYMC ,QUGH&QTTGT &KRN+PI#NGZCPFGT2TÀDUV )GTJCTF)KGN 2CWN4KHHCV/5E 1IWNECP-QEGT /KEJCGN5EJKHHPGT/5E /CTLCPQXKE6QOKUNCX &KRN+PI/QTKV\5EJWN\G Claus Wimmer &KRN+PI0KEQNCK5VCFNOCKT %QPUVCP\G6GOONGT/5E &KRN+PI9QNHTCO7NNTKEJ &KRN+PI/CVVJKCU7VUEJKEM &KRN+PI,QJCPPGU9GKP\KGTN 5VGHCP9GP\GN/5E /CZ Publications 2013-14 ■ (KCNC6 5CVVGNOC[GT6 *GCV4GNGCUGCPF1* ■ ,ÒTI%J )KMCFK, 5CVVGNOC[GT6 0WOGTKECN Radiation in Laminar Non-Premixed Hydrogen- +PXGUVKICVKQPQHVJG2NCPG9CXG4GƅGEVKQP%Q 1Z[IGP(NCOGUUV#+###GTQURCEG5EKGPEGU GHƄEKGPVQHCP'ZJCWUV2KRGCV'NGXCVGF6GORGTC- /GGVKPI)TCRGXKPG6GZCU VWTGUWUKPI.KPGCTK\GF0CXKGT5VQMGU'SWCVKQPU ■ 'VVPGT( 8QNNOGT- 5CVVGNOC[GT6 /CEJ4GƅGE- 2TQEGGFKPIUQH#5/'6WTDQ'ZRQ0Q VKQPKP&GVQPCVKQPU2TQRCICVKPIVJTQWIJC)CUYKVJ )65CP#PVQPKQ75#,WPG C%QPEGPVTCVKQP)TCFKGPV5JQEM9CXGU8QNWOG ■ 6CWVUEJPKI) *CORGN$ *KTUEJ% 5CVVGNOC[GT +UUWGRR/C[ 6 'ZRGTKOGPVCN+PXGUVKICVKQPQH1* CPF%* ■ 5EJYKPI, 5CVVGNOC[GT6 *KIJ(TGSWGPE[ Chemiluminescence Under Varying Operating +PUVCDKNKVKGUKP%[NKPFTKECN(NCOG6WDGU (GGFDCEM %QPFKVKQPU2TQEGGFKPIUQH#5/'6WTDQ'ZRQ /GEJCPKUOCPF&CORKPI2TQEGGFKPIUQH#5/' 0Q)65CP#PVQPKQ75#,WPG 6WTDQ'ZRQ0Q)65CP#PVQPKQ 75#,WPG ■ 9CIPGT/ ,ÒTI% 5CVVGNOC[GT6 %QORCTKUQP ■ 5GKFGN8 /CTQUM[# 5CVVGNOC[GT6 )GPI9 QHVJG#EEWTCE[QH6KOG&QOCKP/GCUWTGOGPV /CIPK( 6JG'HHGEVQH%QQNKPI#KTQPVJG#KT(WGN /GVJQFUHQT%QODWUVQT&CORKPI2TQEGGFKPIUQH Distribution of a Silo Combustor, Proceedings of #5/'6WTDQ'ZRQ0Q)65CP #5/'6WTDQ'ZRQ0Q)65CP #PVQPKQ75#,WPG #PVQPKQ75#,WPG ■ )KMCFK, 7NNTKEJ9% 5CVVGNOC[GT6 6WTTKPK ■ 5GKFGN8 /CTQUM[# *KTUEJ% 5CVVGNOC[GT ( 2TGFKEVKQPQHVJG#EQWUVKE.QUUGUQHC5YKTN 6 )GPI9 /CIPK( +PƅWGPEGQHVJG+PƅQY #VQOK\GT0Q\\NGWPFGT0QP4GCEVKXG%QPFKVKQPU %QPƄPGOGPVQPVJG(NCUJDCEM.KOKVUQHC2TGOKZGF 2TQEGGFKPIUQH#5/'6WTDQ'ZRQ0Q 5YKTN$WTPGT2TQEGGFKPIUQH#5/'6WTDQ'ZRQ )65CP#PVQPKQ75#,WPG 0Q)65CP#PVQPKQ75#,WPG ■ 9CIPGT/ 5EJWN\G/ 5CVVGNOC[GT6 'ZRGTKOGPVCN+PXGUVKICVKQPQH#EQWUVKE2TQRGTVKGU ■ $CWOICTVPGT) 5CVVGNOC[GT6 'ZRGTKOGPVCN QH1TKƄEGUCPF2GTHQTCVGF2NCVGUKPVJG*KIJ/CEJ +PXGUVKICVKQPQHVJG(NCUJDCEM.KOKVUCPF(NCOG 0WODGT4GIKOGVJ+PVGTPCVKQPCN%QPITGUUQP 2TQRCICVKQP/GEJCPKUOUHQT2TGOKZGF*[FTQ- 5QWPFCPF8KDTCVKQP +%58 $CPIMQM6JCKNCPF IGP#KT(NCOGUKP0QP5YKTNKPICPF5YKTNKPI(NQY ,WN[ 2TQEGGFKPIUQH#5/'6WTDQ'ZRQ0Q ■ 5EJWN\G/ 5EJOKF/ /QTIGPYGEM& -ÒIN- )65CP#PVQPKQ75#,WPG OGKGT5 5CVVGNOC[GT6 #%QPEGRVKQPCN#RRTQCEJ ■ $CWOICTVPGT) 5CVVGNOC[GT6 'ZRGTKOGPVCN for the Prediction of Thermoacoustic Stability in +PXGUVKICVKQPQPVJG'HHGEVQH$QWPFCT[.C[GT(NWKF 4QEMGV'PIKPGUVJ#+###5/'5#'#5'' +PLGEVKQPQPVJG(NCUJDCEM2TQRGPUKV[QH2TGOKZGF ,QKPV2TQRWNUKQP%QPHGTGPEG5CP,QUG%CNKHQTPKC *[FTQIGP#KT(NCOGU2TQEGGFKPIUQH#5/'6WTDQ 'ZRQ0Q)65CP#PVQPKQ75# ■ (KCNC6 5CVVGNOC[GT6 1PVJG7UGQH1* ,WPG 4CFKCVKQPCUC/CTMGTHQTVJG*GCV4GNGCUG4CVG ■ 5EJOKVV& -QND/ 9GKP\KGTN, *KTUEJ% in High-Pressure Hydrogen-Oxygen Liquid Rocket 5CVVGNOC[GT6 +IPKVKQPCPF(NCOG5VCDKNK\CVKQPQH %QODWUVKQPVJ#+###5/'5#'#5'',QKPV C2TGOKZGF,GVKP*QV%TQUU(NQY2TQEGGFKPIUQH 2TQRWNUKQP%QPHGTGPEG5CP,QUG%CNKHQTPKC #5/'6WTDQ'ZRQ0Q)65CP #PVQPKQ75#,WPG 178 Institute of Thermodynamics ■ /CTQUM[# 5GKFGN8 5CVVGNOC[GT6 /CIPK( ■ *QHGTKEJVGT8 #JTGPU& -QND/ 5CVVGNOC[GT6 )GPI9 +ORCEVQH%QQNKPI#KT+PLGEVKQPQPVJG #4GCEVQT/QFGNHQTVJG01Z(QTOCVKQPKPC4GCEV Combustion Stability of a Premixed Swirl Burner KPI,GVKP*QV%TQUU(NQY7PFGT#VOQURJGTKECPF 0GCT.GCP$NQYQWV,QWTPCNQH'PIKPGGTKPIHQT)CU *KIJ2TGUUWTG%QPFKVKQPU2TQEGGFKPIUQH#5/' 6WTDKPGUCPF2QYGT8QN+UUWG 6WTDQ'ZRQ)6&ØUUGNFQTH,WPG |RCIGU &QK ■ $CFG5 9CIPGT/ *KTUEJ% 5CVVGNOC[GT ■ 5CVVGNOC[GT6 /C[GT% 5CPIN, +PVGTCEVKQP 6 5EJWGTOCPU$ &GUKIPHQT6JGTOQ#EQWUVKE QH(NCOG(NCUJDCEM/GEJCPKUOUKP2TGOKZGF 5VCDKNKV[ /QFGNKPIQH$WTPGTCPF(NCOG&[PCOKEU *[FTQIGP#KT5YKTN(NCOGU2TQEGGFKPIUQH#5/' ,QWTPCNQH'PIKPGGTKPIHQT)CU6WTDKPGUCPF2QYGT 6WTDQ'ZRQ)6&ØUUGNFQTH,WPG 8QN+UUWG RCIGU &1+ ■ 6CWVUEJPKI) *CPGT'/ *KTUEJ% 5CVVGN- ■ $CFG5 9CIPGT/ *KTUEJ% 5CVVGNOC[GT6 OC[GT6 'ZRGTKOGPVCNCPF0WOGTKECN+PXGUVKICVKQP 5EJWGTOCPU$ &GUKIPHQT6JGTOQ#EQWUVKE5VCDK- QH%QPƄPGF,GVUKP*QV%Q(NQY2TQEGGFKPIUQH NKV[ 2TQEGFWTGCPF&CVCDCUG,QWTPCNQH'PIKPGG- #5/'6WTDQ'ZRQ)6&ØUUGN- TKPIHQT)CU6WTDKPGUCPF2QYGT8QN+UUWG FQTH,WPG RCIGU &1+ ■ #JTGPU& -QND/ *KTUEJ% 5CVVGNOC[GT6 ■ 5EJOKF/ $NWOGPVJCN45 5EJWN\G/ 2QNKHMG 01Z(QTOCVKQPKPC4GCEVKPI2TGOKZGF,GVKP*QV 9 5CVVGNOC[GT6 3WCPVKVCVKXG5VCDKNKV[#PCN[UKU %TQUU(NQY2TQEGGFKPIUQH#5/'6WTDQ'ZRQ 7UKPI4GCN8CNWGF(TGSWGPE[4GURQPUG&CVC,QWT- )6&ØUUGNFQTH,WPG PCNQH'PIKPGGTKPIHQT)CU6WTDKPGUCPF2QYGT8QN ■ 7NNTKEJ9% )KMCFK, ,ÒTI% 5CVVGNOC[GT6 +UUWG&1+ #EQWUVKEGPVTQR[EQWRNKPIDGJCXKQTCPFCEQWUVKE ■ $NQEJ) /WUGNOCPP9 5CKGT/ 5CVVGNOC[GT UECVVGTKPIRTQRGTVKGUQHC.CXCNPQ\\NG#+###XK 6 #RJGPQOGPQNQIKECNUVWF[QPGHHGEVUNGCFKPIVQ CVKQPVJ#+##%'#5#GTQCEQWUVKEU%QPHGTGPEG the departure from nucleate boiling in subcooled #VNCPVC)#,WPG ƅQYDQKNKPI+PVGTPCVKQPCN,QWTPCNQH*GCVCPF/CUU ■ /CMQYMC- 5CVVGNOC[GT6 7PUVGCF[4#05 6TCPUHGTKP2TQITGUU8QNRR&GE +PXGUVKICVKQPQHC*[FTQIGP(WGNGF5VCIGF ■ Institute of Thermodynamics 179 Sport Equipment and Materials Group R&D in sports technology combining engineering, sports science and computational methods ■ The focus of the sports engineering group in 2013-14 was to improve experimental expertise in knee biomechanics, to optimize our computer model of the human arm to simulate the preventive effect of wrist guards and to gain better insight on sports garment related thermo-physiology. Three highlights are worth mentioning: ■ TV report illustrating our research ■ launch of two start-ups within the RTQLGEVnOGEJCVTQPKEUMKDKPFKPIUoKP frame of Federal Ministry for Economic Switzerland’s major science broadcast Affairs’ exist program. ‘Einstein’. ■ Optimization of Germany’s top athlete #PLC*WDGToUUMGNGVQPHQTVJG1N[ORKE Prof. Dr.-Ing. Veit Senner Wintergames in Sotschi Contact www.spgm.tum.de [email protected] Towards Better Performance with Optimized Phone +49.89.289.15366 Sport Equipment Anja Huber in the virtual wind tunnel. Source: TUM/ FluiDyna, Graphics: M. + C. Penev Improving the performance in both top level and leisure time sports is a major motivation for research and development of sports equipment. The focus is on energy transfer between athlete and equipment and can be optimized by ■ KORTQXGFƄVVKPIVQVJGKPFKXKFWCN (i.e. golf shaft) ■ better equipment weight to stiffness ratio (i.e. bicycle frame) ■ energy return at optimal position of athlete’s motion Patented surfboard of TUM start-up ‘tripstix’. Graphics ■ optimized heat- and moisture manage- by TUM students S. Godoj and S. Hofelich OGPV KGPGYKPƄNNUHQTFQYPLCEMGVU Industry and Public Funded Projects ■ 6TCEMCPFƄGNFURTKPVURKMGYKVJ ■ Optimization ergonomics of Olympic synthetic leaf springs Skin- and core temperature UMGNGVQP ■ Impact sensation related to golf shaft’s measurements during garment ■ &GXGNQROGPVKPƅCVCDNGJKIJ YGKIJVCPFƅGZKDKNKV[ test in climate chamber performance surfboard 180 Sport Equipment and Materials Group Towards more Safety with Improved Protection Gear Validation of arm-wrist-model to simulate snowboard backward falls The avoidance of traumatic and also EMG measurements and handling observation while long-term sports injuries due to better climbing with a ‘kids-friendly’ carabiner protective equipment is one of the major challenges of our research. ■ Simulation of a worst case scenario of snowboard falls for evaluating the Projects prevention effect of snowboard wrist ■ Development of a mechanical lower leg guards YKVJKPUVTWOGPVGFMPGGCPFHWNNOWUENG ■ Ergonomics of a climbing carabiner for control children ■ Design of an emergency release system ■ Determination of hip joint loads for for winter sport equipment FKHHGTGPVUMKKPIOCPQGWXGTU Research Focus Infrastructure ■ Improved performance of sport ■ /QDKNGUMKPCPFEQTGVGORGTCVWTG equipment measurement ■ Safety & protection gear to avoid ■ Multi-body simulation software overloads SIMPACK® ■ Thermo-physiology in sport garment ■ Mobile EMG and spirometry design ■ Video-based motion analysis SIMI® ■ Footwear – sport surface interaction ■ Knee surrogate with loading device ■ Electric & muscle-powered lightweight ■ Instrumented bicycle vehicles ■ 5-axis fatigue testing device for bicycle frames Competence ■ /WUEWNCTUMGNGVCNOQFGNUUKOWNCVKQP Courses ■ 3D-motion analysis (optical, inertia, ■ $CUKE5MKNNUQH5EKGPEG DGPS) ■ Applied Biomechanics ■ Electromyography (EMG) & spirometry ■ Sports Technology Measurement of metabolic energy ■ Measurement of external loads & ■ Practical Ergonomics in skiing plantar pressure ■ Digital Human Modeling ■ Development of physical models (foot ■ Advanced Biomechanics CPMNGMPGGNQYGTNGI ■ Sports Engineering ■ Interdisciplinary Research Project Sport Equipment and Materials Group 181 Management: Research Scientists: Prof. Dr.-Ing. Veit Senner, Director Dr. rer. nat. Stefan Lehner (until 10/2014) Dipl.-Sportwiss. Marius Janta, M.Sc. Administrative Staff: Dipl.-Ing. Daniel Meyer Simona Chiritescu-Kretsch Dipl. Phys. Jürgen Mitternacht Michaela Nusser, M.Sc. ETH (until 08/2014) Publications 2013-14 ■ Bulut, J., Janta, M., Senner, V., & Kreuzer, J. (2013). ■ Lehner, S., & Senner, V. (2013). Evaluation of Determination of Insulation Properties of Functional Ergonomics of a New Effort Saving Via-ferrata Clothing Using Core Body Temperature Gradients Carabiner-child vs. Adult Use. Proceedia Enginee- CU3WCPVKƄECVKQP2CTCOGVGT2TQEGGFKC'PIKPGGTKPI ring, 60(0), 319-324, from http://www.sciencedirect. 60(0), 208-213, from http://www.sciencedirect.com/ com/science/article/pii/S1877705813010771. science/article/pii/S1877705813011089. ■ Meyer, D., Steffan, M., & Senner, V. (2014). Impact of ■ Burger, M., & Senner, V. (2014). Correlation between Electrical Assistance on Physiological Parameters Quality of Golf Drive and Impact Sensation in During Cycling. Procedia Engineering, 72, 150-155. Dependence of Shaft Weight and Shaft Flexibility. ■ Mitternacht, J., Klement, A., & Lampe, R. (2013). Procedia Engineering, 72, 292-297. Plantar pressure distribution during and after preg- ■ (GNFUVGKP+ 1RVKOCNFWTEJFGP'KUMCPCN nancy. European Orthopaedics and Traumatology, 4GPPUEJNKVVGP -QPMWTTGP\HÀJKIDNGKDGPFWTEJ ■ 4CJWNCP/6TQ[PKMQX19CVUQP%,CPVC technischen Vorsprung. chemie&more, 5. Jahrgang M., & Senner, V. (2013). Consumer Purchase (6. Ausgabe), 32-33. Behaviour of Sports Compression Garments – A ■ Janta, M., Bengler, K., & Senner, V. (2014). Komfort study of Generation Y and Baby Boomer Cohorts. FWTEJNQMCNG-NKOCVKUKGTWPIKP'NGMVTQCWVQU+P Procedia Engineering, 60(0), 163-169, from http:// Gesellschaft für Arbeitswissenschaft e. V. (Ed.), www.sciencedirect.com/science/article/pii/ )GUVCNVWPIFGT#TDGKVUYGNVFGT 182 Sport Equipment and Materials Group Institute for Energy Systems Power Generation and solid fuel conversion ■ The focus of the Institute for Energy Systems in 2013-14 was to investigate future power generation systems and solid fuel conversion processes. Our research can be divided into four Key competences regarding modeling and areas: Power Plant Technology, Rene- simulation are CFD simulations of com- wable Energy, Modeling and Simulation, DWUVKQPCPFICUKƄECVKQPRTQEGUUGUGPVKTG as well as Measurement Technology. We process simulations, burner design, form cooperate with research institutions and optimization of blade and seal geometry, industrial companies on a number of nati- as well as the simulation of deposition and onal and international research projects. slagging tendencies. 6JGGZRGTVKUGQHVJGKPUVKVWVGKUCNUQ Furthermore, a Siemens GuD-Simulator Prof. Dr.-Ing. TGƅGEVGFKPVJGNCTIGPWODGTQHQRGTCVGF 522#6 ECPDGHQWPFCVVJG+PUVKVWVG Hartmut Spliethoff testing facilities, and in the utilized meas- for Energy Systems, which makes it urement technologies. The mechanical possible to simulate various power plant Contact workshop, the electronics laboratory, and processes, and to test the control system www.es.mw.tum.de the chemical laboratory are also essential of power plants. [email protected] RCTVUQHVJGGZRGTKOGPVCNQRGTCVKQPCVVJG Phone +49.89.289.16270 institute. Power Plant Technology With a stronger presence of renewable FGXGNQROGPVQHHWVWTGJKIJN[GHƄEKGPV energy sources in the power grid, com- JKIJVGORGTCVWTGICUKƄECVKQPRTQEGUUGU DKPGFE[ENGCPFEQCNƄTGFVJGTOCNRQYGT YKVJKPVGITCVGFJQVICURWTKƄECVKQPCPF plants are subject to more frequent and optional CO2 capture and storage for larger load changes. The evaporator as a IGCC power plants and processes for the component in thermal power plants and development of synthetic fuel. Further its dynamic behavior is of great interest projects investigate the development of HQTƅGZKDNGRQYGTRNCPVU6QKPXGUVKICVG a corrosion reduction concept and the the evaporation process under dynamic potential of the SNCR process, in order to conditions, an evaporator test rig is being reduce the emissions of waste combus- installed at the Institute for Energy Sys- tion facilities. The SNCR research focuses VGOU(WTVJGTVGUVTKIUKPENWFGCPQZ[HWGN on ammonia injection in substoichiometric EQODWUVKQPEJCODGTCPFGPVTCKPGFƅQY zones. TGCEVQTU6JGQZ[HWGNEQODWUVKQPQHEQCN is one of the three main research routes Projects for the development of coal-powered ■ Energy valley Bavaria – high pressure power plants with CO2 restraint systems. evaporation facility The aim is to develop and demonstrate ■ *QV8G)CUsJKIJVGORGTCVWTGICUKƄEC- combustion and boiling systems on a VKQPCPFICURWTKƄECVKQPRTQEGUUGUHQT commercial scale. Coal power plants on IGCC power plants the basis of IGCC technology (Integrated ■ KorrMind – development of a corrosion )CUKƄECVKQP%QODKPGF%[ENG OCKPN[ reduction concept WUGGPVTCKPGFƅQYICUKƄGTUCPFQHHGT ■ 4'.%1/sTGNKCDNGQZ[EQCNEQODWUVKQP VJGCFXCPVCIGQHJKIJGHƄEKGPE[CPFVJG ■ 4QDWUVCPFGHƄEKGPV01ZTGFWEVKQP opportunity for effective CO2 capture with ammonia injection in a reducing and storage. The primary objective of ƅWGICUCVOQURJGTG the work at the institute is to lay the 2TGUUWTK\GFGPVTCKPGFƅQYTGCEVQT necessary foundations for the long-term Institute for Energy Systems 183 Renewable Energy The use of biomass for electricity and heat production has moved increasingly into focus. In the biomass work group the goal is to investigate and to solve problems and limitations that arise in the thermal use of biomass. Key aspects are the reduction of emissions and unburned materials, trace elements like sulfur and chlorine compounds, as well as alkalis and particles. Together with Suncoal Industries GmbH, focusing on the process SNG-production from biomass QHJ[FTQVJGTOCNECTDQPK\CVKQP *6% VJG EQPXGTUKQPQHDKQEJCTKPCPGPVTCKPGFƅQY lies on decentralized facilities for the use ICUKƄGTKUKPXGUVKICVGF#RTQEGFWTGHQT of locally produced biomass. the treatment and methanation of the RTQFWEVICUHTQOCDKQOCUUICUKƄGTKU Projects developed as well. The processed gas ■ (.7*-'sGPVTCKPGFƅQYICUKƄECVKQP has to meet the criteria for integration into with biochar the natural gas grid. Furthermore, within ■ FNR – thermal use of biomass in high the framework of the SOFCOM project, temperature processes VJGCDKNKV[VQWUGUQNKFQZKFGHWGNEGNNU ■ 51(%1/sUQNKFQZKFGHWGNEGNNU 51(%U CUCPGHƄEKGPVOGCPUQHDKQOCUU ■ SNG – decentralized production of generation in combined cooling, heat, and synthetic natural gas from biomass power facilities is investigated. The focus Modeling and Simulation Modeling and simulation of solid fuel con- are investigated: Combined cycle power version play an important role in several RNCPVUCPFEQCNƄTGFRQYGTRNCPVU#NUQ projects mentioned above: e.g. HotVeGas, the economic use of waste heat is a focus 4'.%1/CPF01ZTGFWEVKQP%QORWVC- of research. The use of waste heat at low VKQPCNƅWKFF[PCOKEUKOWNCVKQPU %(& CTG temperatures with organic Rankine cycles applied in order to gain a more detailed 14% KUGZCOKPGFCVVJGKPUVKVWVGD[ understanding of several combustion and means of process simulations. ICUKƄECVKQPRTQEGUUGU(WTVJGTOQTGGPVKTG process simulations aim at evaluating Projects the complete power plant system and ■ Energy valley Bavaria - dynamic simula- possible synergies. tion of power plants Simulation of pulverized coal #UVJGƅGZKDKNKV[QHRQYGTRNCPVUIGVUKPVQ ■ '5215#GHƄEKGPVU[UVGOUCPF combustion the focus of the operators – in addition to propulsion for small aircraft GHƄEKGPE[CPFGEQPQO[sVJGKPVGTCEVKQP ■ Misselhorn cycle - waste heat utilization of power plant processes during dynamic at low temperatures QRGTCVKQPKUKPXGUVKICVGFKPVJGEQPVGZVQH ■ TcET - thermochemical energy storage the dynamic simulation of power plants. unit for thermal power plants and An improved process understanding helps industrial heat to develop better operating strategies ■ CleanTechCampus Garching CPFQRVKOK\GFRQYGTRNCPVEQPƄIWTC- tions. Two different power plant types 184 Institute for Energy Systems Research Focus Management ■ Power plant technology Prof. Dr.-Ing. Hartmut Spliethoff, Director ■ Renewable energies Dr.-Ing. Matthias Gaderer ■ Modelling and simulation Dr.-Ing. Stephan Gleis ■ Measurement technology Dipl.-Ing. Christoph Wieland Competence Administrative Staff ■ %QODWUVKQPCPFICUKƄECVKQPQHUQNKF Brigitte Demmel fuels Xiaolu Pei ■ Steam cycles and waste heat utilization Martina Rath ■ Operation of pilot- and lab-scale test Heike Winter facilities ■ Process simulations and CFD simula- Research Scientists tions Michael Angerer, M.Sc. ■ Laser measurement technologies Dipl.-Ing. Andreas Baumgartner ■ Fuel and gas analysis Dipl.-Ing. Moritz Becker &KRN+PI/CZKOKNKCP$NWOG Infrastructure Dipl.-Ing. Federico Botteghi ■ Fuel laboratory and thermobalances Dominic Breitkopf, M.Sc. ■ Mechanical workshop and electronics Dipl.-Ing. Ludwig Briesemeister laboratory &KRN+PI#NGZCPFGT$WVVNGT ■ 'ZRGTKOGPVCNHCEKNKVKGUCPFVGUVTKIU KP Dr.-Ing. Dumitru Cebrucean RCTVKEWNCTEQODWUVKQPCPFICUKƄECVKQP Dipl.-Ing. Pedro Dias TGCEVQTU Dipl.-Ing. Sebastian Fendt (KUEJGT(GNKZ/5E Courses Dipl.-Ing. Markus Fischnaller ■ Basic Course in Reaction Thermo- Andreas Geißler, M.Sc. dynamics Moritz Gleinser, M.Sc. ■ Chemical Reactors Dipl.-Ing. Adrian Goanta ■ Electricity Networks and Energy Stefan Härzschel, M.Sc. Markets Dipl.-Ing. Stefan Halama ■ Energy and Economy Julia Hentschel, M.Sc. ■ Energy from Biomass and Residuals Stephan Herrmann, M.Sc. ■ Energy Systems I/II Barbara Hetterich, M.Sc. ■ Numerical Methods for Energy Systems Dipl.-Ing. Sebastian Jell ■ Process Technology and Ecology in Dipl.-Ing. Steffen Kahlert Modern Power Plants &KRN+PI (* 7NTKEJ-NGKPJCPU ■ Renewable Energy Technology I/II Dipl.-Ing. Andreas Kohlhepp ■ Solarthermal Power Plants Michael Kremling, M.Sc. ■ Steam Turbines Philipp Kurowski, M.Sc. ■ Thermal Power Plants (M.Sc. Power Xinmeng Li, M.Sc. 'PIKPGGTKPI Wei Liu, M.Sc. ■ Thermodynamics in Energy Conversion Dipl.-Ing. Raphael Marro /5E2QYGT'PIKPGGTKPI Dominik Meinel, M.Sc. Dipl.-Ing. Philipp Meysel Dipl.-Ing. Mario Nakonz &T#NGZCPFGT2WICEJGX Dipl.-Ing. Roman Rück Dipl.-Ing. Gerrit Schatte Institute for Energy Systems 185 Dipl.-Ing. Kristina Speth Andrea Hartung Markus Steibel, M.Sc. Jürgen Knösch Andreas Stephan, M.Sc. Lino Krause Dipl.-Ing. Markus Stetka Vera Krekel Markus Ulbrich, M.Sc. Friedrich Leiher Dr. Annelies Vandersickel Manuela Meyer Christian Wolf, M.Sc. Robert Riss Dipl.-Ing. Simon Schatzmann Technical Staff Benedikt Schels Christoph Berkel Margarethe Schwindl Albert Daschner Quynh-Huong Vu Linda Hartmann Publications 2013-14 ■ 2014 (selected publications) Speth, K.; Murer, M.; Spliethoff, H.: Selective High 6GORGTCVWTG4GFWEVKQPQH01ZYKVJ#OOQPKCKP Biomass Incineration. 22th European Biomass ■ $WVVNGT# -QNVWP4 5RNKGVJQHH* 'HƄEKGPE[CPF %QPHGTGPEGCPF'ZJKDKVKQP ƅGZKDKNKV[RQVGPVKCND[KPVGITCVKPIYCVGTGNGEVTQN[UKU ■ 5VGKDGN/ $QVVGIJK( 5RNKGVJQHH* 'ZRGTKOGPVCN KP+)%%RQYGTRNCPVUHQTGZEGUURQYGTUVQTCIGVJ +PXGUVKICVKQPQH5QNKF(WGN)CUKƄECVKQPKP'PVTCKPGF International Freiberg Conference on IGCC & XtL Flow Reactors. 6th International Freiberg Confer- Technologies, 2014 ence on IGCC & Xtl Technologies, 2014 ■ Halama, S.; Spliethoff, H.: Computational Modeling ■ Ulbrich, M.; Schwarz, R.; Spliethoff, H.; Gaderer %(& QH'PVTCKPGF(NQY)CUKƄECVKQP-KPGVKEUYKVJ / 'ZRGTKOGPVCN5VWF[QPVJG+ORCEVQH2TQEGUU focus on the Structural Evolution of Char Particles. Parameters on Energy and Ash Yield of Bio Coal 6th International Freiberg Conference on IGCC & 2TQFWEGF9KVJ*[FTQVJGTOCN%CTDQPK\CVKQP *6% XtL Technologies, 2014 VJ'WTQRGCP$KQOCUU%QPHGTGPEGCPF'ZJKDKVKQP ■ Herrmann, S.; Gaderer, M.; Spliethoff, H.: 2014 6JGTOQ'EQPQOKECPF'ZRGTKOGPVCN+PXGUVKICVKQP of Small- to Medium-Scale Integrated Biomass )CUKƄECVKQP5QNKF1ZKFG(WGN%GNN5[UVGOUVJ 2013 (selected publications) 'WTQRGCP$KQOCUU%QPHGTGPEGCPF'ZJKDKVKQP ■ Kremling, M.; Briesemeister; L., Spliethoff, H.; Gaderer, M.: High Temperature Biomass Gasi- ■ $CNCP) .QUWTFQ/ 5RNKGVJQHH* 'ZRGTKOGPVCN ƄECVKQPKPCP'PVTCKPGF(NQY4GCEVQTs&GUKIP Study of High-Temperature Chlorine-Induced and Engineering of a Test Facility. 22th European Corrosion in Dependence of Gas Velocity. Energy & $KQOCUU%QPHGTGPEGCPF'ZJKDKVKQP (WGNU ■ Liu, W.; Meinel, D.; Wieland, C.; Spliethoff, H.: ■ Becher, V.: Validation of spectral gas radiation +PXGUVKICVKQPQHJ[FTQƅWQTQQNGƄPUCURQVGPVKCN OQFGNUWPFGTQZ[HWGNEQPFKVKQPU&KUUGTVCVKQP YQTMKPIƅWKFUKPQTICPKE4CPMKPGE[ENGHQTIGQVJGT- ■ Blume, M.; Baumgartner, A.; Goanta, A.; Dias, mal power generation. Energy 67, 2014, 106-116 2 5RNKGVJQHH* 'ZRGTKOGPVCN+PXGUVKICVKQPQH ■ Mayerhofer, M.; Fendt, S.; Spliethoff, H.; Gaderer, Interaction between Coal Flames – Effects on Total / (NWKFK\GFDGFICUKƄECVKQPQHDKQOCUUs+PDGF CPF4CFKCVKQP*GCV(NWZGU2TQEGGFKPIUQHVJGVJ investigation of gas and tar formation. FUEL 117, Clearwater Clean Coal Conference 750-761, 2013 2014, 1248-1255 ■ Bohn, J. P.; Blume, M.; Baumgartner, A.; Goanta, ■ Mayerhofer, M.: Teerentstehung und Teerminderung # 5RNKGVJQHH* 1Z[HWGNEQODWUVKQPQHNKIPKVGKPC bei allothermer Wirbelschichtvergasung. Disserta- non-stoichiometric operating two burner arrange- tion, 2014 ment. FUEL 104, 2013, 398-408 ■ Meinel, D.; Wieland, C.; Spliethoff, H.: Effect and ■ Buttler, A., Kunze, C., Spliethoff, H.: Analyse von EQORCTKUQPQHFKHHGTGPVYQTMKPIƅWKFUQPCVYQ ƅGZKDNGP+)%%-QP\GRVGPFGTPÀEJUVGP)GPGTCVKQP UVCIGQTICPKETCPMKPGE[ENG 14% EQPEGRV#RRNKGF +P $GEMOCPP/ *WTVCFQ# *TUI -TCHV- Thermal Engineering 63, 2014, 246-253 werkstechnik – Sichere und nachhaltige Energiever- ■ /WTGT/, 0WOGTKECNOGVJQFUHQTGHƄEKGPVRQYGT sorgung. TK Verlag, 2013, 259-270 generation from municipal solid waste. Dissertation, ■ Buttler, A.; Kunze, C.; Spliethoff, H.: IGCC–EPI: 2014 &GEGPVTCNK\GFEQPEGRVQHCJKIJN[NQCFƅGZKDNG ■ 2WICEJGX#1 #IITGICVKQPQH'ZRGTKOGPVCNCPF +)%%RQYGTRNCPVHQTGZEGUURQYGTKPVGITCVKQP Theoretical Data for Brush Seal Leakage Evaluation. Applied Energy 104, 2013, 869-879 50th AIAA/ASME/SAE/ASEE Joint Propulsion ■ Erbel, C.: Beiträge zur Entwicklung der ELIF-Mess- Conference, 2014 technik. Dissertation, 2013 ■ Schuhbauer, C.; Angerer, M.; Spliethoff, H.; Kluger, F.; Tschaffon, H.: Coupled simulation of a tangen- VKCNN[JCTFEQCNƄTGF%DQKNGT(7'. 149-163 186 Institute for Energy Systems ■ Erbel, C.; Mayerhofer, M.; Monkhouse, P.; Gaderer, ■ Murer, M. J.; Alonso-Herranz, E.; de Waal, C. M. M.; Spliethoff, H.: Continuous in situ measurements W.; Spliethoff, H.; van Berlo, M. A. J.; Gohlke, O.: QHCNMCNKURGEKGUKPVJGICUKƄECVKQPQHDKQOCUU 'PGTI[GHƄEKGPE[OQPKVQTKPIs9JKEJUGPUQTUCTG 2TQEGGFKPIUQHVJG%QODWUVKQP+PUVKVWVG really needed? Waste Management & Research 31 2013, 2331-2338 ■ Fendt, S.; Maschke, M.; Gaderer, M.; Spliethoff, H.: ■ Pugachev, A. O.: Application of gradient-based Concept Study of Small-Scale Biomass-to-SNG optimization methods for a rotor system with static 5[UVGOUYKVJ'ZEGUU2QYGT+PVGITCVKQPUV stress, natural frequency, and harmonic response 'WTQRGCP$KQOCUU%QPHGTGPEGCPF'ZJKDKVKQP constraints. Structural and Multidisciplinary ■ Fischnaller, M.; Volz, F.; Kunde, R.; Spliethoff, H.; 1RVKOK\CVKQP )CFGTGT/ 5OCNN5ECNG)CUKƄGTUs/CTMGVCPF ■ Pugachev, A.O.: Predicted performance of brush Technology Evaluation for Promising Developments. seals: porous medium versus resolved bristle Proceedings of the International Conference on OCVTKZCPFEQORCTKUQPYKVJGZRGTKOGPVCNFCVC Polygeneration Strategies 13, 2013 Proceedings of the 10th European Conference on ■ Gaderer M.; Spliethoff, H.: Future requirements for Turbomachinery, 2013, 160-170 fossil power plants, in Lecture Notes Joint EPS-SIF ■ Schuhbauer, C. J.: Dynamic and Coupled Italian Physical Society – International School on 5KOWNCVKQPQHVJG%%QCN(KTGF2QYGT2NCPV Energy. New Strategies for Energy Generation, Dissertation, 2013 Conversion and Storage 54, 2013, 29-40 ■ Schuhbauer, C.; Angerer, M.; Spliethoff, H.; Kluger, ■ Gaszner, M., Pugachev, A.O., Georgakis, C., & F.; Tschaffon, H,: Detailliert gekoppelte Simulation %QQRGT2 .GCMCIGCPFTQVQTF[PCOKEEQGHƄEKGPVU von Kraftwerksfeuerung und Dampferzeugung. of brush seals with zero cold clearance used in an Deutscher Flammentag, 2013 CTTCPIGOGPVYKVJNCD[TKPVJƄPU#5/','PI)CU ■ Steibel, M.; Botteghi, F.; Stetka, M.; Nakonz, M.; 6WTDKPGU2QYGT 5RNKGVJQHH* 'ZRGTKOGPVGNNG7PVGTUWEJWPIFGT ■ Gewald, D.: Waste heat recovery of stationary *QEJFTWEM2[TQN[UGXQP-QJNGWPFFGTGP'KPƅWUU internal combustion engines for power generation. auf die intrinsische Kinetik der CO2-, H2O- und der Dissertation, 2013 kombinierten H2O-/CO2-Vergasung. Kraftwerkstech- ■ Halama, S.; Kleinhans, U.; Spliethoff, H.: CFD simu- nisches Kolloquium, 2013, 941-952 NCVKQPQHRWNXGTK\GFHWGNEQODWUVKQPICUKƄECVKQP ■ Tremel, A.; Gaderer, M.; Spliethoff, H.: Small-scale CPFCUJFGRQUKVKQPKPGPVTCKPGFƅQYTGCEVQTUUV production of synthetic natural gas by allothermal 'WTQRGCP$KQOCUU%QPHGTGPEGCPF'ZJKDKVKQP+'# DKQOCUUICUKƄECVKQP+PVGTPCVKQPCN,QWTPCNQH Bioenergy Task 32 workshop, 2013 'PGTI[4GUGCTEJ s ■ Kleinhans, U.; Wieland, C.; Spliethoff, H.: ■ 6TGOGN# 5RNKGVJQHH* )CUKƄECVKQPMKPGVKEU Modellierung des zeitlichen Depositionsaufbaus FWTKPIGPVTCKPGFƅQYICUKƄECVKQP2CTV+++CPF+++ bei der Staubfeuerung in einem Flugstromreaktor: (7'. 5+ (7'. 'KP8GTINGKEJ\YKUEJGP5KOWNCVKQPWPF'ZRGTKOGPV 653-661; FUEL 107, 2013, 170-182 Deutscher Flammentag, 2013 ■ Tremel, A.; Becherer, D.; Fendt, S.; Gaderer, M.; ■ Kleinhans, U.; Wieland, C.; Spliethoff, H.: Modeling 5RNKGVJQHH* 2GTHQTOCPEGQHGPVTCKPGFƅQYCPF ash deposition and formation during pulverized fuel ƅWKFKUGFDGFDKQOCUUICUKƄGTUQPFKHHGTGPVUECNGU EQODWUVKQPWUKPIEQORWVCVKQPCNƅWKFF[PCOKEU Energy Conversion and Management 69, 2013, Proceedings of the 38th Clearwater Clean Coal 95-106 Conference, 2013 ■ 9KGNCPF% /GKPGN& 5RNKGVJQHH* 'ZGTIQGEQ- ■ Mitsakis, P.; Mayerhofer, M.; Meng, X.; Spliethoff, nomic Comparison of ORC Concepts at different H.; Gaderer, M.: Optical measurement of tars in Scales. ASME ORC-Conference, 2013 CƅWKFK\GFDGFICUKƄGT KPƅWGPEGQHHWGNV[RGCPF ICUKƄECVKQPRCTCOGVGTUQPVJGKTHQTOCVKQP$KQOCUU %QPXGTUKQPCPF$KQTGƄPGT[ Institute for Energy Systems 187 Institute of Machine Elements Calculation, simulation and experimental analysis of gears, synchronizers, clutches and rolling element bearings ■ The focus of the Institute of Machine Elements (FZG) is to develop OGVJQFUCPFVQQNUHQTTGNKCDNGFGVGTOKPCVKQPQHHCVKIWGNKHGGHƄEKGPE[ friction and vibration characteristics of gears and transmission elements. The FZG has state-of-the-art facilities for VGUVTKIU$CUGFQPGZRGTKOGPVCNCPF the examination and testing of differ ent theoretical studies methods are derived. types of machine elements – such as gears, Furthermore, the institute contributes synchronizers, clutches and rolling element extensively to national and international bearings. To carry out the various different standardization activities and the commu- research activities, FZG has more than PKV[YQTMQH8&+&+0CPF+51 Prof. Dr.-Ing. Karsten Stahl Contact Components: Cylindrical Gears www.fzg.mw.tum.de [email protected] Cylindrical gears are the most widespread ■ #K((8#RTQLGEVn1RVKOKGTWPI(NCPMGP- 2JQPG transmission types. The fatigue life of VTCIHÀJKIMGKVo cylindrical gears is limited by pitting, micro- ■ AiF/FVA project ‘Wassergehalt in Ölen’ RKVVKPIUEWHƄPIYGCTVQQVJTQQVDTGCMCIG ■ (8#RTQLGEVn8CNKFKGTWPI4+-14++o QTVQQVJƅCPMDTGCMCIG6JGDCUKUHQTVJG ■ (8#RTQLGEVn(NCPMGPDTWEJ5VKTPTÀFGTo experimental examination of such gear ■ FVA project ‘Erweiterung Dyn. Zahn- FCOCIGKUVJGUVCPFCTF(<)DCEMVQDCEM MTÀHVG2TQITCOO&<2o gear test rig, which was developed by FZG ■ AiF/FVA project ‘Nitrierte Innen-/Außen- and is used all over the world. verzahnung’ The described types of damages, as well ■ AiF/FVA project ‘Randschichtgefüge’ CUOCVGTKCNNWDTKECPVCPFGHƄEKGPE[GZCOK- ■ &)/-RTQLGEVn(GVVUEJOKGTWPI-NGKP- nations for external and internal gearings, getriebe’ ECPVJGTGD[DGECTTKGFQWVXGT[GHƄEKGPVN[ ■ (TCWPJQHGT)GUGNNUEJCHV2TQLGEVn)GPG- +PCFFKVKQPVQUWHƄEKGPVNQCFECTT[KPI TCVKXG 188 Institute of Machine Elements Components: Bevel and Hypoid Gears $GXGNIGCTUCTGWUGFHQTRQYGTCPFVQTSWG principle of the mechanical power circuit. transmission between non-parallel axes. The test rig is used for the examination of 6JGOCKPCRRNKECVKQPƄGNFQHDGXGNIGCTU VQQVJTQQVCPFVQQVJƅCPMNQCFECTT[KPI is the automotive industry. However, bevel capacity, as well as for hypoid gear oil gears are also used in large numbers in tests. train and ship propulsion, as well as in industrial gearboxes. Projects: The FZG hypoid gear test rig was ■ #K((8#RTQLGEVn-GIGNTCF%CTDQPKVTKG- developed for life tests on bevel and ren’ J[RQKFIGCTU.KMGVJG(<)DCEMVQDCEM ■ (8#RTQLGEVn0CEJTGEJPWPI(NCPMGP- gear test rig, this rig operates on the DTWEJ-GIGNTÀFGTo $GXGNCPFJ[RQKFIGCTVGUVTKI Components: Worm Gears Worm gears offer the possibility of The high percentage of sliding for worm realising high transmission ratios in only gears causes higher power losses with one stage. Thus a considerably high KPETGCUKPIVTCPUOKUUKQPTCVKQ9KVJVQTSWG axial sliding occurs, leading to reduced OGCUWTGOGPVUJCHVUGHƄEKGPE[VGUVUHQT GHƄEKGPEKGU&WGVQVJGNCTIGQXGTNCR every operating condition can be perform- worm gears have low noise and vibration ed with these test rigs. NGXGNU5GNHNQEMKPICPFUGNHDTCMKPICTG The tooth root load-carrying capacity of possible by appropriate choice of the gear worm gears can be determined within geometry. The application of worm gears pulsator tests. Therefore, a special device as power gearboxes is mainly limited by has been developed, which allows a load YGCTRKVVKPIQTNKOKVGFGHƄEKGPE[1VJGT to be imposed on the worm wheel teeth material combinations than the conven- through the corresponding worm shaft. tional combination of steel and bronze are OQTGGPFCPIGTGFD[UEWHƄPI Projects: $QVJGNGEVTKECNN[CPFJ[FTQUVCVKECNN[NQCFGF ■ #K((8#RTQLGEVn5EJPGEMGPIGVTKGDG test rigs are available for the determination $CWITÒ»GPGKPƅWUU++o QHUNKFKPIYGCTRKVVKPICPFUEWHƄPIQHEQO- ■ #K((8#RTQLGEVn5EJPGEMGP Worm gear test rig mon worm gear bronzes, as well as brass, Schraubrad getriebe II’ grey cast iron and spheroidal cast iron. ■ FVA project ‘Integration der Schraub- 6JGTGUWNVUCTGTGRTGUGPVGFCUURGEKƄE TCFIGVTKGDG(8#9QTMDGPEJo YGCTQTUEWHƄPIFCOCIGKPEQTTGNCVKQPVQ ■ FVA project ‘SNESYS IV’ VJGFTKXGVQTSWGQTCURKVVKPIITQYVJQXGT ■ FVA project ‘Fettschmierung the number of load cycles. 5EJPGEMGPIGVTKGDG++o Institute of Machine Elements 189 Components: Synchronizers In vehicle manual and DCT transmissions, Examinations of friction, wear and service the gears are changed by the actuation life behaviour of synchronizers are carried of tooth clutches. Synchronizers are out with the FZG standard synchronizer WUGFVQTGCNKUGGSWCNTQVCVKQPCNURGGFKP VGUVTKI<((<)552 the dog clutch, which is necessary for EQPXGPKGPVIGCTUJKHVKPI6JGTGSWKTGOGPVU Project: HQTU[PEJTQPK\GTUCTGCRRNKECVKQPURGEKƄE FVA project ‘Synchro-Schleppmomente’ CPFEQXGTCNCTIGURGEVTWO$GUKFGUC JKIJVQTSWGVTCPUHGTECRCDKNKV[CPFTGNCVGF high energy and power density for the friction material and the lubricant, low wear and high long-term stability of the friction behaviour, as well as convenient gear shifting are important development objectives. 5VCPFCTFU[PEJTQPK\GTVGUVTKI ZF/FZG SSP-180 Components: Multidisc Clutches Oil-lubricated multidisc clutches and multidisc clutch test rigs. Accordingly, DTCMGUCTGWUGFHQTGZCORNGKPCWVQOCVKE CPGXCNWCVKQPQHVJGKPƅWGPEGUQHHTKEVKQP transmissions for gear shifting and for material, groove pattern, volume of oil frictionally engaged power transmission. ƅQYNWDTKECPVCPFNQCFQPHTKEVKQPYGCT Multidisc clutches are characterised by a and drag loss behaviour is possible. high power density in a compact design. They can be actuated under load and Projects: difference in rotational speed because the ■ FVA project ‘Lebensdauer Lamellen- VQTSWGKUVTCPUOKVVGFD[HTKEVKQP(WPEVKQPCN MWRRNWPIGP++o and service-life behaviour depend to a large ■ (8#RTQLGEVn(GUVKIMGKVXQP4GKDDGNÀIGPo extent on the load and the friction system. ■ FVA project ‘Schleppverluste Lamellen- The mechanical and thermal load of MWRRNWPIGP++o the clutch which occurs during the shift ■ (8#RTQLGEVn%CTDQP²NXGTVTÀINKEJMGKVo operations are not constant in practical ■ (8#RTQLGEVn-725+/o application, but vary due to different ■ FVA project ‘Carbon-/Sinter-Reibungs- shifting conditions. verhalten’ Multidisc clutches test rig The friction, wear, drag loss and service- ■ AiF/FVA project ‘Langsamlaufschlupf KLP-260 life behaviour of oil-lubricated multidisc .COGNNGPMWRRNWPIGPo clutches are examined with the FZG 190 Institute of Machine Elements Topics: Load-Carrying Capacity A large part of the research topics deals The results of many research projects with the load-carrying capacity of the at FZG are gained from theoretical and components cylindrical, bevel, hypoid and experimental investigations. In order to worm gears, as well as multidisc clutches, develop a method, simulation models synchronizers and rolling element bear- are usually developed and validated by ings. For gears, fatigue lifetime is often extensive experimental studies. limited by pitting, micropitting, wear, UEWHƄPIVQQVJTQQVDTGCMCIGCPFVQQVJ ƅCPMHTCEVWTG Topics: EHL-/Tribological Contact For gear drives, the ratio of sliding to rolling along the path of contact is vari- CDNG$CUKEKPXGUVKICVKQPUQPTQNNKPICPF sliding contacts are performed on twin- FKUEOCEJKPGUYJKEJOCMGKVRQUUKDNG to adjust any slide-roll ratios at different rotational speeds. Local measurements of RTGUUWTGVGORGTCVWTGCPFƄNOVJKEMPGUU ECPDGRGTHQTOGFD[OGCPUQHVJKPƄNO '*.ƄNOVJKEMPGUUFKUVTKDWVKQP Schematic EHL-contact sensors. Theoretical consideration and calculations (EHL theory) supplement the distributions of pressure, temperature experiments. CPFNWDTKECPVƄNOVJKEMPGUUKPVJGEQPVCEV In classical hydrodynamics, the contact by applying the EHL theory. Complex surfaces are assumed to be rigid. The simulations can be used to calculate them lubricant wedge formation only depends PWOGTKECNN[%QPUGSWGPVN[OCKPUJGCTCPF on the lubricant and the speed ratios of octahedron stresses below the surface of DQVJEQPVCEVRCTVPGTU6JKUUKORNKƄECVKQP the two contact partners can be deter- is not possible for high pressures. The mined. ƅGZKDNGFGHQTOCVKQPQHVJGEQPVCEVCTGC as well as the viscosity change in the Projects: contact zone on the basis of differences in ■ &()RTQLGEVn4GKPJCTV-QUGNNGEM2TQ- temperature and the high local pressure, LGMVo n5KPVGTUEJGKDGPo can no longer be neglected. These effects ■ &()RTQLGEVKPn522o n'KPNCWHXGT- are recorded on computed halten’ Topics: Dynamics/NVH Internal additional dynamic forces, which during development of high-performance change tooth stress and affect noise transmissions. Experimental and theoreti- behaviour of the transmission, occur in cal investigations are used to determine running transmissions. The NVH behaviour these additional dynamic forces and to of gears is becoming more and more develop and improve analytical calculation important due to the increased customer models for the simulation of excitation and expectations regarding noise. The additi- vibration behaviour. onal dynamic forces must be considered Institute of Machine Elements 191 6QRKEU 'HƄEKGPE[ +PCFFKVKQPVQUWHƄEKGPVNQCFECTT[KPI In parallel, oil distribution and no-load capacity and good noise characteristics, losses are determined by means of CFD research is increasingly focusing on the simulations and validated with results of GHƄEKGPE[RGTHQTOCPEGQHIGCTU'HƄEKGPE[ experiments. investigations on oil- or grease-lubricated cylindrical gears are carried out with the (<)GHƄEKGPE[VGUVTKIUWPFGTFKHHGTGPV operating conditions. 'HƄEKGPE[VGUVTKI Topics: Rolling Element Bearings Rolling element bearings are used for the account, the resulting gearing losses can guidance of axles and shafts, whereby be determined. they absorb radial and/or axial forces and Wear and frictional behaviour of bearings simultaneously allow the rotation of the depend on the lubricant used. Evaluation shaft or of the mounted components. Thus of lubricant samples is possible on the VJGHTKEVKQPCPFRQYGTNQUUUJQWNFDGMGRV TQNNGTDGCTKPINWDTKECPVVGUVTKI(' to a minimum. With the bearing power CEEQTFKPIVQ&+0HQTVJGFGVGTOK- loss test rig of the FZG, the bearing losses nation of anti-wear capacity. Rolling element bearings power under load or no-load can be measured loss test rig for various bearing arrangements. These Projects: results then can be used for the validation ■ FVA project ‘Lebensdauer-Industrie- of the common calculation methods for getriebe Wälzlager IV’ the determination of the bearing losses. ■ (8#RTQLGEVn.QY(TKEVKQP.CIGT 6CMKPIDGCTKPINQUUGUKPVJGVGUVTKIKPVQ (Wälzlager Reibungsberechnung)’ Topics: Fatigue Life Analysis In the context of fatigue life analysis, the for operation in the test rig, are used to fatigue life of gears can be determined investigate this fatigue life. In pulsators or under time-varying operating conditions, DCEMVQDCEMIGCTVGUVTKIUYKVJJ[FTCWNKE e.g. for vehicles and industrial appli- load application the load can be varied cations. Load, temperature and speed during the operation according to these spectra, which are determined from load spectra. Thus fatigue life investiga- TGCNQRGTCVKPIEQPFKVKQPUCPFOQFKƄGF tions are possible. 192 Institute of Machine Elements Topics: Alternative Materials, Composites and Coatings 2NCUVKEIGCTUECPDGCFXCPVCIGQWUKP A composite structure, in which the teeth URGEKƄEVTCPUOKUUKQPCRRNKECVKQPU6JG are made of steel and the wheel body is high material damping has a positive made of plastic, combines the advantages effect on the noise behaviour, the low QHUVGGNCPFRNCUVKEIGCTKPIU$GUKFGU mass and mass inertia can be distinguis- increasing the lightweight design potential, hed in transmissions, which are subject to it is possible to manipulate the dynamic high accelerations. The main advantage system behaviour favourably by using of plastic gears is their dry run capability. composite gears. Moreover the tribologi- 6JKUOCMGUVJGOKFGCNHQTCRRNKECVKQPU ECNRTQRGTVKGUCPFVJGƅCPMNQCFECTT[KPI GIKPVJGƄGNFQHOGFKECNVGEJPQNQI[ capacity of steel gearings can be opti- food processing or the printing industry, mised by using extremely hard coatings where lubrication is not possible for func- e.g. amorphous carbon coatings. The tional or hygienic reasons. High friction KORCEVQHUWEJEQCVKPIUQPGHƄEKGPE[CPF losses in the dry run capability of plastic fatigue life is investigated at FZG. gears limit the transmittable power from a thermal viewpoint. Loss-optimised gears Projects: GZJKDKVUKIPKƄECPVN[NQYGTHTKEVKQPNQUUGU ■ &()RTQLGEVn-WPUVUVQHH\CJPTÀFGTo by concentrating the meshing around the ■ $C[T(5VRTQLGEVn-TQPGPTCFXGT\CJPWP- pitch point. gen’ Topics: Drive Systems/Electromechanical Drives The demand for sustainable mobility #URGEKCNJKIJNKIJVKPVJKUƄGNFKUVJG TGSWKTGUVJGFGXGNQROGPVQHKPPQXCVKXG ‘Active Differential’. The lightweight, drive systems with optimised energy EQORCEVCPFGHƄEKGPVU[UVGOYKVJVQTSWG management. One opportunity of realising vectoring function in the drive train of this is represented by hybrid drive sys- /76' 67/GNGEVTKEXGJKENG QHHGTUCJKIJ tems, which are a combination of several potential for increasing driving dynamics different power sources and aggregates. and recuperation performance. The research into hybrid drive systems 6JGCKOQHVJGRTQLGEV5RGGF'KUVJG at the FZG has been carried out since development, optimization and construc- 6JGOCKPVQRKEUCTGEQPEGRVKQPCPF tion of a high speed powertrain for simulation of hybrid drive systems. For the elec trical automotive applications, which development of alternative drive sys- allows a tripling of motor speed. During tems, special simulation tools have been VJGRTQLGEVCURGEVUNKMGGHƄEKGPE[VQQVJ engineered to evaluate the properties excitation and vibration transmissions are of drive concepts. The aim of complete considered. vehicle simulations is the determination of fuel economy and driving dynamics for Projects: different driving cycles and manoeuvres. A ■ $/$(RTQLGEVn8KUKQ/o XCTKGV[QHEQPƄIWTCVKQPUCPFRCTCOGVGTU ■ DFG project ‘Split-Verbrennungsmotor’ OWUVDGKFGPVKƄGFHQTEQPEGRVUVWFKGU ■ $/9K&.4RTQLGEVo5RGGF's*QEJ- GURGEKCNN[JKIJTGSWKTGOGPVUCTGPGEGU- drehzahl-Getriebe’ sary with respect to the computational ■ StMWMET project ‘FZG-Augsburg time of simulation models. Nevertheless a 4GUUQWTEGPGHƄ\KGPVG#PVTKGDUVGEJPKMo JKIJFGITGGQHƅGZKDKNKV[CPFGZRCPFCDKNKV[ ■ StMWIVT project ‘Elmech’ must be given in order to detail the vehicle models for further analysis. Institute of Machine Elements 193 Research Focus Management ■ Experimental examinations and simula- 2TQH&T+PI-CTUVGP5VCJN&KTGEVQT tions of gear systems and components ■ .QCFECTT[KPIECRCEKV[GHƄEKGPE[CPF Emeritus NVH of cylindrical, bevel, hypoid and 2TQHK4&T+PI$GTPF4QDGTV*ÒJP worm gears ■ Durability and friction behaviour of Adjunct Professors multidisc clutches and synchronizers 2TQH&T+PI/CPHTGF*KTV &T+PI$WTMJCTF2KPPGMCOR4GPM#) Competence Dr.-Ing. Joachim Thomas, Voith AG ■ Calculation, simulation and experimen- tal analysis of load-carrying capacity, Administrative Staff GHƄEKGPE[CPF08*QHIGCTU -QTPGNKC)ØVJ ■ 5VCPFCTFKUCVKQP &+0+51%'% $CTDCTC'JTGPJÒHGT ■ (8#8&+&)/- %QTPGNKC-KTUVGP VKNN ■ Failure analysis, seminars, trainings Sigrid Mayr Heidrun Wolf Infrastructure Robert Rauschmayer ■ 6GUVHCEKNKV[ VGUVTKIU ■ /GCUWTKPINCDQTCVQT[ &UWTHCEG Department Leaders measurement system) &T+PI,QUGH/C[GT 2QUV&QEVKNN ■ Materials laboratory (SEM) Dr.-Ing. Michael Otto ■ Lubricants laboratory &T+PI*GTOCPP2ƅCWO ■ Electro/electronic laboratory &T+PI,QJCPP2CWN5VGORNKPIGT ■ 9QTMUJQR VWTPKPITQWPFƅCVITKPFKPI 2QUV&QE machine) Dr.-Ing. Thomas Tobie ■ )GCTITKPFKPIOCEJKPG.)) Senior Engineers Courses &T+PI-NCWU/KEJCGNKU ■ /CEJKPG'NGOGPVU+ ++ &T+PI2GVGT1UVGT ■ Drive-Systems Technology for Vehicles ■ High-performance Gears for Marine Research Scientists – Team Leaders &TKXGU9KPF'PGTI[2NCPVUCPF+PFWUV- Dipl.-Ing. Florian Dobler rial Applications Dipl.-Ing. Thomas Dräxl ■ &GUKIPQH)GCT$QZGUYKVJ%[NKPFTKECN &T+PI/CVVJKCU(ØTUVGPDGTIGT 2QUV&QE Gears VKNN ■ $GXGNCPF*[RQKF)GCTUHQT8GJKENG &T+PI/KEJCGN*GKFGT VKNN Drive Systems &T+PI5GDCUVKCP+FNGT 2QUV&QE ■ Special Section Machine Elements – &KRN+PI&CPKGN-CFCEJ 4QNNKPI2CKTKPI Thomas Lohner, M.Sc. ■ Synchromesh Systems and Multidisc Dipl.-Ing. Werner Sigmund Clutches &T+PI(NQTKCP9QJNNGDGT 2QUV&QE VKNN 194 Institute of Machine Elements Research Scientists Dipl.-Ing. Eva-Maria Reitinger Dipl.-Ing. Robert Acuner &KRN+PI*CPULÒTI5EJWNVJGK» &KRN+PI/CTMWU$CCT Dipl.-Ing. Stefan Schurer 5CDTKPC$CPUGOKT/5E Martin Sedlmair, M.Sc. ,GPU$KJT/5E Dipl.-Ing. Maximilian Strebel &KRN+PI+XCP$QKCFLKGX &KRN+PI6JCPCM7VCMCRCP 5GDCUVKCP$QTP/5E VKNN &KRN+PI-CVJCTKPC8ÒNMGN &KRN+PI/CTMWU&CHHPGT Christian Weber, M.Sc. Dipl.-Ing. Rui Dai Dipl.-Ing. Alexander Weigl Dipl.-Ing. Andreas Dobler 7YG9GKPDGTIGT/5E Martin Ebner, M.Sc. &KRN+PI%CTQNKP9KEMDQTP Dipl.-Ing. Christian Engelhardt Dipl.-Ing. Maximilian Zimmer Dipl.-Ing. Michael Felbermaier &KRN+PI$GTPF Publications 2013-14 ■ 5VCJN- /C[GT, )GKIGT, 9KTMWPIUITCFXGT- ■ 5EJWNVJGK»* 6QDKG6 /KEJCGNKU- 5VCJN DGUUGTWPIKP)GVTKGDGPs'KPƅWUUXQP8GT\CJPWPI - )TGCUG.WDTKECVKQPs9GCTDGJCXKQTQHIGCTU WPF5EJOKGTUVQHHCO$GKURKGNGKPGU2-9)GVTKGDGU NWDTKECVGFYKVJ0.)+ITGCUGUCVNQYURGGFU )'6241-QPITGUU\WT)GVTKGDGRTQFWMVKQP 56.'56.'#PPCWCN/GGVKPI'ZJKDKVKQP 9ØT\DWTI &GVTQKV ■ 5VCJN- 2ƅCWO* #EWPGT4 4GKDWPIU- ■ 5VCJN- 2ƅCWO* /GKPIC»PGT), 7NDTKEJ \CJN5ETGGPKPIVGUVHØT.COGNNGPMWRRNWPIGPOKV * /CKT% /C[GV, .QJOCPP$ 2ƅGIJCCT 2CRKGTTGKDDGNCI8&+(CEJVCIWPI-WRRNWPIGPWPF , 6GUV4KI&GUKIPHQT+PXGUVKICVKQPUQP6QTUKQPCN -WRRNWPIUU[UVGOGKP#PVTKGDGP-WRRNWPIGPWPF 8KDTCVKQP+UQNCVKQP7PKVU%6+s%CT6TCKPKPI+PUVKVWVG -WRRNWPIUU[UVGOGKP#PVTKGDGP-CTNUTWJG VJ+PVGTPCVKQPCN%6K5[ORQUKWOCPF'ZJKDKVKQP s+PPQXCVKXG#WVQOQVKXG6TCPUOKUUKQPU*[DTKF ■ 5VCJN- 2ƅCWO* $ÀWONGT4 9QJNNGDGT( 'NGEVTKE&TKXGU4QEJGUVGT/+ *CUN% 'NGMVTQOGEJCPKUEJCMVWKGTVGDGFCTHUIG- ■ 5VCJN- 2ƅCWO* *GPUGN/ /GVJQFUHQT TGEJVG.CUVUEJCNVMWRRNWPI8&+/GEJCVTQPKMVCIWPI performance evaluation of lubricants and friction /GEJCVTQPKM#CEJGP OCVGTKCNUKPYGVOWNVKRNGFKUEENWVEJGUKPCZNGDTCMG CRRNKECVKQPU8&+)GVTKGDGKP(CJT\GWIGP &TKXGVTCKPHQT8GJKENGUs8&+$GTKEJVG (TKGFTKEJUJCHGP Institute of Machine Elements 195 ■ 5VCJN- 2ƅCWO* +FNGT5 +PXGUVKICVKQPUQPVJG ■ *ÒJP$4 5VCJN- )YKPPGT2 +ORTQXGF'HƄ- UEWHƄPITGUKUVCPEGQHDGNVCPFEJCKPEQPVKPWQWUN[ EKGPE[HQT*KIJ4CVKQ2NCPGVCT[)GCT6TCPUOKUUKQPU variable transmissions. VDI. Getriebe in Fahrzeugen – Low-loss Wolfrom transmission for wind turbines. &TKXGVTCKPHQT8GJKENGUs8&+$GTKEJVG VDI. International Conference on Gears, Munich (TKGFTKEJUJCHGP ■ 5VCJN- *ÒJP$4 /KEJCGNKU- /C[GT, (WGN ■ 5VCJN- *ÒJP$4 /KEJCGNKU- 6QDKG6 Economy Lubricants in Manual and Dual-Clutch 5VGORNKPIGT,2 )TGCUG.WDTKECVKQPQH)GCTU 6TCPUOKUUKQPU8&+)GVTKGDGKP(CJT\GWIGP s.QCF%CTT[KPI%CRCEKV[CPF'HƄEKGPE[8&+ &TKXGVTCKPHQT8GJKENGUs8&+$GTKEJVG +PVGTPCVKQPCN%QPHGTGPEGQP)GCTU/WPKEJ (TKGFTKEJUJCHGP ■ 5VCJN- *ÒJP$4 1VVQ/ /QP\# .QCF ■ 9KTVJ% *ÒJP$4 $TC[MQHH% 0GY/GVJQFU ECRCEKV[CPFGHƄEKGPE[QHITGCUGNWDTKECVGFYQTO HQTVJG%CNEWNCVKQPQHVJG.QCF%CRCEKV[QH$GXGN gears. VDI. International Conference on Gears, CPF*[RQKF)GCTU)GCT6GEJPQNQI[8QN0Q /WPKEJ RR ■ *ÒJP$4 5VCJN- )YKPPGT2 .KIJV9GKIJV ■ 5VCJN- /C[GT, *KPVGTUVQKUUGT/ /KPKOKUKPI &GUKIPHQT2NCPGVCT[)GCT6TCPUOKUUKQPU)GCT IGCTNQUUGU#5/'#5/'+PVGTPCVKQPCN 6GEJPQNQI[*GHV RR &GUKIP'PIKPGGTKPI6GEJPKECN%QPHGTGPEGU%QO- ■ /K[CVC5 *ÒJP$4 /KEJCGNKU- -TGKN1 puters and Information in Engineering Conference Temperature Rise Analysis in Traction Contact Areas &'6% 2QTVNCPF1TGIQP75# QH6QTQKFCN%86U/QVKQP%QPVTQNs05-6GEJPKECN ■ 5VCJN- *ÒJP$4 6QDKG6 6QQVJƅCPMDTGCM ,QWTPCN*GHV RR CIGsKPƅWGPEGUQPUWDUWTHCEGKPKVKCVGFHCVKIWG ■ 5VGORNKPIGT,2 5VCJN- *ÒJP$4 6QDKG HCKNWTGUQHECUGJCTFGPGFIGCTU#5/'#5/' 6 /KEJCGNKU- #PCN[UKUQHNWDTKECVKQPUWRRN[QH International Design Engineering Technical Confer- IGCTUNWDTKECVGFYKVJITGCUGU0.)+CPFCPFVJG GPEGU%QORWVGTUCPF+PHQTOCVKQPKP'PIKPGGTKPI GHHGEVUQPNQCFECTT[KPIECRCEKV[CPFGHƄEKGPE[ %QPHGTGPEG &'6% 2QTVNCPF1TGIQP75# 0.)+0.)+VJ#PPWCN/GGVKPI6WEUQP#TK\QPC ■ 5VGORNKPIGT,2 5VCJN- *ÒJP$4 6QDKG6 ■ 5VCJN- *ÒJP$4 6QDKG6 6QQVJ(NCPM /KEJCGNKU- #PCN[UKUQHNWDTKECVKQPUWRRN[QHIGCTU $TGCMCIGs+PƅWGPEGUQP5WDUWTHCEGKPKVKCVGF NWDTKECVGFYKVJITGCUGU0.)+CPFVJGGHHGEVU (CVKIWG(CKNWTGUQH%CUG*CTFGPGF)GCTU$)#s QPNQCFECTT[KPIECRCEKV[CPFGHƄEKGPE[9QTNF $TKVKUJ)GCT#UUQEKCVKQP)GCTUs6GEJPKECN Tribology Congress. World Tribology Congress #YCTGPGUU5GOKPCT5VCHHQTFUJKTG 6QTKPC+VCN[ ■ (ØTUVGPDGTIGT/ 1UVGT2 5VCJN- *ÒJP$4 ■ %QPENK( )QTNC% 5VCJN- *ÒJP$4 .GKUVWPIUUVGKIGTWPIXQP-WPUVUVQHH\CJPTÀFGTP /KEJCGNKU- 5EJWNVJGK»* 5VGORNKPIGT,2 durch verlustoptimierte Verzahnungsgeometrien. .QCFKPFGRGPFGPVRQYGTNQUUGUQHQTFKPCT[IGCTU -QPUVTWMVKQP*GHV RR numerical and experimental analysis. World Tribo- ■ 5VCJN- 2ƅCWO* /GKPIC»PGT), 7NDTKEJ* NQI[%QPITGUU9QTNF6TKDQNQI[%QPITGUU /CKT% +UQNCVKQPQH6QTUKQPCN8KDTCVKQPUKP#WVQOQ- 6QTKPC+VCN[ VKXG#RRNKECVKQPUs2CUUKXG5YKVEJKPI+UQNCVQT25+ ■ 5VCJN- /KEJCGNKU- /C[GT, 9GKIN# .QJPGT %6+s%CT6TCKPKPI+PUVKVWVGVJ+PVGTPCVKQPCN%6+ 6 1OCUVC/ *CTVN/ -TWRMC+ 6JGQTGVKECNCPF Symposium ‘Automotive Transmissions, HEV and experimental investigations on EHL point contacts '8&TKXGUo$GTNKP with different entrainment velocity directions. World ■ 5VTGDGN/ 9KTVJ/ 2ƅCWO* 5VCJN- Tribology Congress. World Tribology Congress Schleppverluste in Synchronisierungen. FVA. 6QTKPC+VCN[ )'6.7$s6TKDQNQIKGWPF5EJOKGTUVQHHMQPITGUU ■ $TGVN0 5EJWTGT5 6QDKG6 5VCJN- *ÒJP /CPPJGKO $4 +PXGUVKICVKQPUQP6QQVJ4QQV$GPFKPI ■ *GPUGN/ 2ƅCWO* 'KPƅWUUFGTVJGTOKUEJGP Strength of Case Hardened Gears in the Range $GCPURTWEJWPICWHFKG5EJÀFKIWPIPCUUNCWHGPFGT QH*KIJ%[ENG(CVKIWG#)/##)/#(CNN .COGNNGPMWRRNWPIGP(8#)'6.7$s6TKDQNQIKG 6GEJPKECN/GGVKPI+PFKCPCRQNKU75# WPF5EJOKGTUVQHHMQPITGUU/CPPJGKO ■ 5VCJN- 1VVQ/ 196 Institute of Machine Elements ■ #EWPGT4 8ÒNMGN- 2ƅCWO* 5VCJN- ■ 2CTNQY, 1VVQ/ 5VCJN- #PYGPFWPIUƅGZKDNG +PƅWGPEGQH%QPG#PING&KHHGTGPEGQP2GTHQTOCPEG )GVTKGDGCWUNGIWPIPCEJ9WPUEJ(8#5+/2'2 of Synchonizers with Carbon Friction Linings. VDI. -QDNGP\.CJPUVGKP )GVTKGDGKP(CJT\GWIGP&TKXGVTCKPHQT8GJKENGU ■ $QTP5 5KIOWPF9 5VGORNKPIGT,2 1VVQ (TKGFTKEJUJCHGP / 5VCJN- 50'5;5s#WUNGIWPIUWPF ■ /GKPIC»PGT), /C[GV, 2ƅCWO* 7NDTKEJ $GTGEJPWPIUUQHVYCTGHØT5EJPGEMGPIGVTKGDG(8# * 4KZGP& 5VCJN- +PPQXCVKXG%GPVTKHWICN2GP- 5+/2'2-QDNGP\.CJPUVGKP FWNWO#DUQTDGT5%2#s5[PEJTQPQWU%GPVTKHWICN ■ 0GWDCWGT$ 'HƄ\KGPVG.CUVXGTVGKNWPIUDGTGEJPWPI 2GPFWNWO#DUQTDGT8&+)GVTKGDGKP(CJT\GWIGP WPF-QTTGMVWTCWUNGIWPIKP2NCPGVGPIGVTKGDGU[UVG- &TKXGVTCKPHQT8GJKENGU(TKGFTKEJUJCHGP OGP(8#5+/2'2-QDNGP\.CJPUVGKP ■ $KJT, *GKFGT/ 1VVQ/ 5VCJN- -WOG6 ■ 0KVUEJ% 1VVQ/ *GKFGT/ *ÒJP$4 5VCJN -CVQ/ )GCTPQKUGRTGFKEVKQPKPCWVQOQVKXGVTCPU- - &[PCOKE$GJCXKQTQH5VGGN2QN[OGT%QO- missions. LaMCoS ECAM INSA CNRS7PKXGTUKVÅ RQWPF)GCTU8&+)GVTKGDGKP(CJT\GWIGP FG.[QP+PVGTPCVKQPCN)GCT%QPHGTGPEG.[QP &TKXGVTCKPHQT8GJKENGU(TKGFTKEJUJCHGP 8KNNGWTDCPPG(TCPEG ■ #EWPGT4 2ƅCWO* 5VCJN- (TKEVKQP5ETGGPKPI ■ 5VGORNKPIGT,2 5VCJN- *ÒJP$4 6QDKG 6GUV(QT9GV/WNVKRNG&KUE%NWVEJGU9KVJ2CRGT 6 /KEJCGNKU- #PCN[UKUQHNWDTKECVKQPUWRRN[QH 6[RG(TKEVKQP/CVGTKCN56.'5QEKGV[QH IGCTUNWDTKECVGFYKVJITGCUGU0.)+CPFCPFVJG 6TKDQNQIKUVUCPF.WDTKECVKQP'PIKPGGTU.CMG$WGPC GHHGEVUQPNQCFECTT[KPIECRCEKV[CPFGHƄEKGPE[ 8KUVC(NQTKFC 0.)+5RQMGUOCP+UUWG RR ■ +FNGT5 2ƅCWO* 5VCJN- +PXGUVKICVKQPUQP ■ )YKPPGT2 1VVQ/ 5VCJN- .GKIJVYGKIJV6QT- VJGUEWHƄPITGUKUVCPEGQHDGNVCPFEJCKPV[RG SWG8GEVQTKPI6TCPUOKUUKQPHQTVJG'NGEVTKE8GJKENG continuously variable transmissions. CTI – Car 8KUKQ/$C[GTP+PPQXCVKX%QPHGTGPEGQP(WVWTG 6TCKPKPI+PUVKVWVGVJ+PVGTPCVKQPCN%6+5[ORQUKWO #WVQOQVKXG6GEJPQNQI[)CTEJKPI – Automotive Transmissions, HEV and EV Drives, ■ 5EJWNVJGKUU* 6QDKG6 /KEJCGNKU- *ÒJP 4QEJGUVGT/+ $4 5VCJN- 6JG5NQY5RGGF9GCT$GJCXKQTQH ■ (KUEJGT2 2ƅCWO* 5VCJN- $GTIOCKGT, %CUG%CTDWTK\GF)GCTU.WDTKECVGFYKVJ0.)+ 9CEJVOGKUVGT) %QPEGRVQHCENWVEJWPKVHQTC )TGCUGWPFGT$QWPFCT[.WDTKECVKQP%QPFKVKQPU URNKVETCPMUJCHVKEG%6+s%CT6TCKPKPI+PUVKVWVG 6TKDQNQI[6TCPUCEVKQPU+UUWG RR VJ+PVGTPCVKQPCN%6+5[ORQUKWOs#WVQOQVKXG Transmissions, HEV and EV Drives, Rochester, MI ■ 'PVTGUU(ØTUVGPGEM#XQP )YKPPGT2 1VVQ/ (NØIGN5 'NGMVTQOGEJCPKUEJGT#PVTKGDUUVTCPIOKV ■ $GTIOCKGT, 9CEJVOGKUVGT) (KUEJGT2 2ƅCWO 6QTSWG8GEVQTKPI#6<GZVTC+UUWG 1MVQDGTRR * 5VCJN- 5RNKVETCPMUJCHVGPIKPG EQPEGRVHQTC combustion engine with a two-piece disengageable ■ 5VCJN- +FNGT5 2QNN) (TKGFN# 5WRGT*QEJ- ETCPMUJCHV(-(5s(QTUEJWPIUKPUVKVWVHØT-TCHVHCJT- FTGJ\CJN-QP\GRVHØTFGPGNGMVTKƄ\KGTVGP#PVTKGDU- wesen und Fahrzeugmotoren Stuttgart. Automotive UVTCPI-QPUVTWMVKQP+UUWG CPF'PIKPG6GEJPQNQI[5VWVVICTV ■ *ÒJP$4 5VCJN- )YKPPGT2 +ORTQXGF ■ $QKCFLKGX+ 9KV\KI, 6QDKG6 5VCJN- 6QQVJ 'HƄEKGPE[HQT*KIJ4CVKQ2NCPGVCT[)GCT6TCPUOKU- ƅCPMHTCEVWTGsDCUKERTKPEKRNGUCPFECNEWNCVKQP sions – Low-loss Wolfrom Transmission for Wind model for a sub surface initiated fatigue failure 6WTDKPGU)GVTKGDGCMVWGNN+UUWG RR mode of case hardened gears. LaMCoS ECAM +05#EPTU70+8'45+6'&'.;10+PVGTPCVKQPCN ■ )YKPPGT2 1VVQ/ 5VCJN- &GUKIPQHNQY )GCT%QPHGTGPEG.[QP8KNNGWTDCPPG(TCPEG excitation gearings for electric vehicles. CTI – Car 6TCKPKPI+PUVKVWVGVJKPVGTPCVKQPCN%6+5[ORQ- ■ 5VCJN- /KEJCGNKU- /C[GT, 9GKIN# .QJPGT UKWO$GTNKP 6 1OCUVC/ *CTVN/ -TWRMC+ 6JGQTGVKECNCPF ■ 4ÒUNGT5 (KUEJGT2 'TYGKVGTWPIFGUCMVKXGP 'ZRGTKOGPVCN+PXGUVKICVKQPUQP'*.2QKPV%QPVCEVU &QYPUK\KPIUFWTEJFCU5RNKVOQVQT-QP\GRV with Different Entrainment Velocity Directions. 8QTVTCI4GIGPUDWTI 6TKDQNQI[6TCPUCEVKQPUQPN[CXCKNCDNGQPNKPG ■ 5VGORNKPIGT,2 6JGQWVNQQMHQTGPGTI[CPFVJG ■ .QJPGT6 /GT\4 /C[GT, /KEJCGNKU- role of synthetic lubricants in improving energy -QRPCTUMK/ 5VCJN- 1PVJG'HHGEVQH2NCUVKE GHƄEKGPE[.GEVWTG#OUVGTFCO &GHQTOCVKQP 2& #FFKVKXGUKP.WDTKECPVU'WTQRGCP ■ #EWPGT4 2ƅCWO* 5VCJN- +PƅWGPEGQH 5[ORQUKWOQP(TKEVKQP9GCTCPF9GCT2TQVGEVKQP lubricant on friction and deterioration behavior of QPN[CXCKNCDNGQPNKPG synchronizers with carbon friction linings. CTI – Car ■ 4GKOCPP6 5VGORNKPIGT,2 5VCJN- >(TGUU- 6TCKPKPI+PUVKVWVGVJ+PVGTPCVKQPCN%6+5[ORQ- VGUV#%TsGKPG/GVJQFG\WT2TØHWPIFGU(TGUU UKWO$GTNKP WPF8GTUEJNGK»XGTJCNVGPUXQP*[RQKFÒNGP)H6 ■ 5VGORNKPIGT,2 5VCJN- 7PVGTUWEJWPIGP\WT Reibung, Schmierung und Verschleiß – Forschung 5EJOKGTWPIWPF6TCIHÀJKIMGKVXQP Institute of Machine Elements 197 Institute of Automation and Information Systems /QFGNKPIQHKPVGNNKIGPVTGEQPƄIWTCDNGFKUVTKDWVGFE[DGTRJ[UKECNRTQFWEVKQPU[UVGOU ■ The focus of the Institute of Automation and Information Systems (AIS) in 2013-14 was to establish novel methods, approaches and tools to cope with the challenges that result from the increasing demand to produce EWUVQOGTURGEKƄEKPFKXKFWCNRTQFWEVUKPVJGOCEJKPGCPFRNCPVOCPWHCE- turing domain. Therein, innovative approaches for AIS are analyzed and evaluated in real- Industrie 4.0-capable systems have been world scenarios and together with experts developed to support both the enginee- from industry. ring and the operation of cyber-physical production systems. Among others, 2TQH&T+PI technologies and methods applied at AIS $KTIKV8QIGN*GWUGT are agent-based and service-oriented approaches as well as modeling ap- Contact proaches – both semi-formal and formal – to provide novel concepts for designing www.ais.mw.tum.de [email protected] CPFQRGTCVKPIKPVGNNKIGPVTGEQPƄIWTCDNG Phone +49.89.289.16400 distributed cyber-physical production systems. Especially methods and tech- nologies from the computer science domain are used and adapted to address the challenges in automation and in the machine and plant manufacturing domain. Moreover, taking the interaction with humans and machines into account, the Research focus of the Institute of Automation and methods and approaches developed at Information Systems +PVGNNKIGPV4GEQPƄIWTCDNG&KUVTKDWVGF %[DGTRJ[UKECN2TQFWEVKQP5[UVGOU Due to the ever-increasing complexity and dimensions in industrial automation, the distribution of intelligence and automa- tion tasks among system components is necessary. The research topic’s main challenge is to explore the advantages of distributed systems such as enhanced reliability, reusability and modularity con- trary to the main disadvantages e.g. the extended need of communication. Current researches deal with the implementation and optimization of distributed systems itself regarding functional and non- functional requirements. Several aspects of distributed systems are addressed. At AIS, notations, methods and tools are developed for the design of agent- Open research demonstrator „myJoghurt“. Starterkit oriented automation software for ma- available from http://i40d.ais.mw.tum.de/ chines and production plants in both the manufacturing and process automation domain. By that, the design, implemen- 198 Institute of Automation and Information Systems tation and operation of distributed, intel- Projects ligent cyber-physical production systems ■ BayFor Project – Automatische ECPDGUKORNKƄGFEQORTGJGPUKDKNKV[ECP Codegenerierung für modulare Anlagen be increased and, thus, acceptance in (Acoma) industry can be enhanced. ■ BMBF Project – Sichere, dynamische In 2014, AIS was able to establish a joined Vernetzung in Operationssaal und Klinik demonstrator ‘myJoghurt’ that shows the (OR.NET) capabilities of agent-based approaches ■ DFG Project – Funktionaler Anwen- in the context of Industrie 4.0. In collabo- dungsentwurf für verteilte Automatisie- ration with 5 German institutes, this open rungssysteme (FAVA) research demonstrator and the agent- ■ DFG Project – Gesteigerte Flexibilität based architecture have been developed in heterogen aufgebauten Material- and established. Together with internatio- ƅWUUU[UVGOGPCWH$CUKUKPVGNNKIGPVGT nal robot companies the same architecture 5QHVYCTGCIGPVGPKPUGNDUVMQPƄIWTKGTGP- and platform was applied for a collabora- der Fördertechnik (iSikon) tive production. Using simple scenarios, the coupling of locally distributed produc- tion systems in an automatic and dynamic manner can be demonstrated. /QFGNDCUGF'PIKPGGTKPIQH8CTKCPVTKEJ +PVGTFKUEKRNKPCT[/CPWHCEVWTKPI5[UVGOU +PVJKUƄGNFQHTGUGCTEJVJGKPUVKVWVG#+5 investigates concepts and methods that address the model-based development of industrial production automation systems of different domains such as discrete manufacturing processes as well as continuous (chemical) production Laboratory plant at the Institute processes. A special focus is put on the for Automation and Information Systems with running UML State interdisciplinary character of the design of Chart in debug mode industrial automation systems as well as on increasing the transparency and handling CRRNKECVKQPUCOCLQTQWVEQOGQHVJKUƄGNF VJGEQORNGZKV[VJTQWIJQWVVJGYQTMƅQYQH of research is the successful realization of automation systems’ design and operation. approaches for model-based automation In addition, concepts for the integration of software development, code generation, energy aspects with the modeling of the and model-based debugging as well as operating performance (behavior) of pro- software testing inside a development duction systems and automotive systems environment for automation software that is are explored. Therefore, different modeling widely used in industry. languages are investigated and adapted for these different classes of mechatronic Projects systems and corresponding editors and ■ AiF Project – Anforderungsbasierte Test- tool environments have been developed. fallentwicklung für die Funktionsprüfung For the coupling and synchronization of mechatronischer Systeme (Artemis) heterogeneous models, model transforma- ■ AiF Project – Steigerung der Zuverläs- tions as well as formal methods for con- sigkeit von Maschinen und Anlagen sistency checking have been investigated durch automatisiertes Testen von and successfully applied. Concerning the Fehlerbehandlungsroutinen in der transfer of research results into industrial Steuerungssoftware (ZuMaTra) Institute of Automation and Information Systems 199 ■ BMBF Project – Automati sches Gene- Graduiertenkolleg des SFB 768, Formal rieren von Fertigungsmanage ment sys- Analyses of Heterogeneous Models temen (für die Lebensmittelindustrie) (SFB 768) (AutoMES) ■ IuK Bayern Project – Integrierter Model- ■ BMWi Project – Entwicklung eines Sys- lierungsansatz für den Produktlebens- tems zum modellgestützten Energiema- zyklus auf Basis modularer Modelle nagement von Produktionsanlagen in (IMIP) Echtzeit (morE) ■ IuK Bayern Project – Modellbasiertes ■ DFG Project – Model-Driven Evolution Testen von SPS-Steuerungssoftware- Management Framework for Automa- varianten für den Sondermaschinenbau tion Systems (MoDEMAS) (MoBaTeSt) ■ DFG Projects – IT-Zyklen in transdiszi- plinären Innovationsprozessen, MGK: *WOCP/CEJKPG+PVGTCEVKQPCUYGNNCU&CVC +PVGITCVKQPCPF2TQEGUUKPIVQ5WRRQTV*WOCPU operation by new visualization technolo- gies such as 3D visualization as well as augmented reality and their visualization on mobile devices. Today’s challenges cover the extraction of DGPGƄEKCNKPHQTOCVKQPHTQOVJGTKUKPIƅQQF of process data to e.g. detect faults. This information is collected by data aggrega- tion and data analysis from many different data sources. Fault characteristics are not only characteristics indicating a fault, Exemplary 3D visualization of but also symptoms that indicate causal process and engineering data impact of a fault within a system. Based on this analysis the system can provide 6JKUƄGNFQHTGUGCTEJCFFTGUUGUVJG recommendations to the operator on how design and evaluation of human-machine- he has to intervene in the process. interfaces (HMI) for operators as well as engineering support systems. Projects 6JGTGUGCTEJƄGNFEQPEGTPUUWRRQTVKPI ■ BMBF Project – Durchgängige Zuver- the operating personnel in training, com- lässigkeit im Einsatz Mobiler Manipula- missioning, process monitoring, process toren (DrIEM) optimizing, and diagnosis by means of ■ KME Project – Gestaltungsempfeh- appropriate visualization methods of lungen für einen ergonomischen process and message data during the 'PVYWTHWPFƅGZKDNG5[UVGOCTEJKVGM operation phase of technical plants. The turen von Touch-Interaktionskonzepten current trend in industry is to replace (Ge3stik) the classical 2D visualization systems in ■ Self-Funded Project – Structural Code control rooms for process monitoring and Analysis for IEC 61131 200 Institute of Automation and Information Systems 4GUGCTEJ(QEWU 4GUGCTEJ5EKGPVKUVU ■ Model-based engineering Thomas Aicher ■ Quality management Ulrich Bührer ■ Distributed control systems Manuela Engels ■ Cyber-physical production systems Stefan Feldmann ■ Information processing Jens Folmer ■ Human factors Dr.-Ing. Timo Frank Denise Gramß %QORGVGPEG Johann Hufnagel ■ Improvement of the engineering during Konstantin Kernschmidt the whole life cycle of products and Christoph Legat production lines for hybrid processes Felix Mayer using and adapting methods from com- Dorothea Pantförder puter science, e.g. pattern recognition Daniel Regulin and software engineering. Sebastian Rehberger ■ In charge of the smart production Susanne Rösch scenario of the cyber physical systems Michael Schneider road-map in close cooperation with Daniel Schütz market-leading companies. Alberto Streit Dmitry Tikhonov Infrastructure Sebastian Ulewicz ■ Complex hybrid plant lab model, which Benedikt Weißenberger operates with market leading automa- tion devices 6GEJPKECN5VCHH ■ 48 modular production plants for Karina Grimm C-programming in basic lectures Patrick Luxenburger ■ Pick and Place Unit-demonstrator for Thomas Mikschl evolution in industrial plant automation Andor Nagy Johannes Werner Courses David Wottawa ■ Basics of Modern Information Techno- logy I+II #RRTGPVKEGU ■ Modeling and Simulation Christian Gmeinwieser ■ Industrial Automation 1+2 Tom Kaden ■ Development of Distributed Intelligent Julian Schachermeier Embedded Mechatronic Systems ■ Industrial Software Engineering 1+2 &QEVQTCN6JGUGUƄPKUJGFKP Dr.-Ing. Gülden Bayrak Management Dr.-Ing. Timo Frank Prof. Dr.-Ing. Birgit Vogel-Heuser, Director Dr.-Ing. Dorothea Pantförder Adjunct Professors Dr.-Ing. Heiko Meyer Dr. Ulf Schünemann Administrative Staff Michaela Franke Irene Goros Elke Reichardt Patrizia Trostl Institute of Automation and Information Systems 201 2WDNKECVKQPU Journal Articles ■ Vogel-Heuser, B.; Legat, C.; Folmer, J.; Rösch, S.: Challenges of Parallel Evolution in Production Auto- OCVKQP(QEWUKPIQP4GSWKTGOGPVU5RGEKƄECVKQP ■ Duschl, K.; Gramß, D.; Obermeier, M.; Vogel-Heu- and Fault Handling. In: Automatisierungstechnik ser, B.: Towards a Taxonomy of Errors in PLC (at), vol. 62, no. 11, 2014, pp. 755-826. Programming. Cognition, Technology & Work, 2014. ■ Vogel-Heuser, B.; Schütz, D.; Frank, T.; Legat, ■ Folmer, J.; Vogel-Heuser, B.: Computing Dependent C.: Model-Driven Engineering of Manufacturing Industrial Alarms for Alarm Flood Reduction. In: Automation Software Projects - a SysML-based Transactions on Systems, Signals and Devices Approach. In: Mechatronics, vol. 24, no. 7, 2014, (TSSD), 2013. pp. 883-897. ■ Frank, T.; Eckert, K.; Hadlich, T.; Fay, A.; Diedrich, ■ Zhu, K.; Vogel-Heuser, B.: Sparse representation C.; Vogel-Heuser, B.: Erweiterung des V-Modells® and its applications in micro-milling condition für den Entwurf von verteilten Automatisierungs- monitoring: noise separation and tool condition systemen. In: Automatisierungstechnik (at), vol. 61, monitoring. In: The International Journal of Advan- no. 2, 2013, pp. 79-91. EGF/CPWHCEVWTKPI6GEJPQNQI[XQNPQ| ■ Legat, C.; Mund, J.; Campetelli, A.; Hackenberg, G.; 2014, pp. 185-199. Folmer, J.; Schütz, D.; Broy, M.; Vogel-Heuser, B.: +PVGTHCEG$GJCXKQT/QFGNKPIHQT#WVQOCVKE8GTKƄEC- tion of Industrial Automation Systems’ Functional Conformance. In: Automatisierungstechnik (at), %QPHGTGPEG2WDNKECVKQPU XQN|PQRR ■ Legat, C.; Schütz, D.; Vogel-Heuser, B.: Automatic ■ Abele, L.; Anic, M.; Gutmann, T.; Folmer, J.; Generation of Field Control Strategies for Support- Kleinsteuber, M.; Vogel-Heuser, B.: Combining- ing (Re-)Engineering of Manufacturing Systems. In: Knowledge Modeling and Machine Learning for Journal of Intelligent Manufacturing, vol. 25, no. 5, Alarm Root Cause Analysis. In: IFAC Conference on 2013, pp. 1101-1111. Manufacturing, Modelling, Management and Control ■ Li, F.; Legat, C.; Vogel-Heuser, B.: Extension (MIM), Saint Petersburg, 2013, pp. 1843-1848. of Electronic Device Description Language for ■ Aicher, T.; Legat, C.; Vogel-Heuser, B.: Einheitliche analysing change impacts in modular automation Parameterverwaltung mechatronischer Komponen- in manufacturing plants. In: Journal of Engineering ten im Software-Engineering des Maschinen- und Design, vol. 25, no. 1-3, 2014, pp. 125-149. Anlagenbaus. In: Entwurf komplexer Automatisie- ■ Obermeier, M.; Braun, S.; Vogel-Heuser, B.: A rungssysteme (EKA), 2014. Model Driven Approach on Object Oriented PLC ■ Barbieri, G.; Kernschmidt, K.; Fantuzzi, C.; Programming for Manufacturing Systems with Vogel-Heuser, B.: A SysML based design pattern regard to Usability. In: IEEE Transactions on for the high-level development of mechatronic Industrial Informatics, 2014. systems to enhance re-usability. In: 19th IFAC World ■ Schütz, D.; Wannagat, A.; Legat, C.; Vogel-Heuser, Congress, Kapstadt, 2014, pp. 3431-3437. B.: Development of PLC-based Software for ■ Duschl, K.; Obermeier, M.; Vogel-Heuser, B.: An Increasing the Dependability of Production Auto- Experimental Study on UML Modeling Errors and mation Systems. In: IEEE Transactions on Industrial their Causes in the Education of Model Driven Informatics, vol. 9, no. 4, 2013, pp. 2397-2406. PLC Programming. In: IEEE Global Engineering ■ Vogel-Heuser, B.: Usability experiments to evaluate Education Conference (EDUCON), Istanbul, 2014, UML/SysML-based Model driven Software Engineer- pp. 119-128. ing Notations for logic control in Manufacturing ■ Feldmann, S.; Kernschmidt, K.; Vogel-Heuser, B.: Automation. In: Journal of Software Engineering Combining a SysML-based modeling approach and Applications, vol. 7, no. 11, 2014, pp. 943-973. and semantic technologies for analyzing change ■ Vogel-Heuser, B.; Diedrich, C.; Broy, M.: Anforde- KPƅWGPEGUKPOCPWHCEVWTKPIRNCPVOQFGNU+P VJ rungen an CPS aus Sicht der Automatisierungs- CIRP Conference on Manufacturing Systems technik. In: Automatisierungstechnik (at), vol. 61, (CMS), 2014, pp. 451-456. no. 10, 2013, pp. 669-676. ■ Feldmann, S.; Legat, C.; Kernschmidt, K.; ■ Vogel-Heuser, B.; Diedrich, C.; Fay, A.; Jeschke, Vogel-Heuser, B.: Compatibility and Coalition S.; Kowalewski, S.; Wollschläger, M.; Göhner, P.: Formation: Towards the Vision of an Automatic Challenges for Software Engineering in Automation. Synthesis of Manufacturing System Designs. In: In: Journal of Software Engineering and Applica- 23rd IEEE International Symposium on Industrial tions, vol. 7, no. 5, 2014. Electronics (ISIE), Istanbul, 2014, pp. 1712-1717. ■ Vogel-Heuser, B.; Folmer, J.; Frey, G.; Liu, L.; ■ Feldmann, S.; Legat, C.; Schütz, D.; Ulewicz, S.; Hermanns, H.; Hartmanns, A.: Graphical Modeling Vogel-Heuser, B.: Automatic Rule-Based Inference of Networked Architectures and Real-Time-Requi- of Control Software Capabilities Considering Inter- rements for the Analysis of Networked Automation disciplinary Aspects. In: International Conference on Systems. In: Transactions on Systems, Signals and Production Research (ICPR), Iguassu Falls, 2013. Devices (TSSD), vol. 9, no. 1, 2014. ■ Feldmann, S.; Loskyll, M.; Rösch, S.; Schlick, J.; ■ Vogel-Heuser, B.; Folmer, J.; Legat, C.: Anforde- Zühlke, D.; Vogel-Heuser, B.: Increasing Agility in rungen an die Softwareevolution in der Automat- Engineering and Runtime of Automated Manufac- isierung des Maschinen- und Anlagenbaus. In: turing Systems. In: IEEE International Conference Automatisierungstechnik (at), vol. 62, no. 3, 2014, on Industrial Technology (ICIT), Kapstadt, 2013, pp. 163-174. RR| ■ Vogel-Heuser, B.; Kormann, B.; Tikhonov, D.; ■ Feldmann, S.; Rösch, S.; Legat, C.; Vogel-Heu- Rösch, S.: Automatisierter modellbasierter Appli- ser, B.: Keeping Requirements and Test Cases kationstest für SPS Steuerungsprogramme auf der Consistent: Towards an Ontology-based Approach. Basis von UML. In: Automatisierungstechnik (at), In: 12th IEEE International Conference on Industrial vol. 61, no. 6, 2013, pp. 382-392. Informatics (INDIN), Porto Alegre, 2014. 202 Institute of Automation and Information Systems ■ Feldmann, S.; Rösch, S.; Schütz, D.; Vogel-Heuser, ■ Kernschmidt, K.; Vogel-Heuser, B.: An interdis- B.: Model-Driven Engineering and Semantic Tech- ciplinary SysML based modeling approach for nologies for the Design of Cyber-Physical Systems. CPCN[\KPIEJCPIGKPƅWGPEGUKPRTQFWEVKQPRNCPVUVQ In: 11th IFAC Workshop on Intelligent Manufacturing support the engineering. In: 9th IEEE International Systems (IMS), São Paulo, 2013, pp. 210-215. Conference on Automation Science and Engineer- ■ Folmer, J.; Schuricht, F.; Vogel-Heuser, B.: Detection ing (CASE), Madison, 2013, pp. 1113-1118. of Temporal Dependencies in Alarm Time Series ■ Kernschmidt, K.; Vogel-Heuser, B.; Barbieri, G.; of Industrial Plants. In: 19th IFAC World Congress, Fantuzzi, C.: Interdisziplinäre modellbasierte Kapstadt, 2014, pp. 1802-1807. Entwicklung mechatronischer Systeme basierend ■ Fuchs, J.; Feldmann, S.; Legat, C.; Vogel-Heuser, auf SysML zur Steigerung der Wiederverwendung. $ +FGPVKƄECVKQPQH&GUKIP2CVVGTPUHQT+'% In: VDI Wissensforum – Automation, Baden-Baden, in Machine and Plant Manufacturing. In: 19th IFAC 2014. World Congress, Kapstadt, 2014, pp. 6092-6097. ■ Kernschmidt, K.; Wolfenstetter, T.; Münzberg, ■ Fuchs, J.; Legat, C.; Kernschmidt, K.; Frank, T.; C.; Goswami, S.; Lindemann, U.; Krcmar, H.; Vogel-Heuser, B.: Interdisziplinärer Produktlinien- Vogel-Heuser, B.: Concept for an Integration- ansatz zur Unterstützung der Wiederverwendbarkeit Framework to enable the crossdisciplinary im Maschinen- und Anlagenbau. In: Entwurf Development of Product-Service Systems. In: IEEE komplexer Automatisierungssysteme (EKA), 2014. International Conference on Industrial Engineering ■ Gramß, D.; Frank, T.; Rehberger, S.; Vogel-Heuser, and Engineering Management (IEEM), Bangkok, B.: Consideration of personal factors of freshmen in 2013. mechanical engineering modeling and programming ■ Kohn, A.; Reif, J.; Wolfenstetter, T.; Kernschmidt, K.; tasks in an E-learing environment. In: NETS2014, Goswami, S.; Krcmar, H.; Brodbeck, F.; Vogel- Singapore, 2014. Heuser, B.; Lindemann, U.; Maurer, M.: Improving ■ Hackenberg, G.; Campetelli, A.; Legat, C.; Mund, J.; common model understanding within collaborative 6GWƅ5 8QIGN*GWUGT$ (QTOCN6GEJPKECN2TQ- engineering design research projects. In: Inter- EGUU5RGEKƄECVKQPCPF8GTKƄECVKQPHQT#WVQOCVGF national Conference on Research into Design Production Systems. In: 8th System Analysis and (ICoRD), Chennai, India, 2013, pp. 643-654. Modelling Conference (SAM), Valencia, 2014. ■ Kohn, A.; Reif, J.; Wolfenstetter, T.; Kernschmidt, K.; ■ Hashemi, M.; Feldmann, S.; Legat, C.; Folmer, J.; Goswami, S.; Krcmar, H.; Brodbeck, F.; Vogel-Heu- Vogel-Heuser, B.: Modeling Multicore Program- ser, B.; Lindemann, U.: Improving Common Model mable Logic Controllers in Networked Automation Understanding Within Collaborative Engineering Systems. In: 39th Annual Conference of the IEEE Design Research Projects. In: 4th International Industrial Electronics Society (IECON), Vienna, Conference on Research into Design (ICoRD’13), 2013, pp. 4398-4403. Chennai, India, 2013, pp. 643-654. ■ Haubeck, C.; Ladiges, J.; Fuchs, J.; Legat, C.; Lam- ■ -QYCN/ .GICV% .QTGƄEG& 2TGJQHGT% mersdorf, W.; Fay, A.; Vogel-Heuser, B.: Interaction Schäfer, I.; Vogel-Heuser, B.: Delta Modeling for of Model-driven Engineering and Signal-based Variant-rich and Evolving Manufacturing Systems. Online Monitoring of Production Systems. Accepted In: 36th International Conference on Software paper in: 40th Annual Conference of the IEEE Engineering Workshops (ICSE Workshops 2014), Industrial Electronics Society (IECON), Dallas, 2014. Hyderabad, 2014. ■ Holthusen, S.; Wille, D.; Legat, C.; Beddig, S.; ■ Legat, C., Seitz, C., Lamparter, S., and Feldmann, Schaefer, I.; Vogel-Heuser, B.: Family Model Mining S.: Semantics to the Shop Floor: Towards Ontology for Function Block Diagrams in Automation Soft- Modularization and Reuse in the Automation ware. In: REVE held in conjunction with International Domain. In: 19th IFAC World Congress (IFAC 2014), Software Product Line Conference, Florence, 2014. Cape Town, 2014. ■ Hufnagel, J.; Frank, T.; Vogel-Heuser, B.: Frame- ■ Legat, C.; Bührer, U.; Feldmann, S.; Vogel-Heuser, work for a Model-Based, Cross-Domain System B.: An Approach for Discovering and Analyzing Interconnection in Automation Technology. In: 18th Implicit Architectural Designs in Field Level Auto- IEEE International Conference on Emerging Tech- mation Software. In: 40th Annual Conference of the nologies and Factory Automation (ETFA), Cagliari, IEEE Industrial Electronics Society (IECON), Dallas, RR| 2014. ■ Kernschmidt, K.; Barbieri, G.; Fantuzzi, C.; ■ Legat, C.; Folmer, J.; Vogel-Heuser, B.: Evolution in Vogel-Heuser, B.: Possibilities and challenges Industrial Plant Automation: A Case Study. In: 39th of an integrated development using a combined Annual Conference of the IEEE Industrial Electronics 5[U/.OQFGNCPFEQTTGURQPFKPIFQOCKPURGEKƄE Society (IECON), Vienna, 2013, pp. 4386-4391. models. In: IFAC Conference on Manufacturing ■ Legat, C.; Steden, F.; Feldmann, S.; Weyrich, Modeling, Management and Control (MIM), Saint M.; Vogel-Heuser, B.: Co-Evolution and Reuse Petersburg, 2013, pp. 1465-1470. of Automation Control and Simulation Software: ■ Kernschmidt, K.; Behncke, F.; Chucholowski, N.; +FGPVKƄECVKQPCPF&GƄPKVKQPQH/QFKƄECVKQP#EVKQPU Wickel, M.; Bayrak, G.; Lindemann, U.; Vogel- and Strategies. Accepted paper in: 40th Annual Heuser, B.: An integrated approach to analyze Conference of the IEEE Industrial Electronics change-situations in the development of production Society (IECON), Dallas, 2014. systems. In: 47th CIRP Conference on Manufactur- ■ Legat, C.; Vogel-Heuser, B.: A Multi-agent Archi- ing Systems (CMS), 2014, pp. 148-153. tecture for Compensating Unforeseen Failures on ■ Kernschmidt, K.; Feldmann, S.; Vogel-Heuser, B.: Field Control Level. In: 3rd International Workshop Analyse von Änderungsauswirkungen in langlebigen on Service Orientation in Holonic and Multi Agent Automatisierungssystemen. In: 1st Collaborative Manufacturing and Robotics, Valenciennes, 2013, Workshop on Evolution and Maintenance of Long- pp. 195-208. Living Systems (EMLS), Kiel, 2014, pp. 10-11. ■ Legat, C.; Vogel-Heuser, B.: An Orchestration ■ Kernschmidt, K.; Klein, P.; Jazdi, N.; Göhner, P.; Engine for Service-oriented Field Level Automation Weyrich, M.; Vogel-Heuser, B.: Methodology for Software. In: SOHOMA held in conjunction with the +FGPVKƄECVKQPQHCFCRVKXG4GWUCDNG/QFWNGUKP International Conference MOSIM, Nancy, 2014. automated Production Systems. In: CIRP Design ■ Lüder, A.; Göhner, P.; Vogel-Heuser, B.: Agent based Conference, Bochum, 2013, pp. 125-135. control of production systems. In: 39th Annual Conference of the IEEE Industrial Electronics Society (IECON), Vienna, 2013, pp. 7416-7421. Institute of Automation and Information Systems ■ Maisenbacher, S.; Kernschmidt, K.; Kasperek, D.; ■ Schütz, D.l.; Obermeier, M.; Vogel-Heuser, B.: Vogel-Heuser, B.; Maurer, M.: Using DSM and MDM SysML-based Approach for Automation Software methodologies to analyze structural SysML models. Development – Explorative Usability Evaluation In: IEEE International Conference on Industrial of the Provided Notation. In: 15th International Engineering and Engineering Management (IEEM), Conference on Human-Computer Interaction (HCI Bangkok, 2013. 2013), Las Vegas, 2013. ■ Mayer, F.; Legat, C.; Vogel-Heuser, B.: Towards a ■ Streit, A.; Rösch, S.; Vogel-Heuser, B.: Redeploy- Lightweight Platform for Realizing Agent-based ment of Control Software during Runtime for Cyber-Physical Production Systems. In: 6. Modular Automation Systems Taking Real-Time and Expertenforum Agenten im Umfeld von Industrie Distributed I/O into Consideration. In: 19th IEEE 4.0, 2014, pp. 31-38. International Conference on Emerging Technologies ■ Mayer, F.; Pantförder, D.; Vogel-Heuser, B.: Design and Factory Automation (ETFA), Barcelona, 2014. and implementation of an integrated, platform ■ Tikhonov, D.; Schütz, D.; Vogel-Heuser, B.: Towards independent 3D visualization of complex process Industrial Application of Model-driven Platform- data. In: 12th IFAC, IFIP, IFORS, IEA Symposium on independent PLC Programming Using UML. In: 40th Analysis, Design, and Evaluation of Human- Annual Conference of the IEEE Industrial Electronics Maschine Systems (IFAC HMS), Las Vegas, 2013, Society (IECON), Dallas, 2014. pp. 317-323. ■ Ulewicz, S.; Schütz, D.; Vogel-Heuser, B.: Flexible ■ Mayer, F.; Ulewicz, S.; Rehberger, S.; Vogel-Heuser, Real Time Communication between distributed B.: Webbasierte Programmierung, Simulation und Automation Software Agents. In: International Con- Steuerung von produktionstechnischen Schulungs- ference on Production Research (ICPR), Iguassu anlagen. In: Automation, Baden-Baden, 2013. Falls, 2013. ■ Meyer, H.; Plössnig, J.; Weißenberger, B.; ■ Ulewicz, S.; Schütz, D.; Vogel-Heuser, B.: Integ- Vogel-Heuser, B.: Energy Management based on a ration of Distributed Hybrid Multi-Agent Systems Hybrid Modeling Approach. In: IFAC Conference on into an Industrial IT Environment. Accepted paper Manufacturing, Modeling, Management and Control in: 12th IEEE International Conference on Industrial (MIM), Saint Petersburg, 2013, pp. 158-161. Informatics (INDIN), Porto Alegre, 2014. ■ Meyer, H.; Plössnig, J.; Weißenberger, B.; ■ Ulewicz, S.; Schütz, D.; Vogel-Heuser, B.: Software Vogel-Heuser, B.: Modeling of Power Consumption Changes in Factory Automation - Towards Auto- in Manufacturing. In: IEEE Industrial Automation, matic Change Based Regression Testing. In: 40th Communication & Informatics (ICIT), Busan, 2014. Annual Conference of the IEEE Industrial Electronics ■ Meyer, H.; Plössnig, J.; Weißenberger, B.; Society (IECON 2014), Dallas, 2014. 8QIGN*GWUGT$ 5VGKIGTWPIFGT#PNCIGPGHƄ\KGP\ ■ Ulewicz, S.; Schütz, D.; Vogel-Heuser, B.; Korajda, durch modellbasiertes Lastmanagement. In: B.; Hess, D.: Modellbasierte Auswirkungsbewertung VDI-Kongress Automation, Baden-Baden, 2013, von Änderungen und Testanpassung für SPS-Steu- RR| erungssoftware im Maschinen- und Anlagenbau. ■ Regulin, D.; Krooß, C.; Rehberger, S.; Vogel-Heuser, In: VDI Wissensforum - Automation, Baden-Baden, $ 'HƄEKGPV/QFGNKPIQH/GEJCVTQPKE5[UVGOU 2014. Regarding Variety and Complexity in the Field of ■ Vogel-Heuser, B.; Diedrich, C.; Fay, A.; Göhner, Automotive. In: 39th Annual Conference of the P.: Anforderungen an das Software-Engineering in IEEE Industrial Electronics Society (IECON), Vienna, der Automatisierungstechnik. In: Multikonferenz 2013, pp. 3505-3510. Software Engineering, 2013, pp. 51-66. ■ Regulin, D.; Schneider, M.; Rehberger, S.; ■ Vogel-Heuser, B.; Diedrich, C.; Pantförder, D.; Vogel-Heuser, B.: Automated model generation Göhner, P.: Coupling heterogeneous production in the electrical automotive driveline components. systems by a multi-agent based cyber-physical In: 19th IFAC World Congress, Cape Town, 2014, production system. Accepted paper in: 12th IEEE pp. 4499-4504. International Conference on Industrial Informatics ■ Rehberger, S.; Frank, T.; Mayer, F.; Vogel-Heuser, (INDIN), Porto Alegre, 2014, pp. 719-725. $ $GPGƄVQHCPGNGCTPKPIGPXKTQPOGPVKPENWFKPI ■ Vogel-Heuser, B.; Frank, T.; Rehberger, S.; Aicher, real and simulated plants for teaching mechanical T.: Quality despite quantity – teaching large engineering freshman in programming C. In: heterogenous classes in C programming and 23rd IEEE International Symposium on Industrial fundamentals in computer science. In: IEEE Global Electronics (ISIE), Istanbul, 2014, pp. 2196-2201. Engineering Education Conference (EDUCON), ■ 4GJDGTIGT5 (TCPM6 8QIGN*GWUGT$ $GPGƄV Istanbul, 2014, pp. 367-372. of e-learning teaching C-programming and software ■ Vogel-Heuser, B: Quality despite quantity - teaching engineering in a very large mechanical engineering huge classes of freshman in C-programming and beginners class. In: IEEE Global Engineering fundamentals in computer science. COBENGE Education Conference (EDUCON), Berlin, 2013, 2013 – XLI Congresso Brasilieiro de Educação em RR| Engenharia (Keynote Session), 2013. ■ Rösch, S.; Tikhonov, D.; Schütz, D.; Vogel-Heuser, ■ Weyrich, M.; Göhner, P.; Dietrich, C.; Vogel-Heuser, B.: Model-based testing of PLC software: test B.; Fay, A.; Wollschläger, M.; Kowalewski, S.: of plants’ reliability by using fault injection on Flexibles Management einer dezentralen Automa- component level. In: 19th IFAC World Congress, tisierungsverbundanlage als Beispiel für Industrie Cape Town, 2014, pp. 3509-3515. 4.0. In: VDI-Kongress Automation (VDI KA 2014), ■ Schneider, M.; Bayrak, G.; Reinschke, J.; Al-Hage Baden-Baden, 2014. Ali, A.; Zindler, A.; Mettenleiter, M.; Vogel-Heuser, B.: Prototypical Automatic Code Generation from Simulink to SPPA-T3000. In: 19th IFAC World Book Sections Congress, Cape Town, 2014. ■ Schütz, D.; Legat, C.; Vogel-Heuser, B.: MDE of ■ Feldmann, S.; Vogel-Heuser, B.: Änderungssze- Manufacturing Automation Software - Integrat ing narien in der Automatisierungstechnik – Heraus- SysML and Standard Development Tools. Accepted forderungen und interdisziplinäre Auswirkungen. paper in: 12th IEEE International Conference on In: Vogel-Heuser, B. (Ed.): Engineering von der Industrial Informatics (INDIN), Porto Alegre, 2014. Anforderung bis zum Betrieb, Kassel University Press GmbH, Kassel, 2013, pp. 95-108. Institute of Automation and Information Systems ■ Folmer, J.; Vogel-Heuser, B.: Kenngrößenermittlung ■ Rösch, S.; Tikhonov, D.; Vogel-Heuser, B.: Testen und -analyse für ein zustandsbasiertes Wartungs- in der Automatisierungstechnik - Anforderungen management. In: Vogel-Heuser, B. (Ed.): Engineer- und Lösungsansätze. In: Vogel-Heuser, B. (Ed.): ing von der Anforderung bis zum Betrieb, Kassel Engineering von der Anforderung bis zum Betrieb, University Press GmbH, 2013, Kassel, pp. 63-78. Kassel University Press GmbH, Kassel, 2013, ■ Frank, T.; Schütz, D.; Vogel-Heuser, B.: Funktionaler RR| Anwendungsentwurf für agentenbasierte, verteilte ■ Schütz, D.; Vogel-Heuser, B.: Werkzeugunter- Automatisierungssysteme. In: Göhner, P. (Ed.): stützung für die Entwicklung von SPS-basierten Agentensysteme in der Automatisierungstechnik, Softwareagenten zur Erhöhung der Verfügbarkeit. Springer Verlag, Berlin, 2013, pp. 3-19. In: Göhner, P. (Ed.): Agentensysteme in der Auto- ■ Friedrich, D.; Feldmann, S.; Vogel-Heuser, B.: matisierungstechnik, Springer Verlag, Berlin, 2013, Modularisierung und Wiederverwendung in der RR| Elektroplanung. In: Vogel-Heuser, B. (Ed.): Enginee- ■ Vogel-Heuser, B., Kernschmidt, K.: Modellbasiertes ring von der Anforderung bis zum Betrieb. Kassel disziplinübergreifendes Management von IT-Zyklen University Press, Kassel, 2013, pp. 28-40. in Innovationsprozessen. In: Vogel-Heuser, B.; ■ Fuchs, J.; Vogel-Heuser, B.; Tikhonov, D.: Analyse Lindemann, U.; Reinhart, G. (Eds.): Innovations- von Struktur und Modularität für die Steuerungs- prozesse zyklenorientiert managen – Verzahnte software. In: Vogel-Heuser, B. (Ed.): Engineering von Entwicklung von Produkt-Service Systemen. der Anforderung bis zum Betrieb, Kassel University Springer Verlag, Berlin, 2014, pp. 30-44. Press GmbH, Kassel, 2013, pp. 17-27. ■ Vogel-Heuser, B.: Automation als Enabler für ■ Hametner, R.; Kormann, B.; Vogel-Heuser, B.; Wink- Industrie 4.0 in der Produktion auf Basis von Cyber ler, D.; Zoitl, A.: Automated Test Case Generation Physical Systems. In: Vogel-Heuser, B. (Ed.): for Industrial Control Applications. In: Gupta, G. Engineering von der Anforderung bis zum Betrieb, S.; Bailey, D.; Demidenko, S.; Carnegie, D. (Eds.): Kassel University Press GmbH, Kassel, 2013, Recent Advances in Robotics and Automation, RR| Springer Verlag, Berlin, 2013, pp. 263-273. ■ Vogel-Heuser, B.; Göhner, P.; Lüder, A.: Agent based ■ Hess, D.; Hoos, J.; Schütz, D.; Feldmann, S.; control of production systems – and its architectural Vogel-Heuser, B.:Automatisierungsarchitekturen challenges. In: Industrial Agents: Emerging Appli- für das Engineering von Cyber-Physical Systems. cations of Software Agents in Industry, Elsevier, to In: Vogel-Heuser, B. (Ed.): Engineering von der appear 2015. Anforderung bis zu Betrieb, Kassel University Press, ■ Vogel-Heuser, B.; Legat, C.; Folmer, J.; Feldmann, Kassel, 2013, pp. 5-15. S.: Researching Evolution in Industrial Plant ■ Hufnagel, J.; Frank, T.; Vogel-Heuser, B.: Modell- Automation: Scenarios and Documentation of the landschaft für eine modell-basierte Systemkopplung Pick and Place Unit. Technical Report no. TUM- auf Basis der UML. In: Vogel-Heuser, B. (Ed.): AIS-TR-01-14-02, 2014. Engineering von der Anforderung bis zum Betrieb, ■ Vogel-Heuser, B.; Rösch, S.: Integrated Modeling Kassel University Press GmbH, 2013, Kassel, of Complex Production Automation Systems to RR| Increase Dependability. In: Klüppelberg, C.; Straub, ■ Legat, C.; Lamparter, S.; Vogel-Heuser, B.: D.; Welpe, I. M. (Eds.): Risk - A Multidisciplinary Knowledge-based Technologies for Future Factory Introduction, Springer Verlag, Berlin, Heidelberg, Engineering and Control. In: Borangiu, T.; Thomas, 2014, pp. 363-385. A.; Trentesaux, D. (Eds.): Service Orientation in Holo- ■ Vogel-Heuser, B.; Schütz, D.; Folmer J.; Legat C.: nic and Multi Agent Manufacturing and Robotics, An assessment of the potentials and challenges Springer Verlag, Berlin, 2013, pp. 355-374. in future approaches for automation software. ■ Legat, C.; Vogel-Heuser, B.: A Multi-agent In: Industrial Agents: Emerging Applications of Architecture for Compensating Unforeseen Failures Software Agents in Industry, Elsevier, to appear on Field Control Level. In: Borangiu, T. (Ed): Service 2015. Orientation in Holonic and Multi-Agent Manufactur- ■ Wannagat, A.; Schütz, D.; Vogel-Heuser, B.: Einsatz ing and Robotics, Springer Verlag, Berlin, 2013, von Softwareagenten am Beispiel einer kontinuierli- RR| chen, hydraulischen Heizpresse. In: Göhner, P. (Ed.): ■ Lüder, A.; Vogel-Heuser, B.; Göhner, P.: Y 4 Elek- Agentensysteme in der Automatisierungstechnik, tronische Datenverarbeitung – Agentenbasiertes Springer Verlag, Berlin, 2013, pp. 169-185. Steuern. In: Grote, K.-H. (Ed.): Dubbel-Taschenbuch für den Maschinenbau, Springer Verlag, Berlin, 2014, pp. Y32-Y40. Books ■ Mayer, F.; Pantförder, D.; Diedrich, C.; Vogel-Heuser, B.: Deutschlandweiter I4.0-Demonstrator – Techni- ■ Bauernhansl, T.; ten Hompel, M.; Vogel-Heuser, B. sches Konzept und Implementierung, 2013. (Eds.): Industrie 4.0 in Produktion, Automatisierung ■ Pantförder, D.; Mayer, F.; Diedrich, C.; Göhner, P.; und Logistik. Springer Verlag, Berlin, 2014. Weyrich, M.; Vogel-Heuser, B.:Agentenbasierte ■ Vogel-Heuser, B. (Ed.): Agenten im Umfeld von F[PCOKUEJG4GMQPƄIWTCVKQPXQPXGTPGV\VGP Industrie 4.0. Sierke Verlag, 2014. intelligenten Produktionsanlagen – Evolution statt ■ Vogel-Heuser, B. (Ed.): Engineering von der Anfor- Revolution. In: Bauernhansl, T.; ten Hompel, M.; derung bis zum Betrieb. Tagungen und Berichte. Vogel-Heuser, B. (Eds.): Industrie 4.0 in Produktion, Kassel University Press GmbH, Kassel, 2013. Automatisierung und Logistik, Springer Verlag, ■ Vogel-Heuser, B., Lindemann, U., Reinhart, G. Berlin, 2014, pp. 145-158. (Eds.): Innovationsprozesse zyklenorientiert mana- ■ Pötter, T.; Folmer, J.; Vogel-Heuser, B.: Enabling gen – Verzahnte Entwicklung von Produkt-Service Industrie 4.0 – Chancen und Nutzen für die Pro- Systemen. Springer Verlag, Berlin, 2014. zessindustrie. In: Bauernhansl, T.; ten Hompel, M.; Vogel-Heuser, B. (Eds.): Industrie 4.0 in Produktion, Automatisierung und Logistik, Springer Verlag, Berlin, 2014, pp. 159-171. ■ Pötter, T.; Vogel-Heuser, B.; Pantförder, D.: Vorteile von Industrie 4.0 für die Prozessindustrie. In: Früh, K.F.; Maier, U.; Schaudel, D. (Eds): Handbuch der Prozessautomatisierung, DIV Deutscher Industrie- verlag GmbH, 2014, pp. 45–56. Institute of Automation and Information Systems 205 Institute of Metal Forming and Casting 2TQEGUUCPFOCVGTKCNSWCNKƄECVKQPHQTOGVCNHQTOKPIDNCPMKPICPFECUVKPI ■ The Institute of Metal Forming and Casting focuses on the three pro- duction processes: casting, blanking and sheet metal forming. In 2013-14 over 40 scientists worked at the institute on research projects which vary from fundamental research to industrial application. Virtual production and simulation New technologies and New technologies and New technologies and RTQEGUUGUKPVJGƄGNFQH RTQEGUUGUKPVJGƄGNFQH RTQEGUUGUKPVJGƄGNFQH casting DNCPMKPI metal forming Prof. Dr.-Ing. 9QNHTCO8QNM 2TQEGUUUVCDKNKV[CPFECRCDKNKV[ Contact A highlight was the in-situ temperature The institute organized several confer- www.utg.mw.tum.de [email protected] measurement in the shearing zone during ences and workshops in 2013-14 of Phone +49.89.289.13790 the blanking process using the thermo- which the 6th Forming Technology Forum electric potential between tool and work (Herrsching) and the 2nd utg-NSMLAB piece. Another important milestone was workshop (Seoul, Korea) were highlights. the realization of a continuous composite casting process. Casting The research group ‘Casting’ focuses on: ■ Molding materials ■ Tool technology for gravity and high pressure die casting ■ Continuous casting ■ Residual stresses and material charac- terization In the casting industry, especially in the area of light metal casting, inorganic binder systems replace the existing orga- nic binders. This provides economic and environmental advantages but requires a rethinking of well-known processes. Another trend in the automotive industry is the use of die cast structure parts replac- ing sheet metal parts. Due to their highly complex geometries extensive research in 3D-Coreprinter VJGƄGNFQHVQQNFGUKIPKUTGSWKTGF Continuous casting is a well-known in materials science. For instance the production process. Our research here development of residual stresses during focuses on the developement of a cont- the cooling process of a cast part or the inous compound casting process which phase transformation kinetics in austem- saves production steps. pered ductile iron is investigated in-situ The neutron source FRMII situated near using neutron diffraction. the institute offers enormous possibilities 206 Institute of Metal Forming and Casting Projects ■ In-situ analysis of residual stresses ■ Designing of crashworthy vehicle struc- in composite castings using neutron tural components made from aluminum diffraction (DFG) die-casts (BMW Landshut) ■ In-situ measurement of deformation ■ Development of a methodology for the induced formation of martensite in advanced design of cooling systems in austempered ductile iron (ADI) (DFG) JKIJRTGUUWTGFKGECUVKPIFKGU +0+67/ ■ Optimization of surface activation for ■ 'PGTI[CPFOCVGTKCNGHƄEKGPV thermally sprayed cylinder bores (BMW production of copper bilayer strips Landshut) WUKPIEQORQWPFECUVKPI &$7 ■ Š('CPFUGPUKVKXKV[CPCN[UKU $(5 ■ (14241sGHƄEKGPVRTQFWEVCPF ■ 3D printing of inorganic sand molds for process development by knowledge- ECUVKPICRRNKECVKQPU &$7 based simulation (BFS) ■ *KIJN[KPPQXCVKXGRTQFWEVKQPQHGHƄEKGPV radial bearings (FFG) $NCPMKPI The research group ‘Blanking’ focuses on: In the automotive industry highly-tensile ■ Enhanced understanding of blanking steels are increasingly used. For the processes improvement of the edge-crack sensi- ■ Wear of blanking tools tivity, especially for these steels broad ■ Optimization of materials and part- research efforts are made. The blanking of quality organically coated metal sheets is widely In the sheet metal industry, blanking TGXKGYGFRCTVKEWNCTN[FWGVQVJGKPƅWGPEG is a widely used process in all kinds of of oxidative wear of the tools and corro- enterprises. To ensure the economic and sion-resistance of the sheared edges. technological forthcoming, fundamental CPFKPFWUVTKCNTGUGCTEJQPVJKUƄGNFKU Projects necessary. ■ Burr-free sheared edges (AiF) Recently a method to measure the ■ Development of a software-tool for the temperature in the shearing zone during a robust design of the shearing process blanking process in-situ and and instanta- of metallic multilayer materials without neous was established. additional lubricant (DFG) To improve the lifetime of punching dies, ■ Dry punching of coated metal sheets the connection to the tool was the subject (AiF) of large analyses. Acoustical adjustment ■ Improvement of the formability of shea- of the dies could lead to higher durability. red egdes of iron-manganese metal Cutting tool (left: top part, Another project focuses on how to diminish sheets through optimized punching right: bottom part) wear on the tools of a stamping process parameters (AiF) D[URGEKƄEXQNVCIGCRRNKECVKQP7PFGTVJG ■ +PƅWGPEGQHRTQEGUUTGNCVGFCNVGTKPI KPƅWGPEGQHNCVGTCNHQTEGUFWTKPIVJGUVCO- die clearance on tool wear (FOSTA ping process the die clearance is altering, Stahlanwendung e.V.) which can rise wear. Hence another project ■ In-situ temperature measurement while is dealing with the issue how to increase shearing (DFG) the stiffness of the stamping tool to prevent ■ Lubricant-free forming by affecting altering of the die clearance. thermoelectric currents (DFG) Burr at blanked products is an undesirable ■ Optimization of die connections in property. For this reason an innovative punching tools (AiF) tool concept is developed, which leads to ■ Process enhancement for the applica- burrfree sheared edges. tion of high-tensile steels (AiF) Institute of Metal Forming and Casting 207 Metal Forming The research group ‘Metal Forming’ Projects focuses on: ■ Automated copied driving – analysis ■ Machinery and cataloging of components and ■ Processes manufacturing strategies (AiF) ■ Geometry of components ■ Automated production of 2D sheet ■ Materials metal components by driving (DFG) Increasing product standards and inten- ■ Connection optimization of progressive sifying cost pressure reveals the need for components (AiF) improvement of machines and processes. ■ Extended length of bending compo- In the case of forming technologies, the nents – optibend (BFS) latter accompanies research activities in ■ Mechanical high speed press with VJGƄGNFUQHEQORQPGPVIGQOGVT[CPF linkage transmission (AiF) Kinematics of a high speed press materials. Therefore, new or existing ■ +PƅWGPEGQHVJGDGPFKPIXGNQEKV[QP processes are developed to be able to the springback and the mechanical meet industrial requirements. properties of Mg sheets using technical Developing new drives for presses or processing (DFG) investigating the dynamics of forming ■ Optimization of the properties of roller VQQNUCNNQYUQPGVQKPƅWGPEGRTQEGUU clinched joints (DFG) characteristics and to adapt the process ■ Prevention of springback for structural to the increasing requirements. Processes components (AiF) like automated driving or roller clinching ■ 2TGXGPVKQPQHUWTHCEGFGƅGEVKQPUHQT reduce process times and increase the sheet metal parts (AiF) automation level. Research activities ■ Texture optimization for the improve- addressing the geometry of components ment of forming and mechanical NGCFVQFGUKIPUHQTUKORNKƄGFOCPWHCEVWT properties of Mg sheets using technical ing, smaller reachable tolerances and less processing FGƄEKGPVRTQFWEVU6JGEJCTCEVGTK\CVKQP and optimization of material properties are topics essential for the comprehen- sion and improvement of every forming process. 208 Institute of Metal Forming and Casting Research Focus Management ■ Industrial engineering Prof. Dr.-Ing. Wolfram Volk, Director ■ Tool design Prof. i.R. Dr.-Ing. Hartmut Hoffmann, ■ Engineering and planning processes Emritus Competence Adjunct Professors ■ Process chain car body sheet Prof. Dr.-Ing. Walter Wohnig ■ Alternative metal forming processes for Prof. Dr. Horst-Henning Wolf small batch production and prototyping Dr.-Ing. Wolfgang Blümlhuber ■ Cutting surface quality, wear, accuracy Dr.-Ing. Carsten Intra ■ Tool technology ■ Molding materials Administrative Staff ■ Continuous casting Bettina Böhm ■ Residual stress analysis and material Karin Engels characterization Research Scientists Infrastructure Dr.-Ing. Roland Golle ■ Hydraulic press, high speed punching Prof. Dr.-Ing. Matthias Golle press, triple-action blanking press Dipl.-Ing. Robert Ramakrishnan ■ 3D printer for inorganically bound core Dipl.-Ing. Georg Baumgartner sands Dipl.-Ing. Martin Bednarz ■ Measurement instrumentation (residual Dipl.-Ing. Tim Benkert stresses, surface, geometry, mechani- ETH Ole Böttcher, M.Sc. cal properties, …) Dr.-Ing. Quanji Cai ■ Various tools (cold and heated) Wan-gi Cha, M.Sc. ■ Stamping and bending machine Daniel Einsiedler, M.Eng. ■ Rotational cutting line Dipl.-Ing. Martin Feistle ■ Casting equipment Christian Gaber, M.Sc. ■ Craftformer Dipl.-Ing. Benjamin Griebel ■ Core blowing machine (from 2015) Tobias Hammer, M.Sc. ■ Workshop Florian Heilmeier, M.Sc. Dipl.-Ing. Sven Jansen Courses Dipl.-Ing. David Jocham ■ Principles of Engineering Design and Dipl.-Ing. Thomas Kopp Production Systems Dipl.-Ing. Michael Krinninger ■ Basics of Casting and Metal Forming Simon Maier, M.Sc. (from winter semester 2014-15) Dipl.-Ing. (FH) Josef Mair ■ Metal Forming (until winter semester Tim Mittler, M.Sc. 2014-15) Dipl.-Ing. Christoph Nerl ■ Metal Forming Machines (GTFKPCPF0GWOC[GT/5E 67/ ■ Virtual Process Design for Metal Dipl.-Math. Daniel Opritescu Forming and Casting Dipl.-Ing. Manuel Pintore ■ Casting and Rapid Prototyping Dipl.-Ing. Carolin Ranft ■ Manufacturing Technologies Dipl.-Ing. Matthias Reihle ■ Marketing Engineering and Purchasing Dipl.-Ing. Patrick Saal ■ Production Management in the Com- Dipl.-Ing. Peter Sachnik mercial Vehicle Sector Dipl.-Ing. Sven Schreyer ■ Development of Car Body Parts Marco Stüber, M.Eng. ■ Casting in Vehicle Construction Joungsik Suh, M.Sc. Philipp Tröber M.Eng. Dipl.-Ing. Simon Vogt Dipl.-Ing. Annika Weinschenk Hannes Weiss, M.Sc. Institute of Metal Forming and Casting 209 Dipl.-Ing. Maria Weiß Technical Staff Dipl.-Ing. Martin Wimmer Corinna Sutter Dipl.-Ing. Patrick Woisetschläger Tim Schönstädt Dipl.-Wirt.-Ing. Thorsten Gläsner, external Marco Olbrich-Baier Dipl.-Ing. Michael Hörning, external Andreas Fuhrmann Dipl.-Ing. Oliver Steibing, external Philipp Mair Dipl.-Ing. Peter Sterionow, external 2WDNKECVKQPU ■ Demmel, P.; Pazureck, A.; Golle, R.; Volk, W.; ■ 4GKJNG/ *QHOCPP/ 9CUOWVJ7 8QNM9 Hoffmann, H.: Characterization of the thermoelec- Hoffmann, H.; Petry, W.: In-situ strain measure- tric behavior of plastically deformed steels (2013). ments during casting using neutron diffraction ,QWTPCNQH'NGEVTQPKE/CVGTKCNU RR| /CVGTKCNU5EKGPEG(QTWORR| 2375. 491. ■ Demmel, P.; Tröber, P.; Kopp, T.; Golle, R.; Volk, W.; ■ Rill, D.; Weiß, M.; Hoffmann, H.; Volk, W.: Simulation Hoffmann, H.: Characterization of the thermoelectric CUUKUVGFCPCN[UKUQHOCVGTKCNƅQYKPTQNNGTENKPEJGF behavior of plastically deformed steels by means joints (2014). Advanced Materials Research, 966- QHTGNCVKXG5GGDGEMEQGHƄ\KGPV /CVGTKCNU 967, pp. 628-640. Science Forum, 755, pp. 1-7. ■ Sachnik, P.; Volk, W.; Golle, R.; Hoffmann, H.: ■ Gläsner, T.; Sunderkötter, C.; Plath, A.; Bednarz, 6JGKPƅWGPEGQHVGORGTCVWTGQP\KPECDTCUKQPKP M.; Volk, W.; Hoffmann, H.; Golle, R.: Methods deep drawing processes (2014). Key Engineering to decrease cut edge sensitivity of high strength Materials, 611-612, pp. 1039-1046. steels (2014). Key Engineering Materials, 611-612, ■ Schöbel, M.; Baumgartner, G.; Gerth, S.; Bernardi, RR| J., Hofmann, M.: Microstresses and crack formation ■ Hippmann, S.; Li, Q.; Addinal, R.; Volk, W.: Carbon in AlSi7MgCu and AlSi17Cu4 alloys for engine com- nanotubes-reinforced copper matrix composites ponents (2014). Acta Materialia, 81, pp. 401-408. produced by melt stirring (2013). Proceedings of the ■ Steentjes, S.; Franck, D.; Hameyer, K.; Vogt, Institution of Mechanical Engineers, Part N: Journal S.; Bednarz, M.; Volk, W.; Dierdorf, J.; Hirt, G.; of Nanoengineering and Nanosystems, 227 (2), Schnabel, V.; Mathur, H. N.; Korte-Kerzel, S.: On RR| the Effect of Material Processing: Microstructural ■ -KNKE' 5KCTV7 9KGFGPOCPP1 (C\7 4COC- and Magnetic Properties of Electrical Steel Sheets krishnan, R.; Saal, P.; Eibert, T.F.: Cavity Resonator (2014). 4th International Conference on Electric Measurement of Dielectric Materials Accounting Drive Production, EDPC 2014 – Proceedings, for Wall Losses and a Filling Hole (2013). IEEE RR| Transactions on Instrumentation and Measurement, ■ Thoma, C.; Volk, W.; Heid, R.; Dilger, K.; Branner, 62(2), pp. 401-407. G.; Eibisch, H.: High-Pressure Die Casting (HPDC), ■ Kuppert, A.; Merklein, M.; Friebe, H.; Möller, T.; UKOWNCVKQPEQORWVCVKQPCNƅWKFF[PCOKEU %(& *QV\9 8QNM9 +PƅWGPEGQHUVTCVGI[QHGXCNWC- correlation of mechanical properties, quality predic- tion on forming limit curve (2013). Materialpruefung/ tion (2014). International Journal of Metalcasting, 8, Materials Testing, 55 (9), pp. 668-672. pp. 47-54. ■ Mair, J.; Canti, R.; Golle, R.; Volk, W.; Hoffmann, H.: ■ Volk, W.; Kim, J.K.; Suh, J.; Hoffmann, H.: Anisotro- Dynamic strength behaviour of punch connections pic plasticity model coupled with strain dependent in shear cutting processes (2013). Key Engineering plastic strain and stress ratios (2013). CIRP Annals Materials 549, pp. 262-269. – Manufacturing Technology, 62 (1), pp. 283-286. ■ Meier, L.; Hofmann, M.; Saal, P.; Volk, W.; Hoffmann, ■ Volk, W.; Suh, J.: Prediction of formability for non- H.: In-situ measurement of phase transformation linear deformation history using generalized forming kinetics in austempered ductile iron (2013). Mate- limit concept (GFLC) (2013). AIP Conference rials Characterization, 85, pp. 124-133. Proceedings, 1567, pp. 556-561 ■ Nerl, C.; Wimmer, M.; Hoffmann, H.; Kaschnitz, E.; ■ 9KGFGPOCPP1 4COCMTKUJPCP4 5CCN2 -ĎNĎà Langbein, F.; Volk, W.: Development of a continuous ' 5KCTV7 'KDGTV6( 8QNM9 .QECNOKETQYCXG composite casting process for the production of heating of sand molds as a means to overcome bilayer aluminium strips (2014). Journal of Materials design limitations in sand mold casting (2014). Processing Technology, 214 (7), pp. 1445-1455. Advances in Radio Science, 12, pp. 21-28. ■ Ramakrishnan, R.; Griebel, B.; Volk, W; Günther, D.; ■ Weinschenk, A.; Volk, W.: Decrease of Springback Günther, J.: 3D Printing of Inorganic Sand Moulds D[)GQOGVTKECN/QFKƄECVKQPQHVJG5JGGV/GVCN for Casting Applications (2014). Advanced Materials Part (2014). Advanced Materials Research, 1018, Research, 1018, pp. 441-449. RR| 210 Institute of Metal Forming and Casting Institute of Internal Combustion Engines Engine design and simulation, combustion technologies, and experimental evaluation ■ The focus of the Instiute of Internal Combustion Engines in 2013-14 was to connect theoretical and experimental methods of thermodynamic research on combustion processes. Optical measurement techniques CTGCRQYGTHWNYC[QHXKUWCNK\KPIICUƅQYHWGNKPLGEVKQPCPFEQODWUVKQP inside the cylinder of engines. High temperatures and pressures are challenges for the construction of optically accessible engines. #JKIJNKIJVYCUVJGEQORNGVKQPCPFƄTUV operation of a new 0.5 l single cylinder research engine with full optical accessi- bility through the piston bowl and piston liner. The engine offers fully variable valve Prof. Dr.-Ing. train and various gasoline combustion Georg Wachtmeister modes including conventional port fuel injection and direct injection with spark Contact ignition or homogenous charge com- www.lvk.mw.tum.de pression ignition (HCCI). The results are [email protected] used to validate CFD calculations of gas Phone +49.89.289.24101 ƅQYKPLGEVKQPCPFEQODWUVKQPKPQTFGT to predict the in-cylinder processes. This helps to save time and costs for future LVK 0.5 l optical single cylinder engine with laser sheet developments. CPFICUQNKPGƅCOGNWOKPGUEGPEG The launch of a new 5 l optical engine operated with natural gas is scheduled for 2015. Combustion Technologies – CFD-Simulation – Emission Reduction – Injection Technology The reduction of engine emissions and fuel consumption are drivers for the improvement of combustion technology. Engines for gasoline, diesel and natural gas are developed and build at the Institute and are available for industrial or public-funded research projects. A key competence for the realisation of our engine concepts is the application of professional CFD simulation software, which is used to predict and optimize the gas exchange phase, in-cylinder swirl, tumble or turbulence and the phases of fuel injection, mixture formation and combustion. Simulation results are used to design improved geometries of the combustion chamber or injector nozzles and are then validated on one of our 13 engine test benches. Engine out emissions %(&ECNEWNCVKQPQHKPLGEVKQPRTQEGUU are measured by means of up-to-date FTIR technology and a modern particle Institute of Internal Combustion Engines 211 counting system. We use separate test ■ $(5RTQLGEVn'HƄ\KGP\UVGKIGTWPIXQP benches to evaluate hydraulic behaviour Dual Fuel-Motoren bei Mitteldrücken and spray parameters of fuel injectors. > 24 bar’ Simulative and experimental tools allow ■ BFS project ‘Messung und Berechnung fast and effective optimization of both FGU&ØUGPFWTEJƅWUUGUo GOKUUKQPDGJCXKQWTCPFGPIKPGGHƄEKGPE[ ■ BMWi project ‘Methodik’ Test runs on the research engines are ■ StaMWi project ‘OPTIMAL’ planned and evaluated with statistical ■ DFG project ‘Optimierung des Ein- methods (design of experiments, DOE) spritzverhaltens von Dieselinjektoren to reduce time and costs for the testing WPVGTFGO'KPƅWUUXQP#NVGTWPIUGT- procedure. scheinungen des Injektors’ ■ FVV/AiF project ‘Spritzlochgeometrie’ Projects ■ Several projects funded by industry ■ FNR project ‘CH4 Emissionen’ partners ■ FVV project ‘THC Emissionen’ Friction Measurement – Tribology – Engine Mechanics Piston, piston rings, liner and lubricating oil form a complex tribological system. A large range of relative velocities, pressures and temperatures have to be covered while the combustion chamber has to be sealed reliably. Friction has to be reduced as far as possible to avoid mechanical losses. A new research engine containing a OGCUWTGOGPVU[UVGOWUKPIVJGƅQCVKPI liner method has been developed at the Institute and has been successfully CRRNKGFWPFGTƄTGFEQPFKVKQPU+VCNNQYU 4GUGCTEJGPIKPGYKVJHTKEVKQPOGCUWTGOGPV ƅQCVKPI to measure the friction forces between liner) liner and piston precisely and can be used to optimize geometries, materials, and Projects surface treatments. ■ FVV/AiF project ‘Kolbenring-Öltrans- A second research engine has been built port” at the Institute that contains several sen- ■ FVV/AiF project ‘Fuel in Oil” sors to determine secondary movements ■ FNR project ‘Ablagerungsbildungs- of the piston and the piston rings as mechanismen’ well as the thickness of the oil layer in ■ DFG project ‘Entwicklung eines kosten- the friction combination with the liner. u. verbrauchsgünstigen Split-Verbren- This equipment allows to optimize the nungsmotors’ tribological system and helps to reduce ■ Several projects funded by industry the introduction of oil into the combustion partners chamber or the transport of fuel into the lubricating oil. 212 Institute of Internal Combustion Engines Alternative Fuels – Emission Measurement – Energy Management Test bench with heavy-duty engine Fossil fuels are becoming more and more scarce and european CO2 saving RQNKEKGUJCXGDGGPKPVTQFWEGFVQƄIJV global warming. Combustion engines can Ultra-low soot emissions with alternative diesel fuel reduce their output of GHG emissions and contribute to the transition towards alter- we help to improve such measurement PCVKXGGPGTI[D[GPJCPEKPIVJGGHƄEKGPE[ techniques. of energy conversion and by exploiting #PQVJGTƄGNFQHQWTTGUGCTEJKUVJG CO2 neutral primary energies. Sustainable utilisation of thermodynamic losses from biofuels and synthetic fuels can replace coolant or exhaust. The thermodynamic HQUUKNHWGNUCPFQHHGTVJGCFFKVKQPCNDGPGƄV rankine cycle for instance allows to of clean combustion. harvest enthalpy from hot exhaust gas A detailed screening of various oxygen and produce electric power by means of a containing synthetic fuels was carried steam turbine. out at the Institute and oxymethylenether (OME1) was found to burn without particle Projects emissions in a diesel engine even under ■ BFS project ‘Emissionsreduktion durch unfavourable operating conditions. erneuerbare Kraftstoffanteile” Modern methods for the measurement of ■ FVV project ‘H2 Zumischung Erdgas’ ultra-low particle emissions are needed for ■ FVV project ‘PN-Messverfahren’ this and other advanced engine concepts. ■ Several projects funded by industry Cooperating closely with the industry, partners Institute of Internal Combustion Engines 213 Research Focus Dipl.-Ing. Daniel Engelsmann (until 01/13) ■ Combustion technologies Stephan Gleis, M.Sc. (since 11/14) ■ Gas engines Dipl.-Ing. Stefan Graf ■ Friction measurement Dipl.-Ing. Johannes Halbhuber (since 08/13) ■ Fuel injection technologies Dipl.-Ing. Alexander Heubuch (until 11/13) ■ Alternative fuels and biofuels Dipl.-Ing. Benedikt von Imhoff ■ Exhaust gas aftertreatment and Dipl.-Ing. Claus Kirner measurement Dipl.-Ing. Christian Daniel Koch (since 12/14) Dipl.-Ing. Benjamin Korb Competence Dipl.-Ing. Robert Kudicke (until 05/14) ■ CAD construction Dipl.-Ing. Qixong Li ■ CFD calculation Dipl.-Phys. Thomas Maier ■ Thermodynamic simulations Dipl.-Ing. Andre Merkle (until 06/13) ■ Hydraulic simulations Dipl.-Ing. Alexander Oliva ■ Mechanical simulations Dipl.-Ing. Christian Pastötter (until 09/13) ■ Engine measurement techniques Dipl.-Ing. Johann Peer Dominik Pélerin, M.Sc. (since 03/14) Infrastructure Dipl.-Ing. Christian Pötsch ■ Engine test rigs (13) Dipl.-Ing. Sebastian Rösler ■ Gasoline, diesel and gas engines (>15) Dipl.-Ing. Franz Schauer (until 01/13) ■ Injection test rigs (2) Carsten Schneider, M.Sc. (since 05/13) ■ Optical and laser diagnostics Dipl.-Ing. Alexander Schröder (since 11/14) ■ Mechanical workshop Dipl.-Ing. Sebastian Schuckert ■ Electronic workshop Dipl.-Ing. Florian Schwarzmüller (until 12/13) Dipl.-Ing. Fabian Schweizer (since 05/14) Courses Dipl.-Ing. Philipp Seidenspinner (until 01/14) ■ Combustion Engines Dipl.-Ing. Richard Stegmann ■ Engine Thermodynamics Dipl.-Ing. Benedict Uhlig ■ Mechanics of Combustion Engines Dipl.-Ing. Stefan Weber ■ Methods of Engine Calibration Dr.-Ing. Martin Werner (until 04/13) ■ Injection Technology Dipl.-Ing. Johann Wloka (until 04/14) ■ Measurement Techniques Dipl.-Ing. Sebastian Wohlgemuth ■ Several Practical Courses Dipl.-Ing. Katrin Wülfert (until 06/13) Dipl.-Ing. Thomas Zimmer Management Sebastian Zirngibl, M.Sc. (since 08/14) Prof. Dr.-Ing. Georg Wachtmeister Dr.-Ing. Maximillian Prager Technical Staff Dipl.-Ing. Martin Härtl Dipl.-Ing. Frank Bär Martin Daniel Adjunct Professors Dipl.-Ing. Christian Hödl Dr. Satoshi Kawauchi (since 04/14) Mike Ostrowski (until 10/13) Patrick Ottiger Administrativ Staff Johann Schuster Marita Weiler Ferdinand Springer Sonja Zeilhofer Werner Straßer Edgar Thiele Research Scientists Dipl.-Ing. Ulrich Tetzner Dipl.-Ing. Fabian Backes Markus Weiß Dipl.-Ing. Laura Baumgartner (since 01/13) Dipl.-Ing. Johannes Bergmaier (until 01/14) Trainees Dipl.-Ing. Michael Bernath (until 12/13) Philipp Hell Dipl.-Ing. Yves Compera (since 01/13) Daniel Höchtl (until 04/13) Robert Dohle, M.Sc. (since 11/14) Fabiano Palfner da Paz (since 09/14) 214 Institute of Internal Combustion Engines Publications 2013-14 ■ Backes, F.; Oryoji, K.; Wachtmeister, G. (2013): ■ Korb, B.; Zimmer, Th. (2013): Automatisierte 3D-CFD-simulation of Auto-Ignition in a Gasoline Prüfstandssteuerung eines Einzylinderforschungs- HCCI Engine with Detailed Reaction Kinetics. motors. National Instruments User Report. In: Journal of Society of Automotive Engineers of ■ -WFKEMG4 9CEJVOGKUVGT) -PCƅ# 5VKGUEJ Japan 67 (9), pp. 45-49. G. (2013): Energy Management for Large-Bore, ■ $GTIOCKGT, 9CEJVOGKUVGT) (KUEJGT2 2ƅCWO Medium Speed Diesel Engines. In: 27th CIMAC H.; Stahl, K. (2014): Split-crankshaft engine: World Congress 2013. concept for a combustion engine with a two-piece ■ Maier, Th.; Kiwull, B.; Wolf, J.; Wachtmeister, G.; disengageable crankshaft. In: 14. Internationales Nießner, R. (2013): PN-Messverfahren: Untersu- Stuttgarter Symposium ‘Automobil und Motoren- chung und Bewertung verschiedener Methoden technik’. FKFS. der Partikelanzahl-Messung. Abschlussbericht. ■ Bernath, M.; Swoboda, J.; Ille, Th.; Wachtmeister, Forschungsvereinigung Verbrennungskraftmaschi- G. (2014): Dynamic Vehicle Model for the Systems nen. Engineering of Thermal Management and Waste ■ Maier, Th.; Wachtmeister, G. (2014): Particle Num- Heat Recovery Concepts on Commercial Vehicles. ber Measurement Techniques: PMP particle number In: FISITA 2014 World Automotive Congress counting methodology, PMP-HD measurement sys- Conference. tem comparison. In: 14. Internationales Stuttgarter ■ Bernath, M.; Swoboda, J.; Karl, C. (2013): Symposium ‘Automobil und Motorentechnik’. FKFS. Simulationsmethodik zur Wärmerekuperation für ■ Maier, Th.; Wachtmeister, G. (2014): Systemver- Nutzfahrzeuge. Abschlussbericht. Bayerische gleich zur PMP-Partikelanzahlbestimmung. In: Forschungsstiftung. MTZ Motortech Z 75 (6), pp. 68-75. DOI: 10.1007/ ■ Graf, S.; Wachtmeister, G. (2013): Messung der s35146-014-0369-6. Kolbengruppenreibung – Herausforderungen und ■ Maus, W.; Jacob, E.; Härtl, M.; Seidenspinner, P.; Erkenntnisse. In: 11. Symposium Trends in der Wachtmeister, G. (2014): Synthetische Kraftstoffe Motorentechnologie. Bayern Innovativ. – OME1: Ein potentiell nachhaltig hergestellter ■ Halbhuber, J.; Werner, M.; Fröhlich, S.; Wachtmeis- Dieselkraftstoff. In: Hans Peter Lenz (Hg.): 35. Inter- ter, G. (2013): Entwicklung eines Schwingensystems nationales Wiener Motorensymposium. Düsseldorf: zur Übertragung von Messdaten der Kolbentempe- VDI-Verl. (Nr. 777), pp. 325-347. ratur mit Hilfe gekoppelter MKS/FEM Simulation. In: ■ Oliva, A.; Held, S. (2014): Meshing-Methodenent- ANSYS Conference & 31. CADFEM Users’ Meeting. wicklung für die CFD-Berechnung der Strömung ■ Härtl, M.; Pastötter, Ch.; Seidenspinner, Ph.; Jacob, durch das Kolbenringpaket eines Verbrennungs- E.; Maly, M.; Wachtmeister, G. (2014): Emissions- motors. In: Advanced Simulation Technologies reduktion durch erneuerbare Kraftstoffanteile. Konferenz. AVL. Abschlussbericht. Bayerische Forschungsstiftung. ■ Oliva, A.; Wachtmeister, G. (2014): Fuel in Oil – Teil- ■ Härtl, M.; Seidenspinner, P.; Jacob, E.; Wachtmeis- projekt S2: Entwicklung einer Simulationsmethode ter, G. (2014): Synthetischer Dieselkraftstoff OME1. zur Berechnung der auftretenden Phänomene im .ÒUWPIUCPUCV\HØTFGP Institute of Internal Combustion Engines 215 ■ Rösler, S.; Fischer, P. (2014): Erweiterung des ■ Wloka, J. A.; Schwarzmüller, F.; Wachtmeister, G. aktiven Downsizings durch das Splitmotor-Kon- (2013): Investigations on injection-rate oscillations \GRV+P 'HƄ\KGP\KO#PVTKGDUUVTCPIs6TGPFUWPF in common-rail injectors for high-pressure injection. Herausforderungen. Bayern Innovativ. In: 27th CIMAC World Congress 2013. ■ Schauer, F. X.; Zimmer, Th.; Bachhuber, M.; ■ Wloka, J. A.; Wachtmeister, G. (2013): Macroscopic Scheller, M.; Yamasaki, Y.; Oryoji, K.; Wacht- and Microscopic Spray Pattern for High Pressure meister, G. (2013): Development of a Model-Based Common-Rail Diesel Injection. In: Journal of Society HCCI Con trol Strategy for an Engine with a Fully of Automotive Engineers of Japan 67 (9), pp. 50-55. Variable Valve Train. In: SAE International. DOI: ■ Wohlgemuth, S.; Meiland, L.; Wachtmeister, G.; 10.4271/2013-01-1667. Fledersbacher, P. (2014): Turbocharging of a ■ Schneider, C.; Klumpp, P.; Wachtmeister, G. (2014): Two-cylinder Lean-Burn Natural Gas Engine with Simulation von Festkörper- und Mischreibung Uneven Firing Order. In: SAE International. DOI: in Gleitlagern. In: 3. Györer Tribologie Tagung. 10.4271/2014-01-1652. Széchenyi István Universität. ■ Wohlgemuth, S.; Roesler, S.; Wachtmeister, G. ■ Schwarzmüller, F.; Wachtmeister, G. (2013): (2014): Piston Design Optimization for a Two- Entwicklung eines einfachen Werkzeuges auf Cylinder Lean-Burn Natural Gas Engine – 3D-CFD- Basis empirischer und physikalischer Ansätze Simulation and Test Bed Measurements. In: SAE zur Vorausberechnung der Kenngrößen eines International. DOI: 10.4271/2014-01-1326. Einspritzstrahls in Abhängigkeit der Düsengeomet- ■ Wohlgemuth, S.; Wachtmeister, G. (2013): Hydrop- rie, der Zuströmbedingungen und der Zustände im neumatic storage technology for hybrid passenger Brennraum unter Berücksichtigung dynamischer cars. In: 3rd International Electric Drives Production Vorgänge. Abschlussbericht. Forschungsvereini- Conference (EDPC). IEEE, pp. 1-7. gung Verbrennungskraftmaschinen. ■ Wohlgemuth, S.; Wachtmeister, G. (2013): Optimie- ■ Schwarzmüller, F.; Wachtmeister, G. (2013): Nume- rung des Magerbrennverfahrens eines Zweizylin- TKECNUVWFKGUQHKPƅWGPEGQHIGQOGVT[QPVJGPQ\\NG der-Erdgasmotors mittels 3D-CFD-Simulation und ƅQYCPFVJGURTC[QHCEQOOQPTCKNKPLGEVQT+P #8. Prüfstandsmessung. In: H. Eichlseder (Hg.): 14. Advanced Simulation Technologies International Tagung ‘Der Arbeitsprozess des Verbrennungsmo- User Conference. tors’. TU Graz. ■ Schwarzmüller, F.; Wachtmeister, G. (2013): ■ Wohlgemuth, S.; Wachtmeister, G. (2013): Spritzlochgeometrie, Numerik. Bericht zum Zweizylinder-Erdgasmotor und Hydraulikhybrid – Software-Workshop. Forschungsvereinigung ein kostengünstiger Antriebsstrang. In: 8. Tagung Verbrennungskraftmaschinen. Gasfahrzeuge – Antrieb mit Zukunft. ■ Seidenspinner, Ph.; Wachtmeister, G.; Wilharm, ■ Wohlgemuth, S.; Wachtmeister, G.; Kloft, P. (2013): Th. (2013): Emission Analysis and Cetane Number Development of a Hydraulic Hybrid System Determination of Oxygenated Fuels in a Constant HQT7TDCP6TCHƄE+P 5#'+PVGTPCVKQPCN&1+ Volume Combustion Chamber. In: 1st International 10.4271/2013-01-1479. Conference ‘Tailor-Made Fuels from Biomass’. ■ Wülfert, K.; Schlatter, S.; Wachtmeister, G.; RWTH Aachen. Boulouchos, K. (2013): Erstellung eines phäno- ■ Seidenspinner, Ph.; Wachtmeister, G.; Wilharm, Th. menologischen Modells zur Vorausberechnung 6JG+PƅWGPEGQH(WGN#FFKVKXGUQP%GVCPG des Brennverlaufes von Gasmotoren bei extremen Number and Emissions of Diesel Fuels. In: 6th Inter- Miller/Atkinson-Betrieb. Abschlussbericht. For- national Conference on Biodiesel. Berlin. AGQM. schungsvereinigung Verbrennungskraftmaschinen. ■ ■ Wachtmeister, G.; Baumgartner, L. (2013): CO2 Yamasaki, Y.; Schauer, F. X.; Wachtmeister, G. – Treiber der Motorenentwicklung. In: 15. BAIKA (2013): Development of Dynamic Models for an Jahreskongress ‘Zulieferer Innovativ’. Bayern HCCI Engine with Fully Variable Valve-Train. In: SAE Innovativ. International. DOI: 10.4271/2013-01-1656. ■ Wachtmeister, G.; Baumgartner, L.; Korb, B. ■ Zimmer, Th.; Imhoff, B. von (2013): Student Mode- (2013): Potentiale des Biogasmotors als Beitrag ling and Implementation of a CompactRIO ECU for zur regenerativen Energieversorgung. In: Fach- a Motorcycle Engine. In: NI Week 2013. National gespräch – Biogas in der Landwirtschaft – Stand Instruments. und Perspektiven. Fachagentur Nachwachsende ■ Zimmer, Th.; Imhoff, B. von (2014): Verbrennungs- Rohstoffe. motorsteuerung für Lehre und Forschung mit ■ 9GDGT5 $CWOICTVPGT. 'KPƅWUU9CUUGT- NI CompactRIO. In: LabVIEW Anwendertreffen. stoffzumischung zum Erdgas auf den Betrieb von National Instruments. Gasmotoren. Abschlussbericht. Forschungsvereini- ■ Zimmer, Th.; Imhoff, B. von; Korb, B. (2014): gung Verbrennungskraftmaschinen. Prüfstands- und Motorsteuerung eines Thermody- ■ Werner, M.; Graf, S.; Merkle, A.; Wachtmeister, G. namikforschungsmotors an der TU München. In: (2014): Direkte Messung der Kolbengruppenrei- Automotive-Technologietag. National Instruments. bung. In: MTZ Motortech Z 75 (1), pp. 72-79. DOI: 10.1007/s35146-014-0021-5. 216 Institute of Internal Combustion Engines Institute of Computational Mechanics Application-motivated fundamental research in computational mechanics ■ The Institute for Computational Mechanics (LNM) is committed to what can best be described as cutting-edge ‘application-motivated fundamen- tal research’ in a broad range of research areas in computational mech- CPKEU#RRNKECVKQPUURCPCNNƄGNFUQHGPIKPGGTKPI OGEJCPKECNCGTQURCEG EKXKNEJGOKECN CPFVJGCRRNKGFUEKGPEGU With a strong basis in both computational RWVKPIU[UVGOU/GCPYJKNGVJGTGUGCTEJ UQNKFCPFƅWKFF[PCOKEUVJGEWTTGPVHQEWU activities at LNM also include optimization, NKGUQPOWNVKƄGNFCPFOWNVKUECNGRTQDNGOU KPXGTUGCPCN[UKUWPEGTVCKPV[SWCPVKƄECVKQP CUYGNNCUQPEQORWVCVKQPCNDKQGPIKPGGT CUYGNNCUGZRGTKOGPVCNYQTM+PEQNNCDQTC- ing. In all these areas, LNM covers the VKQPYKVJNGCFKPITGUGCTEJGTUYQTNFYKFGCU full spectrum from advanced modeling YGNNCUPCVKQPCNCPFKPVGTPCVKQPCNKPFWUVTKCN Prof. Dr.-Ing. and the development of novel computa- partners, LNM expedites projects at the Wolfgang A. Wall VKQPCNOGVJQFUVQUQRJKUVKECVGFUQHVYCTG front-line of research. For more details and development and application-oriented WRFCVGFKPHQTOCVKQPYGMKPFN[CUM[QWVQ Contact simulations on high performance com- XKUKVQWTYGDRCIG 34EQFGDGNQY YYYNPOOYVWOFG UGMTGVCTKCV"NPOOYVWOFG Phone +49.89.289.15300 Computational Multiphysics – Coupled and Multiscale Problems 6YQRJCUGƅQY DWDDNGKPCVWTDWNGPVEJCPPGNƅQY The interaction of different physical And also the interplay of effects on phenomena plays an essential role in most different scales plays an important role in engineering applications. The modeling OCP[UEKGPVKƄECPFGPIKPGGTKPICRRNKEC- of such multiphysics problems is one tions. Therefore, there has been increasing of our main areas of research. We have interest in modeling so-called multiscale FGXGNQRGFTQDWUVCPFGHƄEKGPVOQFGNKPI phenomena both mathematically and approaches and computational methods computationally. We tackle multiscale pro- for various coupled problems. Those pro- blems both in CSD and CFD. While in the DNGOENCUUGUEQORTKUGCQƅWKFUVTWEVWTG ƄTUVITQWRQPGHQEWUKUQPVJGOQFGNKPI interaction, electro-chemical, thermo- of heterogeneous materials, in the second (NWKFUVTWEVWTGKPVGTCEVKQP mechanical, opto-acoustic, coupled re - ITQWRVJGHQEWUKUQPVWTDWNGPVƅQYUCPF ƅQYCTQWPFCƅGZKDNGUVTWEVWTG CEVKXGVTCPURQTVRQTQƅWKFVTCPURQTVCPF EQORNGZƅWKFU VJGTOQƅWKFUVTWEVWTGEQPVCEVKPVGTCEVKQP problems. Institute of Computational Mechanics 217 Computational Solid – Structural and Fluid Dynamics discretization methods in the context of ƄPKVGFGHQTOCVKQPUCPFPQPOCVEJKPI meshes/non-conforming interfaces. Lately, this main focus has been successfully GZVGPFGFVQYCTFUEQPVCEVYKVJYGCT coupled thermo-mechanical contact and beam-to-beam contact. Furthermore, UVTQPIN[EQWRNGFƅWKFUVTWEVWTGKPVGTCE- VKQP (5+ YKVJEQPVCEVKUCPQVJGTEWTTGPV Computational structural and solid TGUGCTEJƄGNF F[PCOKEU %5& KUQPGQHVJGENCUUKECN %QORWVCVKQPCNƅWKFF[PCOKEU %(& KU 6WTDWNGPVXCTKCDNGFGPUKV[ƅQY EQTGFKUEKRNKPGUYKVJKPVJGHCUVITQYKPI the other core discipline in computational over a backward facing step with ƄGNFQHEQORWVCVKQPCNOGEJCPKEU1WT OGEJCPKEU9GCTGQPGQHVJGXGT[HGY heating research activities in computational ITQWRUYQTNFYKFGVJCVFQQTKIKPCNTGUGCTEJ structural and solid dynamics cover a KPDQVJ%5&CPF%(&1WTHQEWUKP%(&KU YKFGTCPIGQHOGVJQFUHTQOPQPNKPGCT QPKPEQORTGUUKDNGCPFYGCMN[EQORTGU- UQNKF J[DTKF('OGUJGUKUQIGQOGVTKE UKDNGƅQYU9GFGXGNQRPQXGNFKUETGVK\- CPCN[UKU CPFUVTWEVWTCNOQFGNU DGCOU CVKQPOGVJQFUHQTƅQYRTQDNGOUCUYGNN UJGNNU CPFEQTTGURQPFKPIƄPKVGGNGOGPV CUPQXGNCRRTQCEJGUHQTVWTDWNGPVƅQYU VGEJPQNQI[ '#5#05($CT VQOCVGTKCN DCUGFQPNCTIGGFF[UKOWNCVKQP .'5 CPF OQFGNKPI J[RGTGNCUVKEKV[XKUEQGNCUVKEKV[ FGVCEJGFGFF[UKOWNCVKQP &'5 #PQVJGT GNCUVQRNCUVKEKV[ CVƄPKVGUVTCKPU#PQVJGT HQEWUKUQPOWNVKRJCUGƅQYUCPFƅQYU focus are complex material phenomena EQWRNGFVQQVJGTƄGNFUNKMGKPƅWKFUVTWE- UWEJCUCPKUQVTQR[ƄDGTEQORQPGPVU ture interaction, electro-chemistry or damage, fracture and multiscale modeling reactive transport problems. of heterogeneous materials. Computational contact dynamics repre- Buckling of a cylindrical shell sent a particularly challenging class of structural mechanics problems due to the non-smooth character of the underlying NCYUQHRJ[UKEU GIPQPRGPGVTCVKQP and the strong nonlinearities introduced by the corresponding geometrical con- straints. In addition, complex interface RJGPQOGPC HTKEVKQPCFJGUKQP PGGFVQ DGVCMGPKPVQCEEQWPVYKVJUQRJKUVKECVGF computational models. Here, our research emphasizes the development of robust CPFGHƄEKGPVEQPVCEVHQTOWNCVKQPUCPF Contact of two thin-walled torii 218 Institute of Computational Mechanics Computational Bioengineering and Biophysics experts from medicine, biology or biophy- sics. Some activities are the development of a comprehensive coupled multiscale model of the respiratory system, of a model for rupture risk prediction of abdominal aortic aneurysms, compre- hensive cardiac modeling, simulation of surgical procedures or cellular modeling. +PTGEGPV[GCTUYGCNUQUWEEGUUHWNN[ GPVGTGFVJGCTGCQHDKQRJ[UKEUYJGTGYG could develop a novel, theoretically sound CPFJKIJN[GHƄEKGPVCRRTQCEJHQTVJG Developing bundles in a biopolymer network $TQYPKCPF[PCOKEUQHRQN[OGTU$CUGF QPVJKUWPKSWGCRRTQCEJYGOGCPYJKNG Coupled multiscale model of 1WTTGUGCTEJKPVJGDKQOGFKECNGPIKPGGT EQWNFUVWF[CPFCPUYGTCPWODGTQHQRGP airways in the human lung ing area includes a variety of different questions in the bio physics community. ƄGNFU+PCNNQHVJGOYGEQNNCDQTCVGYKVJ Research Code BACI 6JGEQORNGZKV[CPFUEKGPVKƄEDTQCFPGUU bly unique even from a global perspective. of the majority of our research projects $#%+KUOCKPN[DCUGFQPƄPKVGGNGOGPV make highest demands on both the OGVJQFU ('/ DWVCNUQHGCVWTGUQVJGT ‘modus operandi’ and on the research discretization techniques such as HDG, GPXKTQPOGPVKVUGNH6JKUKUYJ[.0/ particle and meshfree methods. All past YKVJKVUGPVKTGUEKGPVKƄEUVCHHFGXGNQRU and present activities at LNM have been and maintains the parallel multiphysics sCPFCNNHWVWTGRTQLGEVUYKNNDGsTGCNK\GF TGUGCTEJEQFG$#%+ $CXCTKCP#FXCPEGF YKVJKPVJKU*2%RNCVHQTO %QORWVCVKQPCN+PKVKCVKXG YJKEJKURTQDC- Research Focus Competence Further up-to-date information ■ %QORWVCVKQPCNƅWKFF[PCOKEU ■ Contact dynamics and a list of publications can be HQWPFQPQWTYGDRCIGCV ■ Computational solid and structural ■ Discretization methods dynamics ■ 'ZRGTKOGPVCN DKQ OGEJCPKEU ■ Computational contact mechanics ■ Fluid dynamics ■ Multiphysics/coupled problems ■ Fluid-structure interaction ■ Multiscale problems ■ Inverse methods ■ 4GFWEGFFKOGPUKQPCNOQFGNKPI ■ Material modeling ■ 7PEGTVCKPV[SWCPVKƄECVKQP ■ 1RVKOK\CVKQP ■ Inverse problems ■ Solid dynamics ■ 1RVKOK\CVKQP ■ Solvers/AMG ■ High performance computing ■ 6JGTOQƅWKFUVTWEVWTGKPVGTCEVKQP ■ Transport phenomena ■ 7PEGTVCKPV[SWCPVKƄECVKQP Institute of Computational Mechanics 219 Infrastructure &KRN6GEJ/CVJ)GQTI$CWGT WPVKN,CP ■ HPC cluster &KRN+PI,QPCU$KGJNGT ■ $KQOGEJCPKEUNCD KPENWFKPIWPKCZKCN #PPC$KT\NG/5E HTQO/CTEJ CPFDKCZKCNVGUVKPIOCEJKPGU &KRN+PI%CTQNKPG&CPQYUMK WPVKN,WN[ &KRN+PI#PFTGCU'JTN Courses 4WK(CPI/5E ■ 'PIKPGGTKPI/GEJCPKEU+++CPF+++ 2JKNKRR(CTCJ/5E HTQO,CP ■ 0WOGTKECN/GVJQFUHQT'PIKPGGTU ,WNKGP)KNNCTF/5E HTQO/CTEJ ■ Nonlinear Continuum Mechanics /CZKOKNKCP)TKNN/5E HTQO#WI ■ (KPKVG'NGOGPVU %GTGP)WTMCP/5E HTQO1EV ■ (KPKVG'NGOGPVUKP(NWKF/GEJCPKEU Manuel Hahn, M.Sc. ■ 0QPNKPGCT(KPKVG'NGOGPV/GVJQFU Dipl.-Ing. Georg Hammerl ■ $KQOGEJCPKEUs(WPFCOGPVCNUCPF &KRN+PI/KEJCGN*KGTOGKGT HTQO,WPG Modeling ,WNKC*ÒTOCPP/5E HTQO,CP ■ (KPKVG'NGOGPV.CD /CJOQWF+UOCKN/5E WPVKN,WPG ■ %QORWVCVKQPCN$KQOGEJCPKEU.CD &KRN+PI$GPLCOKP-TCPM HTQO#WI ■ 'PIKPGGTKPI5QNWVKQPUHQT$KQOGFKECN 4CHHCGNC-TWUG/5E HTQO#RTKN Problems Dipl.-Ing. Christoph Meier ■ 0WOGTKECN/GVJQFUHQT'PIKPGGTU.CD &KRN+PI-GK/ØNNGT WPVKN&GE ■ TM-Applets &JTWDCL[QVK/WMJGTLGG/5E HTQO5GRV ■ Computational Solid and Fluid Dipl.-Tech. Math. Andreas Nagler &[PCOKEU /5' &KRN+PI-GKLQ0KUUGP WPVKN&GE &KRN+PI/CTVKP2HCNNGT HTQO,CP Management &KRN+PI7TUWNC4CUVJQHGT Prof. Dr.-Ing. Wolfgang A. Wall, Director &KRN+PI#PFTGCU4CWEJ HTQO/CTEJ &KRN+PI%JTKUVKCP4QVJ Administrative Staff 5XGPLC5EJQGFGT/5E HTQO,WN[ 4GPCVC0CIN &KRN/CVJ$GPGFKMV5EJQVV %NCWFKC'FGP WPVKN1EV #NGZCPFGT5GKV\/5E HTQO,WN[ &KRN+PI5JCFCP5JCJOKTK WPVKN,WN[ Research Scientists &KRN6GEJP/CVJ5WUCPPC6KPMN WPVKN &T%TKUVÏDCN$GTVQINKQ 5GRV &T#NKPG$GN WPVKN#WI *COOCPFG8CCN/5E WPVKN5GRV &T/KTGNNC%QTQPGQ WPVKN/C[ Dipl.-Ing. Anh-Tu Vuong &T8QNMGT)TCXGOGKGT RCTVVKOG &KRN+PI-CTN4QDGTV9KEJOCPP Dr. Martin Kronbichler Dipl.-Tech. Math. Tobias Wiesner Dr. Alexander Popp Dipl. Math. Martin Winklmaier &T(TCPEGUE8GTFWIQ HTQO&GE /CIPWU9KPVGT/5E HTQO#RTKN &T.GPC;QUJKJCTC OCVGTPKV[NGCXG Dipl.-Ing. Andy Wirtz &KRN+PI%JTKUVQRJ#IGT HTQO0QX Sudhakar Yogaraj, M.Sc. 220 Institute of Computational Mechanics Publications 2013-14 .KUVQPN[EQPVCKPURGGTTGXKGYGFRWDNKECVKQPUKPKPVGTPCVKQPCNKPFGZGFLQWTPCNU ■ 5GKV\#2QRR#9CNN9# #UGOKUOQQVJ0GY- ■ $GTVQINKQ% %CKC\\Q# #VCPIGPVKCNTGIWNCTK\CVKQP ton method for orthotropic plasticity and frictional OGVJQFHQTDCEMƅQYUVCDKNK\CVKQPKPJGOQF[PCOKEU EQPVCEVCVƄPKVGUVTCKPU%QORWVGT/GVJQFUKP ,QWTPCNQH%QORWVCVKQPCN2J[UKEU #RRNKGF/GEJCPKEUCPF'PIKPGGTKPI 228-254 ■ 4CUVJQHGT7$WTVQP)%9CNN9#)TCXGOGKGT ■ Farah P., Popp A., Wall W.A.: Segment-based vs. 8 /WNVKHTCEVCNUWDITKFUECNGOQFGNKPIYKVJKP element-based integration for mortar methods in a variational multiscale method for large-eddy computational contact mechanics. Computational simulation of passive-scalar mixing in turbulent /GEJCPKEU ƅQYCVNQYCPFJKIJ5EJOKFVPWODGTU2J[UKEUQH ■ /C[T/-NÒRRGN69CNN9#)GG/9 # (NWKFU Temporal Consistent Approach to Fluid-Structure ■ 'JTN#2QRR#)TCXGOGKGT89CNN9# #FWCN +PVGTCEVKQP'PCDNKPI5KPING(KGNF2TGFKEVQTU5+#/ OQTVCTCRRTQCEJHQTOGUJV[KPIYKVJKPCXCTKCVKQPCN ,QWTPCNQP5EKGPVKƄE%QORWVKPICEEGRVGF OWNVKUECNGOGVJQFHQTKPEQORTGUUKDNGƅQY+PVGT ■ $KGJNGT,)GG/99CNN9# 6QYCTFUGHƄEKGPV PCVKQPCN,QWTPCNHQT0WOGTKECN/GVJQFUKP(NWKFU WPEGTVCKPV[SWCPVKƄECVKQPKPEQORNGZCPFNCTIG UECNGDKQOGEJCPKECNRTQDNGOUDCUGFQPC$C[GUKCP ■ 5EJQVV$9CNN9# #PGYHCEGQTKGPVGFUVCDKNK\GF OWNVKƄFGNKV[UEJGOG$KQOGEJCPKEUCPF/QFGNKPI :('/CRRTQCEJHQT&CPF&KPEQORTGUUKDNG in Mechanobiology, accepted 2014 Navier-Stokes equations. Computer Methods in ■ Vuong A.-T., Yoshihara L., Wall W.A.: A general #RRNKGF/GEJCPKEUCPF'PIKPGGTKPI CRRTQCEJHQTOQFGNKPIKPVGTCEVKPIƅQYVJTQWIJ RQTQWUOGFKCWPFGTƄPKVGFGHQTOCVKQPU%QORWVGT ■ %QTQPGQ/;QUJKJCTC.9CNN9# $KQƄNOITQYVJ /GVJQFUKP#RRNKGF/GEJCPKEUCPF'PIKPGGTKPI COWNVKUECNGCPFEQWRNGFƅWKFUVTWEVWTGKPVGTCEVKQP CPFOCUUVTCPURQTVCRRTQCEJ$KQVGEJPQNQI[CPF ■ 5EJQVV$4CUVJQHGT7 )TCXGOGKGT8 9CNN9# $KQGPIKPGGTKPI A face-oriented stabilized Nitsche-type extended ■ Henke F., Winklmaier M., Gravemeier V., Wall W.A.: variational multiscale method for incompressible A semi-Lagrangean time-integration approach for VYQRJCUGƅQY+PVGTPCVKQPCN,QWTPCNHQT0WOGTKECN GZVGPFGFƄPKVGGNGOGPVOGVJQFU+PVGTPCVKQPCN /GVJQFUKP'PIKPGGTKPICEEGRVGF ,QWTPCNHQT0WOGTKECN/GVJQFUKP'PIKPGGTKPI ■ 4GGRU%-GJN56CPKQU(/CKGT#$KGJNGT, 2GNKUGM,9CNN9#'EMUVGKP**)GG/9 ■ Ismail M., Gravemeier V., Comerford A., Wall W.A.: $KQOGEJCPKEUCPFIGPGGZRTGUUKQPKPCDFQOKPCN A stable approach for coupling multidimensional CQTVKECPGWT[UO,QWTPCNQH8CUEWNCT5WTIGT[ ECTFKQXCUEWNCTCPFRWNOQPCT[PGVYQTMUDCUGFQPC G PQXGNRTGUUWTGƅQYTCVGQTRTGUUWTGQPN[0GWOCPP ■ Popp A., Wall W.A.: Dual mortar methods for boundary condition formulation. International EQORWVCVKQPCNEQPVCEVOGEJCPKEUsQXGTXKGYCPF ,QWTPCNHQT0WOGTKECN/GVJQFUKP$KQOGFKECN TGEGPVFGXGNQROGPVU)#///KVVGKNWPIGP 'PIKPGGTKPI ■ $GN$TWPQP#-GJN5/CTVKP%7JNKI59CNN ■ *WGOGT,5VKEMGN65CICP'5EJYCT\/9CNN 9# 0WOGTKECNKFGPVKƄECVKQPOGVJQFHQTVJG 9# 1PVJG+PƅWGPEGQH7PUVGCF[#GTQF[PCOKEU non-linear viscoelastic compressible behaviour of on Driving Dynamics of Passenger Cars. Vehicle soft tissue using uniaxial tensile tests and image 5[UVGO&[PCOKEUs+PVGTPCVKQPCN,QWTPCNQH8GJKENG registration – Application to rat lung parenchyma. /GEJCPKEUCPF/QDKNKV[ ,QWTPCNQHVJG/GEJCPKECN$GJCXKQTQH$KQOGFKECN ■ ;QUJKJCTC.%QTQPGQ/%QOGTHQTF#$CWGT) /CVGTKCNU -NÒRRGN69CNN9# #EQODKPGFƅWKFUVTWEVWTG ■ Ismail M., Comerford A., Wall W.A.: Coupled and KPVGTCEVKQPCPFOWNVKƄGNFUECNCTVTCPURQTVOQFGN reduced dimensional modeling of respiratory for simulating mass transport in biomechanics. mechanics during spontaneous breathing. +PVGTPCVKQPCN,QWTPCNHQT0WOGTKECN/GVJQFUKP +PVGTPCVKQPCN,QWTPCNHQT0WOGTKECN/GVJQFUKP 'PIKPGGTKPI $KQOGFKECN'PIKPGGTKPI s ■ 4CUVJQHGT7 $WTVQP)% 9CNN9# )TCXGOGKGT8 ■ &CPQYUMK%)TCXGOGKGT8;QUJKJCTC.9CNN An algebraic variational multiscale-multigrid-multi- W.A.: A monolithic computational approach to HTCEVCNOGVJQF #8/ HQTNCTIGGFF[UKOWNCVKQPQH VJGTOQUVTWEVWTGKPVGTCEVKQP+PVGTPCVKQPCN,QWTPCN VWTDWNGPVXCTKCDNGFGPUKV[ƅQYCVNQY/CEJPWODGT HQT0WOGTKECN/GVJQFUKP'PIKPGGTKPI +PVGTPCVKQPCN,QWTPCNHQT0WOGTKECN/GVJQFUKP (NWKFU ■ 9KGUPGT66WOKPCTQ459CNN9#)GG/9 ■ /GKGT%2QRR#9CNN9# #P1DLGEVKXG&.CTIG Multigrid transfers for nonsymmetric systems based &GHQTOCVKQP(KPKVG'NGOGPV(QTOWNCVKQPHQT)GQ- on Schur complements and Galerkin projections. OGVTKECNN['ZCEV%WTXGF-KTEJJQHH4QFU%QORWVGT 0WOGTKECN.KPGCT#NIGDTCYKVJ#RRNKECVKQPU 0.## /GVJQFUKP#RRNKGF/GEJCPKEUCPF'PIKPGGTKPI ■ 4GGRU%/CKGT#2GNKUGM,*ÀTVN()TCDJGT ■ /ØNNGT-9$TWKPUOC4(.KGNGI1$CWUEJ#4 /GKGT89CNN9#'UUNGT/'EMUVGKP**)GG 9CNN9#.GXKPG#, 4JGQNQI[QHUGOKƅGZKDNG /9 /GCUWTKPICPFOQFGNKPIRCVKGPVURGEKƄE DWPFNGPGVYQTMUYKVJVTCPUKGPVNKPMGTU2J[UKECN distributions of material properties in abdominal 4GXKGY.GVVGTU CQTVKECPGWT[UOYCNN$KQOGEJCPKEUCPF/QFGNKPI ■ 4QOGTQ+ 7TTGEJC/ %[TQP%, #VQTUKQPHTGG KP/GEJCPQDKQNQI[ PQPNKPGCTDGCOOQFGN+PVGTPCVKQPCN,QWTPCNQH ■ %[TQP%,/ØNNGT-95EJOQNNGT-/$CWUEJ 0QP.KPGCT/GEJCPKEU #49CNN9#$TWKPUOC4( 'SWKNKDTKWORJCUG ■ 5WFJCMCT;/QKVKPJQFG#NOGKFC,29CNN9# FKCITCOQHUGOKƅGZKDNGRQN[OGTPGVYQTMUYKVJ An accurate, robust, and easy-to-implement NKPMGTU'WTQRJ[UKEU.GVVGTU #NGVVGTULQWTPCN method for integration over arbitrary polyhedra: GZRNQTKPIVJGHTQPVKGTUQH2J[UKEU CRRNKECVKQPVQ'ODGFFGF+PVGTHCEG/GVJQFU,QWT- RR PCNQH%QORWVCVKQPCN2J[UKEU Institute of Computational Mechanics 221 ■ $CWGT))COPKV\GT2)TCXGOGKGT89CNN9# ■ Comerford A., Gravemeier V., Wall W.A.: An An isogeometric variational multiscale method for algebraic variational multiscale-multigrid method large-eddy simulation of coupled multi-ion transport for large-eddy simulation of turbulent pulsatile KPVWTDWNGPVƅQY,QWTPCNQH%QORWVCVKQPCN2J[UKEU ƅQYUKPEQORNGZIGQOGVTKGUYKVJFGVCKNGFKPUKIJV KPVQRWNOQPCT[CKTYC[ƅQY+PVGTPCVKQPCN,QWTPCN ■ Popp A., Seitz A., Gee M.W., Wall W.A.: Improved HQT0WOGTKECN/GVJQFUKP(NWKFU robustness and consistency of 3D contact algo- rithms based on a dual mortar approach. Computer ■ 5WFJCMCT;9CNN9# 3WCFTCVWTGUEJGOGUHQT /GVJQFUKP#RRNKGF/GEJCPKEUCPF'PIKPGGTKPI arbitrary convex/concave volumes and integration QHYGCMHQTOKPGPTKEJGFRCTVKVKQPQHWPKV[OGVJQFU ■ 4CUVJQHGT7 )TCXGOGKGT8 /WNVKHTCEVCNUWD Computer Methods in Applied Mechanics and ITKFUECNGOQFGNKPIYKVJKPCXCTKCVKQPCNOWNVKUECNG 'PIKPGGTKPI OGVJQFHQTNCTIGGFF[UKOWNCVKQPQHVWTDWNGPVƅQY ■ 'JTN#$CWGT))TCXGOGKGT89CNN9# # ,QWTPCNQH%QORWVCVKQPCN2J[UKEU computational approach for the simulation of s PCVWTCNEQPXGEVKQPKPGNGEVTQEJGOKECNEGNNU,QWTPCN ■ %[TQP,%/ØNNGT-9$CWUEJ#49CNN9# QH%QORWVCVKQPCN2J[UKEU Micromechanical simulations of biopolymer PGVYQTMUYKVJƄPKVGGNGOGPVU,QWTPCNQH%QORWVC- VKQPCN2J[UKEU ■ Ismail M., Wall W.A., Gee M.W.: Adjoint-based KPXGTUGCPCN[UKUQHYKPFMGUUGNRCTCOGVGTUHQT RCVKGPVURGEKƄEXCUEWNCTOQFGNU,QWTPCNQH %QORWVCVKQPCN2J[UKEU 222 Institute of Computational Mechanics Institute of Astronautics 4GCNVKOGVGNGTQDQVKEUKPURCEGsURCEGVGEJPQNQIKGUsGZRNQTCVKQPJWOCPURCEGƅKIJV sPCPQUCVGNNKVGUsURCEGƅKIJVU[UVGOUGPIKPGGTKPIsJ[RGTXGNQEKV[NCD ■ In 2013-14, like the years before, the Institute of Astronautics focused on the development and design of satellite and space exploration technology. In particular: can be simulated, while the operator is ■ Real-time teleoperation for on-orbit located in the institute’s mission control servicing center or anywhere on earth. Realistic tele- ■ Inter-satellite link communication operation is performed by real-time satellite systems links via a ground station on top of the the ■ Life support systems of habitats and institute’s building and a relay satellite in space suits geostationary orbit. ■ CubeSats for technology in-orbit For the renewed interest of NASA and XGTKƄECVKQP ESA in human space exploration an Prof. Prof. h. c. Dr. ■ High velocity impact physics adapted and a highly reliable life support Dr. h. c. Ulrich Walter ■ Micrometeoroid and space debris system (LSS) is mandatory. In 2013-14 the simulation institute of Astronautics has improved the Contact modeling tool V-HAB for arbitrary LSS, www.lrt.mw.tum.de/ 1PQTDKVUGTXKEKPIKUCITQYKPIƄGNFQH YJKEJHQTVJGƄTUVVKOGKUCDNGVQOQFGN QHƄEG"NTVOYVWOFG space activities, where satellites or other a LSS dynamically over a long period of Phone +49.89.289.16003 spacecraft in space are serviced (such time. The modeling not only includes the as refueling, maintenance, or upgrade) or life support components but in particular deorbited by a servicing satellite if defunct. CJKIJƄFGNKV[JWOCPOQFGNHQTCUVTQPCWVU This service can be accomplished by an living and working in this LSS. operator on ground teleoperating a robot, +P0QXGODGTVJGƄTUVUCVGNNKVGQH cameras, or else on the servicing satellite in the TU Munich, the institute’s MOVE I real-time. As a highlight in 2013-14, the ins- pico-satellite, was launched from Russia titute built a large simulation environment, into space, from where it successfully called RACOON-Lab, with the dimensions transmitted beacon and telemetry data. 6 m x 10 m x 5 m. In this laboratory the proximity operations of the two satellites LISA – Space Communication Technologies On-orbit servicing and space debris removal missions with tele-operation, a key research area of LRT, require trans- mission of multi-channel video signals and spacecraft sensor information which can exceed data rates of 20 Mbps. These communication scenarios require, among other novel technologies, especially high- gain antenna systems. The Light-weight Intersatellite (Link) Satellite Antenna (LISA) R&D projects at the LRT respond to this need. All LISA antennas are designed the design of high performance, low loss CUFKTGEVTCFKCVKPITGNCVKXGN[ƅCVCTTC[ and high frequency waveguide structures, antennas. The latest high-gain Ka-band using a lost core galvanic manufacturing LISA antennas are implemented as novel, process. The copper-galvanic process has copper-galvanically manufactured horn been carefully designed, characterized, antennas with a low-loss waveguide dis- GXCNWCVGFCPFEGTVKƄGFHQTWUGKPURCEG- tribution network. Copper-galvanic allows ƅKIJVGPXKTQPOGPVUCURCTVQHVJG.+5# Institute of Astronautics 223 projects. The LISA high gain Ka-band antennas, implemented in a 40 x 40 cm reference model, provide a narrow beam angle of 1.6O, thus requiring precision orientation between sending and receiving station. Especially in highly agile on-orbit servicing missions with tumbling, non- cooperative targets, fast precision 2-axes mechanical steering mechanisms are required. The project LISAMS+ develops employ superposition of phase-shifted a 2-axes mechanical steering mechanism, signals from each horn to provide an the corresponding high gain copper array apparent beam steering without mechan- antenna and a novel two-channel, low- ical components. loss, Ka-band waveguide rotary joint with research partners from industry and the Project Funding University of Applied Sciences Munich. These projects are funded by DLR (Ger- In addition to the developed and inves- man Aerospace Center – Space Adminis - tigated mechanical pointing mechanism tration) research grants no. FKZ 50YB0602 (LISAMS+), an option for a mecha- (LISA S-band antenna), FKZ 50YB0802 nism-free electric steering solution is (LISA Ka-band mechanical steering), investigated in the project (LISAES) for and 50YB1113 (LISA Ka-band electronic geostationary orbit with partners from steering), managed by Dr. Siegfried industry and the Technical University Voigt and Heiko Ultes at the DLR Space Darmstadt. Using liquid-crystal phase shif- Administration in Bonn. ters in the waveguide distribution network of the direct radiating antenna array would RACOON – Real-time On-Orbit Teleoperation real-time capabilities allow the inclusion of a human operator into the control loop for research in the area of human spacecraft interaction. This includes user studies for optimal human machine interface design or operator workload evaluation. Projects ■ Racoon Hardware-in-the-loop Ver. 2 Simulator The Racoon Lab features a satellite ■ FORROST (BFS funded) proximity operations simulation environ- ■ Adaptive Communication Channels ment. The lab consists of a hardware (DFG funded) in the loop simulator that represents ■ Optimal Docking Trajectories (Munich position and attitude of two spacecraft in Aerospace Scholarship) close proximity (e.g. for rendezvous and ■ Debris Capture with Flexible Elements docking maneuvers). The lab provides (EADS Study) realistic lighting conditions and hardware ■ RacoonSim Software Environment sensors to simulate realistic sensor data Development for the development of new spacecraft technologies (e.g. control algorithms). The 224 Institute of Astronautics 8*#$s/QFGNKPICPF5KOWNCVKQPQH.KHG5WRRQTV5[UVGOU To fully assess the long-term operation the lunar surface. The three other disser- and stability of life support systems (LSS) tations, which are still in progress, cover for exploration missions, static analysis the simulation of portable life support OGVJQFUCTGKPUWHƄEKGPV'UVCDNKUJKPI systems for space suits, the addition of mass balances and selecting technologies performance shaping factors to the human based on average performance values is model and the optimization of LSS archi- a fast and proven method for feasibility tectures containing both physico-chemical studies but, once the system design as well as biological components. becomes more detailed, certain aspects of In addition to the previously mentioned the system behavior cannot be captured. dissertations, the group published its work To provide this additional information, the at the annual International Conference Institute of Astronautics has developed on Environmental Systems (ICES), the the Virtual Habitat or V-HAB. V-HAB is preeminent conference for the life support a MATLAB®-based simulation software system community. The peer-reviewed which enables the dynamic simulation papers were well received and the already of life support systems, the humans strong ties to LSS experts from NASA and occupying the simulated habitat and the industry could be expanded. In total the OKUUKQPVJCVKUDGKPIRGTHQTOGF6JGƄTUV ITQWRRWDNKUJGFƄXGRCRGTUCV+%'5 development step was completed in early and three at ICES 2014, all of which can 2013 when the simulation system was be found in the publications list. In addi- validated by comparing data from a virtual tion to these conference papers the group model of the International Space Station also continued the extensive in volve- .55YKVJCEVWCNƅKIJVFCVC6JKUEQKPEKFGF ment of students in the actual research, with the completion of a dissertation on producing a total of 17 Bachelor’s theses, the rationale and development of V-HAB 9 Master’s theses and 5 term papers in bei Dr. Markus Czupalla [1]. Four other 2013 and 2014. dissertations where derived from this initial work, each adding to V-HAB’s already References broad spectrum of capabilities. One of [1] M. Czupalla, ‘The Virtual Habitat - Integral these dissertations was also completed Modeling and Dynamic Simulation of Life Support Systems’, Dissertation, Inst. of Astronautics, TUM, in late 2013 by Dr. Phillip Hager [2] who Munich, 2012. contributed a dynamic thermal simulation [2] P. Hager, ‘Dynamic thermal modeling for moving tool to capture the thermal dynamics of objects on the Moon’, Dissertation, Institute of Astronautics, Technische Universität München, moving objects (e.g. astronauts, rovers) on Munich, 2013. Institute of Astronautics 225 Research Focus Management ■ Real-time tele-robotics in space Prof. Dr. Dr. h.c. Ulrich Walter, Director ■ Space communication technology Prof. Dr.-Ing. Harry O. Ruppe, Emeritus ■ Space mechanism Prof. Dr.-Ing. Eduard Igenbergs, Emeritus ■ Analysis of life support systems ■ Nano satellites Adjunct Professors ■ Lunar in-situ resource utilization Hon. Prof. Dr. med. Hans Pongratz ■ Hypervelocity impacts apl. Prof. Dr.-Ing. Robert Schmucker Dr. rer. nat. Markus Brandstätter Competence ■ Systems engineering tools for develop- #FOKPKUVTCVKXG5VCHH ment of complex systems Petra Lochner ■ End-to-end satellite communication ■ Dynamic simulation of life support Research Scientists systems Dr. Alexander Hoehn, Assoc. Professor (adj.), Univ. of Colorado Infrastructure Dr.-Ing. Martin Rott, Academic Director ■ Mechanical workshop Dr.-Ing. Jan Harder, Postdoc, Promotion ■ Cleanroom (Class 7) Jan. 2014 ■ Thermal-vacuum chamber Dipl.-Ing. Claas Olthoff ■ Proximity operations simulator Dipl.-Ing. Andreas Fleischner, left Nov. 2014 ■ Groundstation (Ka-, S- and UHF/VHF Dipl.-Ing. Matthias Killian Band) Dipl.-Ing. Christian Bühler ■ Mission control center Dipl.-Ing. Andreas Hein, left Sep. 2014 ■ Hypervelocity accelerator Dipl.-Ing. Martin Langer Dipl.-Ing. Sabine Letschnik Lectures in: Dipl.-Ing. Ralf Purschke ■ (WPFCOGPVCNUQH5RCEGƅKIJV Philipp Reiß, M.Sc. ■ Space System Design Dipl.-Ing. Matthias Tebbe ■ Orbit- and Flight Mechanics Jacopo Ventura, M.Sc. ■ *WOCP5RCEGƅKIJV Ming Ming Wang, M.Sc. ■ Systems Engineering Dipl.-Ing. arch. Thomas Dirlich, external ■ Sterne und Kosmos Dipl.-Inf. Carolin Eckl, external ■ Space environment and its simulation Dipl.-Ing. Piotr Perczynski, external ■ Near Earth Objects Dipl.-Ing. Anton Zhukov, external Dipl.-Ing. Jonas Schnaitmann, external Technical Staff Tobias Abstreiter .GQPJCTF4ÒRƅ 226 Institute of Astronautics Publications 2013-14 ■ Carpenter, J. D.; Barber, S.; Cerroni, P.; Fisackerly, ■ Purschke, R.; Hoehn, A. (2013): Design and R.; Fumagalli, A.; Houdou, B. et al. (2014): characterization of an Antenna Pointing Mechanism Accessing and assessing lunar resources with for on-orbit servicing missions. In: 2013 IEEE PROSPECT. In: LEAG (Hg.): Annual Meeting of the Aerospace Conference. Big Sky, MT, 2-3 March Lunar Exploration Analysis Group. Laurel, Maryland, 2013, pp. 1-8. USA, 22-24 October 2014. Available online: http:// ■ Purschke, Ralf; Hoehn, Alexander (2014): oro.open.ac.uk/41598/1/3018.pdf. Evaluation and test of different gear concepts for ■ Göser, Johannes; Olthoff, Claas Tido (2014): Results Ka-band Antenna Pointing Mechanisms. In: 2014 of a Dynamic Liquid Cooling Garment Simulation IEEE Aerospace Conference. Big Sky, MT, USA, in V-SUIT. In: Proceedings of the 44th International |/CTEJRR Conference on Environmental Systems. 44th Inter- ■ 4GKUU2 *CIGT2 +PXGUVKICVKQPQHVJGƅQY national Conference on Environmental Systems. characteristics of lunar regolith simulants under Tucson, Arizona, USA, 13-17 July 2014. ICES. reduced gravity and vacuum on a partial-g para- ■ Hager, P. B.; Klaus, D. M.; Walter, U. (2014a): DQNKEƅKIJV+P 'WTQRGCP)GQRJ[UKECN7PKQP *I Char acterizing transient thermal interactions 2TQEGGFKPIUQHVJG')7|)GPGTCN#UUGODN[ between lunar regolith and surface spacecraft. In: 8QN|)GPGTCN#UUGODN['WTQRGCP)GQRJ[UKECN Planetary and Space Science 92, Pp. 101-116. DOI: Union. 10.1016/j.pss.2014.01.011. ■ Reiss, P.; Hager, P.; Hoehn, A. (2013): Hopper-Flow ■ Hager, P. B.; Parzinger, S.; Haarmann, R.; Walter, of Lunar Regolith Simulants in Reduced Gravity and U. (2014b): Transient thermal envelope for rovers Vacuum. In: International Society of Terrain-Vehicle and sample collecting devices on the Moon. In: Systems (Hg.): Proceedings of the 7th Regional Advances in Space Research. DOI: 10.1016/j. Americas Conference of the International Society asr.2014.12.012. of Terrain-Vehicle Systems. International Society of ■ *CIGT2 4GKUU2 8GTKƄECVKQPQHCVJGTOCN Terrain-Vehicle Systems. simulation tool for moving objects on the lunar ■ Reiss, P.; Hager, P.; Hoehn, A.; Rott, M.; Walter, surface. In: Geophysical Research Abstracts 15. U. (2014a): Flowability of lunar regolith simulants ■ Hager, P.; Walter, U.; Klaus, D. (2013): Impact of under reduced gravity and vacuum in hopper-based lunar dust on radiator design for Moon bases and conveying devices. In: Journal of Terramechanics rovers. In: Proceedings of the 43rd International 55, pp. 61–72. DOI: 10.1016/j.jterra.2014.04.005. %QPHGTGPEGQP'PXKTQPOGPVCN5[UVGOU8QN| ■ Reiss, P.; Hager, P.; Parzinger, S.; Henn, N. (2014b): 14-18 July 2013. AIAA. Technological Challenges for In-Situ Investigation of ■ Harder, Jan; Wilde, Markus; Fleischner, Andreas Lunar Resources. In: Proceedings of the European (2013): Technology development for real-time Lunar Symposium. European Lunar Symposium. teleoperated spacecraft mission operations. In: London, United Kingdom, 15-16 May 2014. 2013 IEEE Aerospace Conference. Big Sky, MT, ■ Reiss, P.; Hoehn, A. (2014): Evaluation of Small- |/CTEJ2R scale Penetrators for Lunar Subsurface Investi- ■ Hoehn, A.; Hager, P. B.; Harder, J. T. (2013): Design gation. In: Proceedings of the European Lunar characterization of an electronic steerable Ka-band Symposium. European Lunar Symposium. London, antenna using liquid crystal phase shifters. In: United Kingdom, 15-16 May 2014. 2013 IEEE Aerospace Conference. Big Sky, MT, ■ Reiss, P.; Walter, U. (2013): Compaction of Lunar |/CTEJ2R Regolith Simulants under Reduced Gravity. In: ■ McGrath, C.; Hager, P. (2013): Thermal Analysis of Proceedings of the European Planetary Science the CubeSat First-MOVE in Preparation for Launch %QPITGUU8QN|'WTQRGCP2NCPGVCT[5EKGPEG using ESATAN-TMS r4. In: International Academy of Congress. #UVTQPCWVKEU *I 2TQEGGFKPIUQHVJGVJ+##|5[O- ■ Schnaitmann, J. (2013): Approach to improve the RQUKWOQP|5OCNN5CVGNNKVGUHQT'CTVJ1DUGTXCVKQP Crew Module of the Virtual Habitat Simulation to VJ+##|5[ORQUKWOQP|5OCNN5CVGNNKVGUHQT'CTVJ FGRKEV3WCPVKVCVKXGCPF3WCNKVCVKXG%TGY'HƄEKGPE[ Observation. Berlin, Germany. In: Proceedings of the 43rd International Conference ■ Olthoff, C.; Schnaitmann, J. (2013): Development on Environmental Systems, 14-18 July 2013. AIAA. Status of V-SUIT – The Virtual Space Suit simulation ■ Takahashi, Tadayuki; den Herder, Jan-Willem A.; software. In: Proceedings of the 43rd International Bautz, Mark; Perinati, E.; Rott, M.; Santangelo, A. et Conference on Environmental Systems, 14-18 July al. (2014): Hyper-velocity impact test and simulation 2013. AIAA. of a double-wall shield concept for the Wide ■ Olthoff, Claas Tido; Schnaitmann, Jonas; Zhukov, Field Monitor aboard LOFT. In: SPIE (Hg.): Space Anton (2014): Development Status of the Dyna- Telescopes and Instrumentation 2014: Ultraviolet to mic Life Support System Simulation V-HAB. In: Gamma Ray. Vol. Tadayuki Takahashi, Jan-Willem Proceedings of the 44th International Conference A. den Herder und Mark Bautz. Montréal, Quebec, on Environmental Systems. 44th International %CPCFC,WPG 52+' 52+'|2TQEGGFKPIU Conference on Environmental Systems. Tucson, 9144), pp. 914465. Arizona, USA, 13-17 July 2014. ICES. ■ Tan, Jingwen; Ma, Weihua; Wang, Mingming; ■ Pederesen, M. N.; Letschnik, J.; Schelde, L.; Kar- Luo, Jianjun (2014): Relative Navigation for Space stoft, H.; Schurig, F.; Walter, U. (2013): Three-dimen- 5[PEJTQPK\CVKQP$CUGFQP)055|%CTTKGT2JCUG sional radiation pattern measurement strategy for In: IAF (Hg.): Proceedings of the 65th Internati- ground station antennas. In: International Journal of onal Astronautical Congress. 65th International Satellite Communications and Networking Volume Astronautical Congress. Toronto, Canada, 29 Sep- 31 (Issue 1), pp. 39-50. DOI: 10.1002/sat.1020. tember - 3 October 2014. International Astronautical ■ Plötner, P.; Anderson, M.; Czupalla, M.; Ewert, M.; Federation. Roth, C.; Zhukov, A. (2013): Status of the Correla- ■ Ventura, Jacopo; Romano, Marcello (2014): Exact tion Process of the V-HAB Simulation with Ground Analytic Solution for the Spin-up Maneuver of an Tests and ISS Telemetry Data. In: Proceedings of Axially Symmetric Spacecraft. In: Acta Astronautica the 43rd International Conference on Environmental 104 (1). DOI: 10.1016/j.actaastro.2014.07.038. Systems, 14-18 July 2013. AIAA. Institute of Astronautics 227 ■ Wang, Mingming; Walter, U.; Luo, Jianjun; Ma, ■ Wang, Mingming; Walter, Ulrich; Luo, Jianjun 9GKJWC C #&&5|$CUGF4GCN6KOG5KOWNCVKQP D #|0QPNKPGCT/QFGN2TGFKEVKXG%QPVTQNNGT Architecture for Space Robotic Tele-Operation. In: for Kinematically Redundant Space Manipulator. IAF (Hg.): Proceedings of the 64th International In: IAF (Hg.): Proceedings of the 64th International Astronautical Congress. International Astronautical Astronautical Congress. International Astronautical Congress. Beijing, China. International Astronautical Congress. Beijing, China. International Astronautical Federation. Federation. ■ Wang, Mingming; Walter, Ulrich (2013a): Joint ■ Wilde, Markus; Harder, Jan; Purschke, Ralf Space Dynamics Algorithm for Tree Structure Space (2013): Operator learning effects in teleoperated Manipulators by Using Inertia Mapping Matrix. rendezvous & docking. In: 2013 IEEE Aerospace In: Zdravko Terze (Hg.): ECCOMAS Thematic %QPHGTGPEG$KI5M[/6/CTEJRR| Conference on Multibody Dynamics 2013. Zagreb, ■ Zhukov, A.; Roth, C.; Plötner, P.; Czupalla, M. Croatia, July 1-4, 2013: book of abstracts. Zagreb: (2013): Simulation of the Temperature and Humidity University of Zagreb. Faculty of Mechanical Control System of International Space Station in Engineering and Naval Architecture. the Virtual Habitat. In: Proceedings of the 43rd Inter- ■ Wang, Mingming; Walter, Ulrich (2013b): Joint- national Conference on Environmental Systems, Space Dynamics Algorithm of Space Manipulators 14-18 July 2013. AIAA. with Tree Structure using Inertia Mapping Matrix. ■ Zhukov, Anton; Czupalla, Markus (2014): The Virtual In: IAF (Hg.): Proceedings of the 64th International Habitat - Optimization of Life Support Systems. In: Astronautical Congress. International Astronautical Proceedings of the 44th International Conference Congress. Beijing, China. International Astronautical on Environmental Systems. 44th International Federation. Conference on Environmental Systems. Tucson, ■ Wang, Mingming; Walter, Ulrich (2013c): Kinematics Arizona, USA, 13-17 July 2014. ICES. Analysis of Free-Floating Redundant Space Manipulator based on Momentum Conservation. In: &GWVUEJGU| 228 Institute of Astronautics Institute of Materials Science and Mechanics of Materials Experimental and theoretical characterization of metallic materials ■ The focus of the Institute of Materials Science and Mechanics of /CVGTKCNU 9-/ KPYCUVQFGXGNQRHWTVJGTVJGƄGNFQHRTQ cessing-microstructure-properties-relationships of load bearing materials concentrating on metallic materials such as high strength steels, titanium, nickel, aluminum and tungsten alloys. Research is performed employing theoretical, numerical and experimental techniques with equal import- ance. The associated State Material Testing Laboratory serves as import- ant interface to industry with respect to research oriented (off-routine) testing of materials. Since 2006 WKM hosts the Christian-Doppler- Laboratory for Material Mechanics of High Performance Alloys (CDL, headed by Dr. C. Krempaszky). Prof. Dr. mont. habil. Dr. rer. nat. h. c. Current research activities concentrate on Ewald Werner residual stresses in gas turbine compo- nents, their machining via electrochemical Contact metal dissolution or selective laser sinter- www.wkm.mw.tum.de ing, hot isostatic pressing of precipitation [email protected] Phone +49.89.289.15247 hardening aluminum cast alloys, surface OQFKƄECVKQPQHVKVCPKWOCNNQ[UHQTOGFKECN implants, thermal fatigue of semiconduc- tor devices, plasticity and failure of high strength sheet steels and fracture mech- anics of tungsten alloys as plasma facing components of fusion reactors. The Institute applied successfully for HQWT|RCVGPVUQPRTQEGUUKPIQHVWPIUVGPXKC tape casting (together with Siemens). Scanning electron microscope at WKM (Photo: WKM) Deformation and Failure Mechanisms of Thin Sheet Materials for Automotive Applications The desire to produce higher strength steels with formability greater than those obtained in conventional controlled rolled high strength microalloyed grades has led to the development of microstructure strengthened steels. These include dual phase (DP) ferrite-martensite steels, ferrite-bainite steels, transformation induced plasticity (TRIP) steels, consisting of ferrite, bainite, and retained austenite, complex phase (CP) and martensite steels. deformation experiments. A systematic Simulated distribution of plastic The research activities carried out on this evaluation of accompanying microstruc- equivalent strain in the marten- sitic phase of a dual phase steel topic concentrate on different grades tural investigations allows a deepening (Quelle: WKM) of industrially produced high strength of understanding of the mechanisms steels. Formability of the chosen materials controlling and limiting formability. Special is characterized in uni- and multi-axial attention is paid to hole expansion testing, Institute of Materials Science and Mechanics of Materials 229 becoming an increasingly important Projects method in describing the formability of ■ Micromechanical modelling of the high strength steels. formability and failure of DP steels (CDL) Besides experimental investigations on ■ Effect of edge preparation in hole the relationship between microstructural expansion testing (CDL) aspects and parameters describing ■ Development of an instrumented hole formability, micromechanical modeling expansion set-up (CDL) approaches are worked out to assess ■ Bainite formation in low alloyed thin the formability of virtual microstructures, sheet steel with increased boron thereby reducing development and testing content (CDL) costs considerably. ■ Strengthening of DP steels by grain size control Residual Stress Analysis the desired dimensional accuracy of the component can no longer be achieved. The main focus in this topic is placed on the development and application of experimental methods (such as hole drilling techniques, dissectioning methods Forged component of complex and neutron diffraction) for residual stress geometry positioned at the analysis as well as the theoretical estima- neu tron diffractometer STRESS- SPEC for strain mapping tion of the evolution of the residual stress (Photo: WKM) state during the different/critical stages of the production process (e.g. forging/ Residual stresses typically act on dif- forming, heat treatment) using adequate ferent length scales depending on the semianalytical and numerical modeling mechanisms they originate from. They approaches. ECPDGDGPGƄEKCNQTFGVTKOGPVCNHQTVJG material and component performance. Projects As a consequence of compressive ■ Residual stresses in geometrically macroscopic stresses near the surface of complex structural parts (CDL) a component the accumulation of micro- ■ Development of an advanced design cracks can be reduced and the life time of and production process of high tem- the component can be extended. Further- perature Ni-based alloy forgings (EC) more, macroscopic residual stresses are ■ Eigenspannungsbedingter Bauteil- responsible for distortions of the compo- XGT\WIKPTQNNIGDQIGPGP5VCJNRTQƄNGP nents during machining. In the worst case (Heidenhain) 230 Institute of Materials Science and Mechanics of Materials Electrochemical Machining For aircraft engine components exposed to high temperatures and dynamic loadings, Ni-based super alloys are used owing to their high strength at elevated tempera- tures and high creep resistance. For the machining of these components, however, conventional methods such as milling are cost-intensive due to excessive tool wear. Single-axis laboratory PECM Electrochemical machining (ECM) and pre- equipment at WKM (Photo: WKM) cise electrochemical machining (PECM) activities at WKM include investigation rely on the controlled anodic dissolution of high-rate anodic dissolution of poly- of the workpiece material, thus serving and single-crystalline Ni-based alloys, as low-tool-wear and cost-effective development of a control system for the alternatives to milling since no mechanical PECM process, and simulation-assisted contact is established between tool and tool shape design. workpiece. Challenges related to ECM and PECM Projects KPENWFGƄPFKPICRRTQRTKCVGRTQEGUU ■ Innovative, adaptive Prozessregelung conditions for the machining of materials ECM/PECM (Federal Ministry of of interest, maintaining process stability, Economy and Technology) and process simulation. ■ Herstellung von LCF-Proben mittels In cooperation with MTU Aero Engines PECM (MTU) and the Institute of Automatic Control, ■ Elektrochemische Bearbeitung von TiAl ECM- and PECM-related research (MTU) Durability Analysis of Integrated Circuits One of the key factors for the rapid FIB (Focused-Ion-Beam) cross technological progress in our time is the section images through points of failure. Conductor paths with a development of integrated circuits (ICs) NKPGYKFVJQHŠO NGHV CPF - a wiring of electronic components on a ŠO TKIJV 5QWTEG 65OQTQFKP J. Wilde, P. Alpern, M. Stecher, single semiconductor substrate. IEEE Transactions on Device Growing demands on performance and and Materials Reliability 8 (2008) 590-599) durability of ICs require an understand- is costly and may not be feasible. ing of possible failure mechanisms. An For this purpose simulative life time investi- important cause for damage to ICs arises gations are conducted at WKM which take from thermo-mechanical loads of the into account the microstructure, the grain involved materials as a result of current orientation and the temperature dependent pulses. The mismatch in thermal expan- anisotropic visco-plastic material behavior sion between the conductor paths made of aluminum. The small dimensions of the of aluminum and the surrounding inter- EQORQPGPVUKPVJGTCPIGQHŠOCPFVJG layer dielectric leads to stresses which large span of time scales, involving current cause crack initiation and, consequently, pulses of a few milliseconds and a service short circuits and the loss of functionality time of several years, put high demands on of the assembly. the material model. Throughout their service life electronic components undergo millions of load Projects cycles, so that an experimental life cycle ■ Modellierung der Metallisierung in analysis during the development process integrierten Schaltungen (DFG) Institute of Materials Science and Mechanics of Materials 231 Research Focus Management ■ Testing and modelling of metallic high Prof. Dr. mont. habil. Dr. rer. nat. h. c. performance alloys (iron-, nickel-, Ewald Werner, Director titanium- and aluminum-based alloys) Dr.-Ing. Christian Krempaszky ■ Residual stress determination via diffraction methods (X-rays, neutrons) Adjunct Professors and incremental hole drilling Hon.-Prof. Dr.-Ing. Dr. Eng. (Univ. Nagoya/ ■ Microstructure based numerical Japan) Harald Bolt modelling ■ Electron and light microscopy Administrative Staff ■ Mechanical testing Yvonne Jahn ■ Electrochemical machining Melanie Laubenbacher Competence Research Scientists ■ High resolution scanning electron Dipl.-Ing. Alexander Fillafer microscopy Stephan Hafenstein, M. Sc. ■ Diffraction techniques Dipl.-Ing. Florian Hairer ■ Material testing on demand Dipl.-Ing. Peter Holfelder Dipl.-Ing. Christiane Kellerer Infrastructure Dr.-Ing. Lisa Koll ■ Material testing equipment Muyuan Li, M.Sc. ■ Light and electron microscopes Dipl.-Phys. Jinming Lu ■ Hot isostatic press Dipl.-Ing. Felix Meier ■ Dilatometers and annealing simulator Dipl.-Ing. Gerwin Riedl ■ Electrical and mechanical workshops Dr.-Ing. Cornelia Schwarz ■ Electrochemical machining workstation Johannes Seidl, M.Sc. ■ X-ray diffractometers Mathias Sommerer, M.Sc. Anneka Vogel, M.Sc. Courses Dr. mont. Zhonghua Wang ■ Materials Science I and II Dipl.-Ing. Robert Wesenjak ■ Engineering Materials Technology ■ Engineering Mechanics for Business Technical Staff Sciences Wolfgang Bauer ■ Fracture Mechanics/Plasticity Theory Brigitte Hadler ■ Tensor Calculus for Engineers Alois Huber ■ Finite Elements in Mechanics of Stefan Humplmair Materials Carola Reiff ■ Electron Microscopy Jens Reuter, B.Sc. ■ Laboratory Courses on Materials Caner Yanbaz Science, Mechanics of Materials and Finite Element Methods 232 Institute of Materials Science and Mechanics of Materials Publications 2013-14 ■ T. Schmitz, C. Hertl, E. Werner, U. Gbureck, J. Groll, ■ J. Rehrl, K. Mraczek, A. Pichler, E. Werner: The C. Moseke: Oxygen diffusion hardening of tantalum impact of hydrogen on the mechanical properties of coatings on cp-titanium for biomedical applications. AHSS/ UHSS grades at low- and high strain rates. Surface and Coatings Technology 216 (2013) 46-51. In: Proc. of 2nd Int. Conf. on Metals & Hydrogen. DOI: 10.1016/j.surfcoat.2012.11.021. SteelyHydrogen 2014 , Ghent, BE, May 5-7, 2014, ■ 66CZGT%5EJYCT\95OCTUN['9GTPGT #ƄPKVG L. Duprez (Eds.), OCAS NV, (2014) 21-34. GNGOGPVCRRTQCEJVQUVWF[VJGKPƅWGPEGQHECUV ■ C. Hertl, L. Koll, T. Schmitz, E. Werner, U, Gbureck: pores on the mechanical properties of the Ni-base Strucutral characterisation of oxygen diffusion alloy MAR-M247. Mater. Sci. Engng. A575 (2013) hardened alpha-tantalum PVD-coatings on 144-151. DOI: 10.1016/j.msea.2013.02.067 titanium. Mater. Sci. Engng., C41 (2014) 28-35. DOI: ■ K. Hausmann, D. Krizan, K. Spiradek-Hahn, A. 10.1016/j.msec.2014.03.018 2KEJNGT'9GTPGT 6JG+PƅWGPEGQH0DQPVJG ■ M. Metzger, M. Leidenfrost, E. Werner, H. Riedel: transformation behavior and mechanical properties Lifetime prediction of EN-GJV 450 cast iron cylinder of TRIP-assisted bainitic-ferritic sheet steels. Mater. heads under combined thermo-mechanical and Sci. Engng. A588 (2013) 142-150. DOI: 10.1016/j. high cycle fatigue loading. SAE Int. J. of Engines 7 msea.2013.08.023 (2014) 1073-1083. DOI: 10.4271/2014-01-9047 ■ K. Hausmann, D. Krizan, A. Pichler, E. Werner: ■ A. Fillafer, C. Krempaszky, E. Werner: On strain par- Trip-aided bainitic-ferritic sheet steel: a critical titioning and micro-damage behavior of dual-phase assessment of alloy design and heat treatment. steels. Mater. Sci. Engng. A614 (2014) 180-192, In: Proc. MS&T 2013, Advanced Steel Metallurgy: DOI: 10.1016/j.msea.2014.07.029 Design, Processing, and Technological Exploitation, ■ F. Ohmenhäuser, C. Schwarz, S. Thalmair, H. S. Association for Iron & Steel and TMS, Warrendale, Evirgen: Constitutive modeling of the thermo- PA, USA (2013) 209-219. mechanical fatigue and lifetime behavior of the ■ E. Werner, A. Fillafer: Stahl ein Leichtbauwerkstoff cast steel 1.4849. Mat. Des. 64 (2014) 631-639. mit Tradition und Zukunft. lightweightdesign 6 DOI: 10.1016/j.matdes.2014.08.016 (2013) 12-17. ■ T. Schmitz, F. Warmuth, E. Werner, C. Hertl, J. Groll, ■ J. Rehrl, K. Mraczek, A. Pichler, E. Werner: Mecha- U. Gbureck, C. Moseke: Physical and chemical nical properties and fracture behavior of hydrogen characterization of Ag-doped Ti coatings produced charged AHSS/UHSS grades at high and low strain by magnetron sputtering of modular targets. Mater. rate tests. Mater. Sci. Engng. A590 (2014) 360-367. Sci. Engng. C44 (2014) 126-131. DOI: 10.1016/j. DOI: 10.1016/j.msea.2013.10.044 msec.2014.08.024 ■ J. Lu, G. Riedl, B. Kiniger, E.A. Werner: Three- ■ M. Li, E. Werner, J.-H. You: Fracture mechanical dimensional tool design for steady-state electro- analysis of tungsten armor failure of a water-cooled chemical machining by continuous adjoint-based divertor target. Fusion Engn. and Design 89 (2014) shape optimization. Chem. Engng. Sci. 106 (2014) 2716-2725. DOI: 10.1016/j.fusengdes.2014.07.011 198-210. DOI: 10.1016/j.ces.2013.11.040 ■ F. Meier, C. Schwarz, E. Werner: Crystal-plasticity ■ ,4GJTN#2KEJNGT-/TCE\GM'9GTPGT +PƅWGPEG based thermo-mechanical modeling of Al-com- of microstructure and Ti(C,N) in the susceptibility ponents in integrated circuits. Comput. Mater. to hydrogen embrittlement of AHSS grades for Sci. 94 (2014) 122-131. DOI: 10.1016/j.com- the automotive industry. In: Proc. of International matsci.2014.03.020 Hydrogen Conference (IHC 2012): Hydrogen-Mate- ■ C. Krempaszky, P. Larour, J, Freudenthaler, E. rials Interactions, B.P. Somerday, P. Sofronis (Eds.), 9GTPGT 6QYCTFUOQTGGHƄEKGPVJQNGGZRCPUKQPU ASME Press, New York, NY, USA (2014) 137-146. testing. In: Proc. of International Deep Drawing ■ J. Rehrl, K. Mraczek, A. Pichler, E. Werner: The Research Group (IDDRG 2014): Innovations for the impact of Nb, Ti, Zr, B, V and Mo on the hydrogen sheet metal industry, Paris, FR, June 1-4, 2014, H. diffusion in four different AHSS/UHSS microstruc- Sfar, A. Maillard (Eds.), (2014) 204-209 tures. Steel research int. 85 (2013) 336-346. DOI: 10.1002/srin.201300087 Institute of Materials Science and Mechanics of Materials 233 Institute of Biochemical Engineering Industrial biotechnology ■ Industrial biotechnology (‘white biotechnology’) makes use of micro- organisms or enzymes for the industrial production of chemicals like URGEKCNCPFƄPGEJGOKECNUDWKNFKPIDNQEMUHQTCITKEWNVWTCNQTRJCTOC- EGWVKECNRTQFWEVUCFFKVKXGUHQTOCPWHCEVWTKPICUYGNNCUDWNMEJGOKECNU and fuels. Renewable resources are the favored raw materials for industrial biotechnology. The Institute of Biochemical Engineering is dealing with all aspects of the technical use of biochemical reactions for industrial Prof. Dr.-Ing. biotechnology. The research focus is on Dirk Weuster-Botz bioreactors and biocatalysis, as well as on (gas-) fermentation and bioprocess Contact integration. www.biovt.mw.tum.de/ bioverfahrenstechnik [email protected] View into a stirred-tank bioreactor at the Institute of Phone +49.89.289.15712 $KQEJGOKECN'PIKPGGTKPI EQR[TKIJV 9GWUVGT$QV\ TUM) Bioreactors Highlight The license holder 2mag AG, Munich, Germany starts commercialization of the bioREACTOR48, a parallel stirred-tank bioreactor system developed at the Institute of Biochemical Engineering. Projects ■ High throughput reaction engineering analysis of halophilic microorganisms Gas-inducing stirrers for 48 parallel stirred-tank for enzyme production bioreactors (copyright: 2mag AG – www.2mag.de) ■ Continuous fermentations in miniatur- ized stirred-tank reactors The effective generation of process ■ Micro-dosing device and micro-sensors information represents a major bottleneck for pH control in parallel bioreactors in microbial production process develop- ■ Reaction engineering studies of butanol ment and optimization. An approach to fermentation with Clostridium aceto- overcome the necessity of a large number butylicum strains in parallel stirred-tank of time- and labor-consuming experiments reactors in lab-scale bioreactors is miniaturization and parallelization of stirred-tank reac- tors along with automation of process management. 234 Institute of Biochemical Engineering Biocatalysis High demands are set upon the optical purity of building-blocks for the pro- duction of pharmaceuticals. Due to the high natural selectivity of biocatalysts, biocatalysis appears as favorable method for the purpose of chiral syntheses. Major research interests are the development of new reaction engineering methods and devices to intensify whole cell biotransfor- mations of hydrophobic, unstable and/or toxic substrates up to the technical scale. Scheme of the intracellular reactions established in 'EQNKHQTVJGRTQFWEVKQPQHVJGEJQNKECEKFFGTKXCVKXG MGVQ7&%# EQR[TKIJV 5WP67/ Highlight The whole-cell biocatalytic process, developed at the Institute of Biochemical ■ Surface functionalisation of nano-scale Engineering for the production of a cholic enzyme membrane reactors acid derivative (pharmaceutically used for ■ Minimal cells for multi-enzyme syn- the non-surgical dissolution of gallstones) thesis was transferred to the industrial scale ■ Production of N-acetylneuraminic acid by the cooperation partner PharmaZell using epimerases from cyanobacteria GmbH, Raubling, Germany. ■ Stereoselective multi-step reduction of dehydrocholic acid with hydroxysteroid Projects dehydrogenases ■ Polymeric nano-compartments for ■ Asymmetric reductions using novel biocatalytic applications ene-reductases from cyanobacteria ■ Membrane functionalisation of nano- scale enzyme membrane reactors Fermentation Making use of microorganisms for the Projects production of chemicals from renewable ■ Bioprocess development for the resources is the core of industrial biotech- production of single-stranded DNA nology. Reaction engineering analyses of ■ Microbial electrosynthesis for the metabolically optimized producer strains production of chemicals and metabolic analyses of microorganisms ■ Metabolic analyses of recombinant in production processes are necessary for microorganisms from production GHƄEKGPVDKQRTQFWEVKQPQPCPKPFWUVTKCN processes scale. ■ Microbial production of lipids ■ Metabolic control Analysis of microbial Highlight fed-batch production of L-phenyl- The fermentation process optimized at alanine the Institute of Biochemical Engineering ■ Reaction engineering analysis of for the recombinant production of spider Escherichia coli for the production of a Pilot-scale fermentations were silk proteins with bacteria was transfer- hydrophobic spider silk protein performed at the TUM-Research Center for Industrial Biotechno- 3 red to the industrial scale (> 50 m ) by logy (copyright: TUM) the cooperation partner AMSilk GmbH, Planegg, Germany. Institute of Biochemical Engineering 235 Gas Fermentation Special microorganisms are able to Projects produce chemicals with carbon dioxide ■ Modeling of microalgae cultivation in as sole carbon source. Energy may be open photobioreactors supplied from sunlight or hydrogen gas. ■ Characterization of new microalgae for Bioprocess engineering is the key to open photobioreactors make use of these energy sources for the ■ Mass production of microalgae in open microbial production of chemicals from photobioreactors carbon dioxide on an industrial scale. ■ Reaction engineering analysis of new microalgae Highlight ■ Bioelectrosynthesis for the production 4GCEVKQPEQPFKVKQPUYGTGKFGPVKƄGFHQTVJG of chemicals from carbon dioxide ■ microbial production of acetate from CO2 Microbial production of chemicals from Flat-panel photo-bioreactor and H2 with Acetobacterium woodii resul- synthesis gas operated at the Institute of Bio- ting in the highest product con centrations ■ Hydrogenotrophic production of acetic chemical Engineering (copyright: -1 9GWUVGT$QV\67/ reported so far (> 60 g L ). acid Bioprocess Integration In many cases, downstream processing Projects is by far the most cost-intensive step of a ■ Non-stationary hydrodynamics of bioprocess. Often, multiple-step bio- chromatography columns separations are required yielding rather ■ 2TGRCTCVKXGRWTKƄECVKQPQHRTQVGKPUXKC low product yields. crystallization Therefore, existing bioseparation pro- ■ 2TGRCTCVKXGRWTKƄECVKQPQHRTQVGKPUXKC cesses should be improved and combined extraction to reduce the number of process steps. ■ 2WTKƄECVKQPCPFHQTOWNCVKQPQHC The focus is on bioprocess integration of therapeutic antibody by crystallization fermentation/biocatalysis and downstream ■ Protein crystallization in stirred-tank processing (and follow-up chemistry). reactors Crystal of a therapeutic monoclo- Highlight nal antibody produced in a stirred Process protein crystallization was shown ET[UVCNNK\GT EQR[TKIJV 5OGLMCN TUM) VQDGCPGHƄEKGPVUECNCDNGHCUVCPF inexpensive alternative to key steps of a UVCPFCTFRWTKƄECVKQPRTQEGUUHQTVJGTC- peutic antibodies. 236 Institute of Biochemical Engineering Research Focus Management ■ Micro-bioprocess engineering/bio- Prof. Dr.-Ing. Dirk Weuster-Botz, Director reactors ■ Biocatalysis Administrative Staff ■ Fermentation Ellen Truxius ■ Gas fermentation Gabriele Herbrik ■ Bioprocess integration Research Scientists Competence Dr. Kathrin Castiglione, TUM Junior Fellow ■ Design and automation of bioreactor Dr.-Ing. Dariusch Hekmat systems Dr.-Ing. Dominik Maslak ■ Bioprocess development and optimiza- Dipl.-Ing. Michael Weiner tion Dirk Hebel, M.Sc. (Dissertation 2013) ■ Metabolic analysis of microbial reac- Michael Schmidt, M.Sc. (Dissertation 2013) tions in bioreactors Benjamin Smejkal, M.Sc. (Dissertation ■ Metabolomics 2013) ■ Downstream processing Yilei Fu, M.Sc. (Dissertation 2013) Nils Janzen, M.Sc. (Dissertation 2014) Infrastructure Boqiao Sun, M.Sc. (Dissertation 2014) ■ Stirred-tank bioreactor systems up to Georg Faust, M.Sc. (Dissertation 2014) a 100 L-scale Ilka Sührer, M.Sc. ■ Flat-panel photobioreactor systems Christina Kantzow, M.Sc. with high-power LEDs Anna Groher, M.Sc. ■ Parallel bioreactor systems automated Andreas Schmideder, M.Sc. with lab-robots Ludwig Klermund, M.Sc. ■ Anaerobic work benches/sterile laminar Dipl.-Ing. Dipl.-Wirt.Ing. Andreas Apel ƅQYYQTMDGPEJGU Sarah Poschenrieder, M.Sc. ■ Syngas labs (CO2, CO, H2) Julia Tröndle, M.Sc. ■ Phage lab Tom Schwarzer, M.Sc. ■ Cooled lab (4° C) Anja Koller, M.Sc. ■ Electronic/mechanical work shop Andrea Weber, M.Sc. ■ #PCN[VKECNNCD .%/5ƅQYE[VQOGVT[ Benjamin Kick, M.Sc. GC, LC, …) Sarah Hintermayer, M.Sc. Eva Schußmann, M.Sc. Courses Kathrin Doll, M.Sc. ■ Biochemical Engineering Fundamentals Martin Dorn, M.Sc. ■ Biochemical Engineering %JTKUVKPC2HCHƄPIGT/5E ■ Bioprocesses Timm Severin, M.Sc. ■ Bioprocesses and Bioproduction ■ Industrial Bioprocesses Technical Staff ■ Bioreactors/Bioreaction Engineering Georg Kojro ■ Environmental and Biochemical Norbert Werth Engineering Markus Amann ■ Separation of macromolecular bio- Florian Sedlmaier products ■ Practical training on biochemical engineering ■ Practical training on bioprocess engineering Institute of Biochemical Engineering 237 Publications 2013-14 ■ Albermann C, Weiner M, Tröndle J, Weuster-Botz D, ■ Riedlberger P, Brüning S, Weuster-Botz D (2013): Sprenger GA (2014): Utilization of organophosphate: Characterization of stirrers for screening studies of phosphate antitransporter for isotope-labeling enzymatic biomass hydrolyses on a milliliter-scale. experiments in E. coli. FEMS Microbiol Lett 361: Bioproc Biosys Eng 36: 927-935. 52-61. ■ Smejkal B, Agrawal NJ, Helk B, Schulz H, Giffard ■ Bendig C, Weuster-Botz D (2013): Reaction M, Mechelke M, Ortner F, Heckmeier P, Trout BL, engineering analysis of cellulase production with *GMOCV& (CUVCPFUECNCDNGRWTKƄECVKQPQH Trichoderma reesei RUT-C30 with intermittent a therapeutic full-length antibody based on process substrate supply. Bioproc Biosys Eng 36: 893-900. crystallization. Biotechnol Bioeng 110: 2452-2461. ■ Brüning S, Weuster-Botz D (2014): CFD analysis of ■ Smejkal B, Helk B, Rondeau JM, Anton S, Wilke interphase mass transfer and energy dissipation in A, Scheyerer P, Fries J, Hekmat D, Weuster-Botz D COKNNKNKVGTUECNGUVKTTGFVCPMTGCEVQTHQTƄNCOGPVQWU (2013): Protein crystallization in stirred systems – microorganisms. Chem Eng Res Des 92: 240-248. Scale-up via the maximum local energy dissipation. ■ Delhomme C, Schaper LA, Zhang-Preße M, Rau- Biotechnol Bioeng 110: 1956-1963. daschl-Sieber G, Weuster-Botz D, Kühn FE (2013): ■ Straub M, Demler M, Weuster-Botz D, Dürre P Catalytic hydrogenation of levulinic acid in aqueous (2014): Selective enhancement of autotrophic phase. J Organomet Chem 724: 297-299. CEVGVCVGRTQFWEVKQPYKVJIGPGVKECNN[OQFKƄGF ■ Faust G, Janzen N, Bendig C, Römer L, Kaufmann Acetobacterium woodii. J Biotechnol 178: 67-72. K, Weuster-Botz D (2014): Feeding strategies ■ Sührer I, Haslbeck M, Castiglione K (2014): enhance high cell density cultivation and protein Asymmetric synthesis of a Fluoxetin precursor expression in milliliter-scale bioreactors. Biotechnol YKVJCPCTVKƄEKCNHWUKQPRTQVGKPQHCMGVQTGFWEVCUG J 9: 1293-1303. and a formate dehydrogenase. Proc Biochem 49: ■ Fu Y, Castiglione K, Weuster-Botz D (2013): Com- 1527-1532. parative characterization of novel ene-reductases ■ Sun B, Kantzow C, Bresch S, Castiglione K, from cyanobacteria. Biotechnol Bioeng 110: 1293- Weuster-Botz D (2013): Multi-enzymatic one- 1301. pot reduction of dehydrocholic acid to 12- ■ Hebel D, Huber S, Stanislawski B, Hekmat D ketoursodeoxycholic acid with whole-cell (2013): Stirred batch crystallization of a therapeutic biocatalysts. Biotechnol Bioeng 110: 68-77. antibody fragment. J Biotechnol 166: 206-211. ■ Weiner M, Albermann C, Gottlieb K, Sprenger GA, ■ Hebel D, Ürdingen M, Hekmat D, Weuster-Botz D Weuster-Botz D (2014): Fed-batch production of (2013): Development and scale-up of high-yield L-phenylalanine from glycerol and ammonia with crystallization processes of lysozyme and lipase recombinant Escherichia coli. Biochem Eng J 83: using additives. Cryst Growth Des 13: 2499-2506. 62-69. ■ Hekmat D, Kuhn M, Meinhardt V, Weuster-Botz ■ Weiner M, Tröndle J, Albermann C, Sprenger & /QFGNKPIQHVTCPUKGPVƅQYVJTQWIJC GA, Weuster-Botz D (2014): Carbon storage in viscoelastic preparative chromatography packing. re combinant Escherichia coli during growth on Biotechnol Prog 29: 958-967. glycerol and lactic acid. Biotechnol Bioeng, 111: ■ Hölsch K, Sührer I, Heusel M, Weuster-Botz D 2508-2519. (2013): Engineering of formate dehydrogenase: ■ Weiner M, Tröndle J, Albermann C, Sprenger GA, Synergistic effect of mutations affecting cofactor Weuster-Botz D (2014): Improvement of cons- URGEKƄEKV[CPFEJGOKECNUVCDKNKV[#RRN/KETQDKQN VTCKPVDCUGFƅWZGUVKOCVKQPFWTKPI.RJGP[NCNCPKPG Biotechnol 97: 2473-2481. production with Escherichia coli using targeted ■ Klermund L, Groher A, Castiglione K (2013): knock-out mutants. Biotechnol Bioeng 111: New N-acyl-D-glucosamine 2-epimerases from 1406-1416. cyanobacteria with high activity in the absence of ATP and low inhibition by pyruvate. J Biotechnol 168: 256-263. ■ Liu L, Braun M, Gebhardt G, Weuster-Botz D, Gross R, Schmid RD (2013): One step synthesis of 12-ketoursodeoxycholic acid from dehydrocholic acid using a multienzymatic system. Appl Microbiol Biotechnol 97: 633-639. 238 Institute of Biochemical Engineering Institute of Medical and Polymer Engineering Medical and polymer engineering, process & manufacturing method development, sterile production, vascular and cardiac engineering ■ The Institute of Medical and Polymer Technology inaugurated the Cen- tral Institute for Medical Engineering in 2000 and established in the same [GCTVJG/CUVGTU%WTTKEWNWOQH/GFKECN'PIKPGGTKPIVJGƄTUVQPGQHKVU kind on university level in Germany, and it offers a comprehensive curricu- lum in medical engineering and in polymer engineering. Today more than 400 students follow the Institutes courses and seminars every semester. Teaching is focused on industrial and clinical needs primarily. The Institute represents two main and tion molding is a key research area. interacting focus areas: This includes the entire designing and manufacturing process of tools, Prof. Dr. med. Dr.-Ing. A) Medical engineering with a strong devices and machines, i.e. the most habil. Erich Wintermantel impact on biocompatible materials compact injection molding machine engineering, mainly process engineer- worldwide has been designed and Contact ing of materials and designing of tools, manufactured by us. www.medtech.mw.tum.de OQNFUCPFRCTVUURGEKƄGFHQTOGFKECN [email protected] implants made from non-metallic orga- Research currently concentrates on three Phone +49.89.289.16701 nic materials. It develops new surfaces main areas: and structures of materials-cell-interfa- 1) Hemocompatible and hemoactive ces, i.e. porosities, in order to optimize surfaces, biosystems, devices and biocompatibility behaviour following implants and corresponding relevant implantation in patients. It provides manufacturing processes, respective testing, including biotoxicity 2) Functionalized polymeric implants testing and the development of tissue through process engineering, engineering systems. 3) Improved polymers, process tooling B) Polymer engineering and tooling is CPFCPCN[UKUVQQNUKGUWTHCEGOQFKƄ- intensively represented with an outstan- cation or materials reinforcements, all ding polymer technology infrastructure. strictly oriented towards high socioeco- All industrially relevant processes are nomic impact. presented in teaching, micro-injec- Research Example Autosterility: Fundamentals and Experimental Examination of Polymer Processing Technology Sterile medical single use products are KPFKURGPUCDNGVQHWNƄNNOCP[VCUMUYKVJKP medicine. To date, the manufacturing and sterilization processes are separated steps within the production of sterile medical products. This research work focuses on the autosterile polymer molding without subsequent sterilization. Sub-steps of the manufacturing chain are investigated by © Schönberger, M., 2014 validation methods for sterility with focus on the autosterile production. An auto- developed with recommendation concern- sterile injection molding concept has been ing validation and implementation. Institute of Medical and Polymer Engineering 239 Research Example Hematogenous Growth Factors: Isolation, Application and Biological Activity Hematogenous, autologous platelet deri- ved growth factors represent a promising new wound care concept. Optimized preparation of platelet concentrate from patient‘s whole blood and an innovative hand-held device for application to wound surfaces is developed. Subsequently the biological activity is evaluated in vitro. Correlations between preparation process, state of platelet activation and the proliferation-promoting effect of the © Wacker, S., 2013 concentrates are worked out. Research Focus Courses ■ Vascular and cardiac engineering ■ Introduction in Medical and Polymer ■ Medical polymer engineering Technology ■ Machine and process technology ■ Basics Medical Engineering: Bio- ■ Polymer technology compatible Materials 1 ■ Sterile polymer manufacturing ■ Biocompatible Materials 2 ■ Implantology ■ Polymers and Polymer Technology ■ Drug release systems ■ Trends in Medical Engineering I & II ■ Research laboratories Competence ■ Polymer processing Management ■ Polymer testing Prof. Dr. med. Dr.-Ing. habil. Erich ■ Bio-/hemocompatibility testing Wintermantel, Director ■ Polymer aging Dr. med. Markus Eblenkamp, Assistant ■ Polymer design Director ■ Medical device design Susanne Wiedl ■ Polymer process simulation Dr.-Ing. Markus Schönberger ■ /GEJCPKECNCPFƅWKFF[PCOKE Dipl.-Ing. Miriam Haerst simulation ■ Virtual planning and modelling Adjunct Professors ■ Engineering medical devices Dr.-Ing. Marcus Heindl ■ Incubator and cell culture design Dr.-Ing. Christian Wende Infrastructure Administrative Staff ■ Tech lab (CNC milling machine, water Susanne Wiedl jet cutting, etc.) ■ $KQNCD 5ENCUUKƄGFHQTDKQJGOQ- Doctoral Candidates comp., sterility testing) and Research Scientists ■ Polymer lab (molding machines and Dipl.-Ing. Max Bauer testing) Dipl.-Ing. Cécile Boudot Dipl.-Ing. Andreas Brehm 240 Institute of Medical and Polymer Engineering Katharina Düregger, M.Sc. Technical Staff Dr. med. Markus Eblenkamp Uli Ebner (Master, supervisor) Johannes Gattinger, M.Sc. Georg Lerchl Markus Geith, M.Sc. Florian Huber Dipl.-Ing. Miriam Haerst Severin Lindemeier Dipl.-Ing. Sebastian Koller Martin Streifeneder Dipl.-Ing. Fabian König Peter Pichler Dipl.-Ing. Erhard Krampe Christian Gastinger Ana Lilia Nowak, B.Sc. Dipl.-Ing. (FH) Matthias Pigerl Research Students Christin Rapp, M.Sc. 15 research & teaching assistants Dipl.-Ing. Andreas Robeck 120 research theses (2013), > 8 per Peter Röstel, M.Sc. doctoral candidate Dr.-Ing. Markus Schönberger Dipl.-Ing. Catherine Schreiber Dipl.-Ing. Matthias Schuh Ilse Schunn, CTA Dipl.-Ing. Vera Seitz Publications 2013-14 ■ Boudot, C., Freihart, K., Linder, A., Eblenkamp, M., ■ Haerst, M., Seitz, V., Ahrens, M., Boudot, C., Haerst,M., Wintermantel, E.: Surface Functionaliza- Wintermantel, E.: Silicone Fiber Electrospinning for tion of Silicone Rubber for Improved Cell Adhesion. Medical Applications. 6th European Conference 48. Annual Conference of the DGBMT, 2014 of the International Federation for Medical and ■ Boudot, C., Recht, S., Eblenkamp, M., Haerst, M., Biological Engineering, IFMBE Proceedings, 2014 Wintermantel, E.: Protein Adsorption and Adhesion ■ Huppmann, T., Wintermantel, E.: Fighting Germs of Blood Platelets on Silicone Rubber under Static with Solar Energy. Kunststoffe International 104 (5), and Dynamic Flow Conditions.6th European Con- 2014, 60-63 ference of the International Federation for Medical ■ Huppmann, T., Wintermantel, E.: Geeignete and Biological Engineering, 2014 Matrixsysteme für titandioxidbasierte antimikrobielle ■ Dierkesmann, K., Krampe, E., Wintermantel, E.: Kunststoffe. VDI Fachtagung Kunststoffe in der Development of an MR-safe and MR-compatible Medizintechnik, 2014 ECVJGVGTIWKFGYKTGWUKPIECTDQPƄDGTTGKPHQTEGF ■ Huppmann, T., Wintermantel, E.: Geeignete plastics. Kunststoffprodukte in der Medizin - Endos- Matrixsysteme für titandioxidbasierte antimikrobielle kope und Katheter, 2014 Kunststoffe. VDI Kunststoffe in der Medizintechnik, ■ Eblenkamp, M., Haag, L., Pfeifer, S., Wintermantel, 2014, 127-138 E.: Software-Based System for Automatic 3D ■ Huppmann, T., Wintermantel, E.: Kampf dem Keim Dendritic Spine Evaluation for Research on Alz- durch Sonnenkraft. Kunststoffe 104 (5), 2014, 104-107 heimer’s Disease. 6th European Conference of the ■ Koller, S., Fiolka, A., Schneider, A., Schönberger, M., International Federation for Medical and Biological Wintermantel, E., Feußner, H.: Entwicklung eines Engineering, 2014, 138-141 Single-Use-Applikators für endoskopische Nieten ■ Froehlich, M., Strohmayr, M., Seibold, U., Krampe, bei NOTES-Eingriffen. Kunststoffprodukte in der E., Wintermantel, E.: Towards Realistic Haptic Medizin - Endoskope und Katheter, 2014 Organ Phantoms for Medical Training. 48th Annual ■ Rapp, C., Huppmann, T., Gattinger, J., Eblenkamp, Conference of the DGBMT, 2014 M., Wintermantel, E.: Improving the antibacterial ■ Gattinger, J., Schönberger, M., Wintermantel, E., effect of polyamide 12 by functionalization of Rau, A., Wolff, K.D., Loeffelbein, D.J.: Computer titanium dioxide nanoparticles. 48th Annual aided Modelling of Nasoalveolar Molding Devices Conference of the DGBMT, 2014 for Cleft Lip and Palate Treatment. 48th Annual ■ Schulte, J., Friedrich, A., Hollweck, T., König F., Conference of the DGBMT, 2014 Eblenkamp, M., Beiras-Fernandez A., Fano, C., ■ Haerst, M., Ahrens, M., Seitz, V., Wintermantel, E.: Hagl C., Akra B.: A Novel Seeding and Condition- Electrospinning of commercially available silicone ing Bioreactor for Vascular Tissue Engineering. rubber. 48th Annual Conference of the DGBMT, Processes 2 (3), 2014, 526-547 2014 ■ Schönberger, M., Hierl, F., Haerst, M., Wintermantel, ■ *CGTUV/'PIGNUKPI- 'KPƅØUUGXQP4GKPKIWPI E.: Suitability of Screw Plasticization for Autosterile Desinfektion und Sterilisation auf Kunststoffe in Injection Molding. Advances in Polymer Technology Medizinprodukten. Fachtagung Kunststoffprodukte 33 (2), 2014 in der Medizin - Endoskope und Katheter, 2014 Institute of Medical and Polymer Engineering 241 ■ Schönberger, M., Schaller, C., Seitz, V., Haerst, M., ■ Huppmann, T.: Antimicrobial Polymers – The Anti- Eblenkamp, M., Wintermantel, E.: Suitability of bacterial Effect of Photoactivated Nano Titanium OpenAir Plasma Beams for Medical Device Steriliza- Dioxide Polymer Composites. PPS 29, Nürnberg, tion. 48th Annual Conference of the DGBMT, 2014 2013 ■ Schönberger, M., Wintermantel, E., Hoffstetter, M: ■ Huppmann, T.: Antimikrobielle Wirkung von Autosterile injection molding (AIM): A new manu- Bauteilen aus Titandioxid-Kunststoff-Kompositen. facturing approach for medical single use products. 6J)166JGOGPVCIG)TGP\WPF1DGTƅÀEJGP- ANTEC 2014 - Proceedings of the Technical technik, 2013 Conference & Exhibition , 2014 ■ Huppmann, T., Hanselmann, N., Haller, N., Leon- ■ Schönberger, M., Wintermantel, E., Seitz, V., Hoffstet- hardt, S., Wintermantel, E.: Antimikrobielle Wirkung ter, M.: Reinraumfertigung: Autosterile Spritzgießpro- von Bauteilen aus Titandioxid-Kunststoff-Kompo- duktion. Kunststoffe 104 (5), 2014, 88-92 siten. Tagungsband 9. Thementage Grenz- und ■ Schönberger, M., Wintermantel, E., Seitz, V., 1DGTƅÀEJGPVGEJPKM Hoff stetter, M., Cleanroom production: Autosterile ■ Huppmann, T., Leonhardt, S., Schönberger, M., Injection Molding Production. Kunststoffe internati- Wintermantel, E.: Antimicrobial Activity of Titanium- onal, (5), 2014, pp. 50-53 Dioxide-Polyamide- Composites Depending on ■ Seitz, V., Hoffstetter, M., Haerst, M., Krampe, E., Hygroscopicity. Euromat 2013, 2013 Wintermantel, E.: Polymeric Hard-Soft-Combina- ■ Huppmann, T., Yatsenko, S., Leonhardt, S., tions by Multi-Component Injection Molding for Radovanovic, I., Bastian, M., Wintermantel, E.: Small Medical Devices. 48th Annual Conference of Antimicrobial polymers - the antibacterial effect the DGBMT, 2014 of photo activated nano titanium dioxyde polymer ■ Wiederer, C., Fröhlich, M., Krampe, E., Winterman- composite. Proceedings of the Polymer Processing tel, E., Strohmayr, M.: Towards tactile sensation in Society 29th Annual Meeting, 2013, 09-180 laparoscopic surgery. Kunststoffprodukte in der ■ -TWRRC5*ÀOOGTN55EJKHHGTU4-TCORG' Medizin - Endoskope und Katheter, 2014 9KPVGTOCPVGN' #PCN[UKUQHVJGƄNNKPIE[ENGCPF ■ Wolter, L., Eblenkamp, M., Schönberger, M., Haerst, automated determinatiopn of the change-over M., Wintermantel, E.: Finite-element-analysis of point with sensor systems on the machine and a six-hole tibia shaft locking plate to optimize the comparison with conventional switchover methods screw hole position. Biomedizinische Technik 59 (1), in injection molding. Proccedings of the Polymer 2014, 1136-1139 Processing Society 29th Annual Meeting, 2013 ■ Ziegelmeier, S., Panagiotis, C., Wöllecke, F., ■ Leonhardt, S., Huppmann, T., Wintermantel, E.: Tuck, C., Goodridge, R., Hague, R., Krampe, E., #PVKOKETQDKCNGHƄECE[QHVKVCPKWOFKQZKFG 6K1 Wintermantel, E.: An experimental study into the polypropylene (PP) composites. Bayern Innovativ GHHGEVUQHDWNMCPFƅQYDGJCXKQTQHNCUGTUKPVGTKPI - Forum Life Science 201313.03.2013 polymer powders on resulting part properties. ■ Mosdzinski, A., Haerst, M., Schönberger, M., Journal of Materials Processing Technology 215, Wintermantel, E., Engelsing, K., Heidemeyer, P.: 2014, 239-250 Clinical use of thermoplastic polymers - aging after ■ Bergmann, B., Wacker, S., Eblenkamp, M., hygienic reprocessing. Forum Life Science 2013 Wintermantel, E.: Wound healing induction with 201313./14.03.2013 platelet concentrates – evaluation of a new growth ■ Pertl, C., Eblenkamp, M., Pertl, A., Pfeifer, S., factor application system. Forum Life Science 2013 Wintermantel, E., Lochmuller, H., Walter, M., 201314.03.2013 Krause, S., Thirion, C.: A new web-based method ■ Dittmann, R., Wintermantel, E., Graule, T.: Sintering for automated analysis of muscle histology. BMC of nano-sized titania particles and the effect of chlo- Musculoskeletal Disorders 14 (1), 2013, 26 rine impurities. Journal of the European Ceramic ■ Ravichandran, R., Seitz, V., Reddy Venugopal, J., Society 33 (15-1 6), 2013, 3257-3264 Sridhar, R., Sundarrajan, S., Mukherjee, S., Win- ■ Frank, M. J., Walter, M. S., Lyngstadaas, S. P., termantel, E., Ramakrishna, S.: Mimicking Native Wintermantel, E., Haugen, H. J.: Hydrogen content Extracellular Matrix with Phytic Acid-Crosslinked in titanium and a titanium-zirconium alloy after 2TQVGKP0CPQƄDGTUHQT%CTFKCE6KUUWG'PIKPGGTKPI acid etching. Materials Science & Engineering Macromolecular Bioscience 13 (3), 2013, 366-375 C-Materials for Biological Applications 33 (3), 2013, ■ Ravichandran, R., Venugopal, J. R., Mueller, M., 1282-1288 Sundarrajan, S., Mukherjee, S., Pliska, D., Winter- ■ Haerst, M., Wintermantel, E., Krampe, E., Schön- mantel, E., Ramakrishna, S.: Buckled structures and berger, M., Engelsing, K., Heidemeyer, P.: Effect of 5-azacytidine enhance cardiogenic differentiation of Repeated Sterilization. Kunststoffe 103 (2), 2013, adipose-derived stem cells. Nanomedicine 8 (12), 54-57 2013, 1985-1997 ■ Haerst, M., Wintermantel, E., Krampe, E., Schön- ■ Thierfelder, N., Koenig, F., Bombien, R., Fano, C., berger, M., Engelsing, K., Heidemeyer, P.: Aus- Reichart, B., Wintermantel, E., Schmitz, C., Akra, wirkung der Mehrfachsterilisation. Kunststoffe 103 B.: In Vitro Comparison of Novel Polyurethane (2), 2013, 82-85 Aortic Valves and Homografts After Seeding and ■ Herrmann, F. E. M., Lehner, A., Hollweck, T., Haas, Conditioning. ASAIO Journal 59 (3), 2013, 309-316 U., Fano, C., Fehrenbach, D., Kozlik-Feldmann, R., ■ Wagner, D., Staack, H., Krampe, E., Klaus, C., Wintermantel, E., Eissner, G., Hagl, C., Akra, B.: In Wintermantel, E.: Systematic design approach for vitro biological and mechanical evaluation of various FRP components in electric energy storage systems scaffold materials for myocardial tissue engineering. of hybrid electric vehicles. Polymer Processing Journal of Biomedical Materials Research - Part A, Society 29th Annual Meeting 2013 2013 ■ Wolff, T., Lasso, A., Eblenkamp, M., Wintermantel, ■ Horper, M., Kohn, N., Horst, G., Koller, S., Fiolka, A., E., Fichtinger, G.: C-arm angle measurement with Schneider, A., Krampe, E., Feußner, H., Ulbrich, H., accelerometer for brachytherapy: an accuracy Wintermantel, E.: A visualization chain for mecha- study. International Journal of Computer Assisted tronic platforms in single-port surgery and NOTES. Radiology and Surgery, 2013, 1-8 1st Russian-German Conference on Biomedical Engineering, 201323-24.10.2013 242 Institute of Medical and Polymer Engineering Institute for Machine Tools and Manufacturing Technology Perspectives for production ■ In 2013-14, the focus of the Chair for Machine Tools and Production Engineering was on the machining of materials and the processing thereof into composite materials. With emphasis being placed on light-weight design, new production processes were researched and further optimized using suitable simulation models. With regard to light-weight structures that are optimally adapted to the respective loads, bionic approaches such as the adaptation of natural honeycomb and grid structures have proven to be particularly suitable for achieving the desired goals in Prof. Dr.-Ing. the area of additive production processes. Michael F. Zaeh With the objective to use the suitable material in any location, the research Contact is focusing in the area of joining and www.iwb.tum.de separating technology on producing joints [email protected] of different metals or metal to plastics that 2JQPG so far could not be produced. Thermal production, from which mainly small and simulations for joining processes have medium-sized companies in the Bavarian- proven their particular potential, which 5YCDKCPTGIKQPDGPGƄV allow innovative production processes A highlight was the inauguration of the with respect to the production of lithium- research production line for lithium-ion- ion cells. cells. Together with press representatives For the last 20 years, the Application and all involved project partners, the iwb is Center Augsburg has transferred the new RTQWFVQQRGPWR67/oUƄTUVHWNNTGUGCTEJ production technologies to the industrial RTQFWEVKQPNKPGQHKVUMKPFKP,WN[| Machine Tools ation of aspects of instrumentation and control, the study horizon is expanded beyond purely mechanical structures to the complex overall mechatronic system. Modern simulation methods such as the ƄPKVGGNGOGPVUCPFOWNVKRNGDQF[UKOW- lation, are used for these examinations to DGCDNGVQTGƅGEVVJGOCEJKPGHGCVWTGUKP detail. By coupling these with developed cutting-force models, interactions between structure and process can be In the context of the Machine Tools work- demonstrated. Furthermore, energy- ing group, we are dealing with the analysis related aspects that are also interacting and optimization of cutting production with the machine properties, are in the systems. The studies focus on the exami- focus of the investigations. The energy nation of the dynamic machine behaviour, GHƄEKGPE[QHOCEJKPGVQQNUKUDGEQOKPI VJGEWVVKPIRTQEGUUCPFVJGKPƅWGPEKPI more and more a competitive factor. thermal factors. Thanks to the consider- Institute for Machine Tools and Manufacturing Technology 243 Projects ■ (14'PGTI[s62 ETGCVKQPQHVTCPU ■ TOPOS: development, production and parency on the energetic behaviour and testing of topology-optimized osteo- GPGTI[ƅGZKDKNKV[QHHCEVQTKGU synthesis ■ FOREnergy – TP 2: increase system ■ Simulation methods as basis for ƅGZKDKNKV[VQEQPVTQNVJGFGOCPFHQT autonomous production units energy and manage energetic load ■ FORCiM3A – TP 7: system validation peaks and evaluation of the technology ■ BaZMod: component-adjusted machine readiness level of CRP/Metal-compo- EQPƄIWTCVKQPKPRTQFWEVKQPVJTQWIJ site structures in machinery and plant additional cyber-physical modules engineering ■ DynaMoRe: increase in dynamics of ■ (14++s62 UKOWNCVKQPQH galvanometer laser scanners through damping effects in machine tools model-based control ■ 522 EQWRNKPIQHCPCN[VKECNCPF ■ '& KPETGCUGKPGPGTI[GHƄEKGPE[ numerical models to simulate thermo- through damping of machine structures mechanical interactions during the milling of complex workpieces ■ DynSpann: process-related dynamic cutting to reduce distortion and internal stress during the welding of compo- nents Manufacturing Processes ■ Additive production ■ Quality assurance ■ Handling technologies for products varying in shapes ■ Designing manual and hybrid assembly systems Projects ■ AeroSim – development of a selective laser melting (SLM) simulation tool for aero engine applications ■ AMMag – laser melting of magnesium alloys ■ (NGZKEWVsƅGZKDNGKPVGNNKIGPVRTQEGUUKPI VGEJPQNQIKGUHQTEQORNGZƄDGTEQORQ- The iwb Application Center Augsburg site components (AzA) is the technology transfer centre ■ FORCiM3A – CFK/metal-compo- of the Institute for Machine Tools and site design in machinery and plant Industrial Management at the Technical engineer ing, TP 6: quality and structure University Munich. As part of this activity, testing of hybrid CFK components the AzA supports particularly the medi- ■ IDe3D – intelligent deformation com- um-sized industry in Bavaria with the pensation in 3D-print know-how of the university in the area of ■ ThermoQS – thermographic layer production engineering in the long term. monitoring during laser melting 6JGHQNNQYKPIHQWTTGUGCTEJƄGNFUCTG offered at the iwb Application Center Augsburg: 244 Institute for Machine Tools and Manufacturing Technology Joining and Cutting Technology ■ Friction stir processing (FSP) to increase the performance of aluminium cast components ■ FOREL: research and technology cen- VGTHQTTGUQWTEGGHƄEKGPVNKIJVYGKIJV structures of electro mobility ■ ISAR: friction welding of tank structures for carrier rockets ■ Nexhos: next generation of high- 1PKVUYC[HTQOCUGOKƄPKUJGFVQC voltage batteries in light-weight ƄPKUJGFRTQFWEVVGEJPKECNRTQFWEVU construction generally go through several joining and ■ Optimization of parameters during separating steps that are particularly ƅ[YJGGNHTKEVKQPYGNFKPI relevant for the high quality and economic ■ RegTemp: temperature control during success of the production. The working friction stir welding group Joining and Separating Technology ■ ReLaTiS – modeling and simulation deals with this focal point and is working QHDGCOTGƅGEVKQPFWTKPIFGGR on innovative production processes. The penetration laser welding aim of the research and development ■ 522 PFHWPFKPIRJCUG DKPFKPI activities is the optimization of quality- and mechanisms during friction stir welding RTQFWEVKXKV[QRVKOK\GFCPFUEKGPVKƄECNN[ of mixed compounds sound production processes. To this ■ 646 NCUGTYGNFKPIQHECTDQF[ end, machinery with modern laser beam parts in visible seam quality sources, friction welding equipment and a ■ ZAktiSiLA: design and development of wide range of measuring and analysis a prototype of a centrally active safety instruments is at the disposal of the device for the monitoring of remote working group. The competences of the high-performance laser beam systems working range from process analysis, in industrial applications system technology and technology ■ eProduction – competence in the pro- consulting to simulation. duction of high-energy storage systems for electromobility Projects ■ PaLaSi – passive laser safety for ■ ExZellTUM: Excellence Center for high-performance lasers in industrial battery cells at the Technical University applications Munich ■ ISAR: innovative SpinForm process for ■ EEBat: decentralized stationary battery high-strength aluminium alloys with UVQTCIGHQTVJGGHƄEKGPVWUGQHTGPGY friction stir welding technology able energies and to support network ■ ZaktiSiLa: central active laser safety stability Institute for Machine Tools and Manufacturing Technology 245 Research Focus Management ■ Machine tools Prof. Dr.-Ing. Michael F. Zaeh, Director ■ Joining and separation technology Marion Fritsch, Secretary ■ Production engineering Adjunct Professors Competence Hon.-Prof. Dr.-Ing. Christian Lammel ■ Weak-point analysis of production Hon.-Prof. Dipl.-Ing. Siegfried Petz systems ■ Experimental and computer-aided Visiting Lectures development support Dr.-Ing. Marco Einhaus ■ Optimization of development and Dipl.-Ing. Peter Göttel production processes ■ Technology screening, analysis and Administrative Staff evaluation Dipl.-Ing. Mareile Dörge ■ Laser-based production technologies Bianca Einfalt ■ Friction welding Sandra Wallentin ■ Simulation of production processes Regina Spitzer ■ Innovative production technologies ■ Simulation-assisted optimization of Research Scientists production processes Dipl.-Ing. Alexander Belitzki ■ Quality assurance of production Dr.-Ing. Stefan Braunreuther processes Dipl.-Wirt.-Ing. Conrad Fischbach ■ Designing process chains Andreas Ganser, M.Sc. Christian Gebbe, M.Sc. Infrastructure Dipl.-Ing. Martin Haubold ■ Cutting machine tools Dipl.-Ing. Michael Jelinek ■ Laser tools Manuel Keßler, M.Eng. ■ Friction welding equipment Robin Kleinwort, M.Sc. ■ Industrial robots Dipl.-Ing. Markus Krutzlinger ■ Environmental, safety and teaching Corinna Liebl, M.Sc. laboratories Stefan Liebl, M.Sc. ■ Energetic and geometrical parameters Dipl.-Ing. (FH) Johannes Löhe ■ Material analysis systems Florian Lugauer, M.Sc. ■ Simulation environments Dipl.-Ing. Clemens Marder Dipl.-Ing. Klemens Niehues Courses Dipl.-Ing. Sebastian Pieczona ■ Manufacturing Technologies Dipl.-Ing. Richard Popp ■ Joining Technology Christian Rebelein, M.Sc. ■ Principles of Engineering Design and Dipl.-Ing. Christoph Julius Richter Production Systems Dipl.-Ing. Philipp Rinck ■ Laser Technology Dipl.-Ing. Oliver Rösch ■ Machine Elements and Manufacturing Dipl.-Ing. Andreas Roth ■ Quality Management Dipl.-Ing. Philipp Schmidt ■ Metal Cutting Manufacturing Processes Patrick Schmitz, M.Sc. ■ Metal Cutting Machine Tools Dipl.-Ing. Stefan Schwarz ■ Structural Behaviour of Machine Tools Markus Schweier, M.Sc. ■ Practical Course Mechatronic Develop- Dipl.-Ing. Peter Seebach ment of Machine Tools Dipl.-Ing. Christian Seidel ■ Practical Course Welding Technologies Dipl.-Ing. Tobias Steinhäußer ■ Practical Course Metal Cutting Machine Dipl.-Ing. Johannes Stock Tools Cosima Stocker, M.Eng. 246 Institute for Machine Tools and Manufacturing Technology Dipl.-Ing. Sahin Sünger Alexander Degenhart Dipl.-Ing. Georgios Theodossiadis Andreas Grünwald Dipl.-Ing. Franz Xaver Wirth Wolfgang Rissling Stefan Seidl Technical Staff Gerhard Sigl Armin Braun Rainer Sollfrank Gerhard Brethack Kurt Wagner Publications 2013-14 ■ Fuchs, A. N.; Zäh, M. F. Gasgeführtes Laserstrahl- ■ Foeckerer, T.; Zaeh, M. F.; Zhang, O. B. A schneiden von CF-Preforms. wt Werkstattstechnik Three-Dimensional Analytical Model to Predict the QPNKPG RR Thermo-Metallurgical Effects within the Surface ■ Fuchs, A. N.; Zäh, M. F.; Heckert, A.; Roth, A.; Layer during Grinding and Grind-Hardening. Schmidt, P.; Schmitz, P. Neue Werkstoffe für die ■ +PVGTPCVKQPCN,QWTPCNQH*GCVCPF/CUU6TCPUHGT Elektromobilität erfordern angepasste Füge- und RR Trennverfahren. Automobiltechnologie in Bayern ■ Fuchs, A.; Schoeberl, M.; Tremmer, J.; Zaeh, M. RR .CUGTEWVVKPIQHECTDQPƄDTGHCDTKEU6JG.CUGT7UGT ■ Fuchs, A. N.; Zäh, M. F.; Heckert, A.; Roth, A.; #WVWOPRR Schmidt, P.; Schmitz, P. New materials used in ■ Fuchs, A.; Schoeberl, M.; Tremmer, J.; Zaeh, M. electric vehicles require the adaptation of joining .CUGTEWVVKPIQHECTDQPƄDTGHCDTKEU+P 'OOGN- and cutting processes. Automotive Technology in mann, C. et al. (Hrsg.): Physics Procedia. Munich, $CXCTKC RR /C[2JKNCFGNRJKC 'NUGXKGT ■ Koch, J.; Maisenbacher, S.; Maurer, M.; Reinhart, RR| G.; Zäh, M. F. Structural modeling of extended ■ Koch, J.; Plehn, C.; Reinhart, G.; Zaeh, M. F. manufacturing systems – an approach to support Cycle Management for Continuous Manufacturing EJCPIGCDKNKV[D[TGEQPƄIWTCVKQPRNCPPKPI+P %+42 Planning. In: Zaeh, M. F. (Hrsg.): *TUI 2TQEGFKC%+42#OUVGTFCO 'NUGXKGT ■ Enabling Manufacturing Competitiveness and RR 'EQPQOKE5WUVCKPCDKNKV[ 5RTKPIGT8GTNCI ■ Lugauer, F. P.; Braunreuther, S.; Wiedenmann, R.; RR|+5$0 Zäh, M. F. Laser Intensity as a Basis for the Design ■ Koch, J.; Plehn, C.; Reinhart, G.; Zäh, M. F. of Passive Laser Safety Barriers – A Dangerous Zyklenmodellierung für die Produktionsplanung. #RRTQCEJ2J[UKEU2TQEGFKC RR <[MNGPOCPCIGOGPV#MVWGNN ■ Krol, T. A.; Seidel, C.; Schilp, J.; Hofmann, M.; Gan, ■ Lugauer, F. P.; Wiedenmann, R.; Braunreuther, S.; 9 Institute for Machine Tools and Manufacturing Technology 247 ■ Schmidt, P.; Zaeh, M. F. Analysis of Joining ■ Wiedenmann et al. R.; Schilp, H.; Kohnhäuser, M. Technologies for the Electrical Contact between Laserstrahlschweißen von Kupferwerkstoff mit Lithium-Ion Cells in Automotive Battery Systems. unterschiedlichen Strahlquellen. wt Werkstattstech- In: Haus der Technik (Hrsg.): Kraftwerk Batterie. PKMQPNKPG RR ■ Zaeh, M. F. (Hrsg.)Enabling Manufacturing Com- ■ Schweier, M.; Haubold, M. W.; Heins, J. F.; Zaeh, petitiveness and Economic Sustainability: Springer M. F. Spatter formation in laser welding with beam 8GTNCI+5$0 oscillation. In: Schmidt, M. et al. (Hrsg.): Lasers ■ Zaeh, M. F.; Seidel, C.; Riss, F. Wirtschaftliche KP/CPWHCEVWTKPI/WPKEJ additive Fertigung durch funktionsintegrierten #OUVGTFCO 'NUGXKGTRR Leichtbau. In: Reinhart, G. et al. (Hrsg.): Augs- ■ Seidel, C.; Zaeh, M. F.; Weirather, J.; Wunderer, M.; burger Seminar für additive Fertigung. Augsburg, Krol, T. A.; Schilp, J.; Groth, C.; Stroebele, B. S. /ØPEJGP 7V\8GTNCIRR Simulation of the laser beam melting process – an +5$0 CRRTQCEJHQTCPGHƄEKGPVIGQOGVT[OQFGNNKPIQH ■ Zäh, M. F.; Löhe, J. Die Werkzeugmaschine complex lightweight parts. In: Deutsche Gesell- FGT 248 Institute for Machine Tools and Manufacturing Technology Appendix Habilitations 2013-14 Name Topic Mentor Date Dr.-Ing. Thomas Indinger Aktuelle Herausforderungen in der Automobilaerodynamik Prof. Dr.-Ing. Adams March 20, 2013 (in Form einer Kumulation von 25 Fachpublikationen) Dr. rer. nat. Marco Ellero 6QYCTFUEQORWVCVKQPCNOKETQƅWKFKEU EQORNGZƅQYQHEQORNGZ Prof. Dr.-Ing. Adams July 7, 2013 ƅWKFU KP(QTOGKPGT-WOWNCVKQPXQP(CEJRWDNKMCVKQPGP Doctorates 2013-14 Name Topic Supervisor Date Dr.-Ing. Christian Krämer Ergonomische Optimierung des Handbike-Antriebes Prof. Dr.-Ing. Senner January 8, 2013 Dr.-Ing. Florian Ettner 'HƄ\KGPVGPWOGTKUEJG5KOWNCVKQPFGU&GƅCITCVKQPU&GVQPC- Prof. Dr.-Ing. Sattelmayer January 10, 2013 tions-Übergangs Dr.-Ing. Delia Ilie Systematisiertes Ziele- und Anforderungsmanagement in der Prof. Dr.-Ing. Lindemann January 17, 2013 (CJT\GWIGPVYKEMNWPI Dr.-Ing. Gero Bansemir Konstruktionsleitsystem für den durchgängig rechnerbasierten Prof. i. R. Dr.-Ing. Höhn January 18, 2013 Appendix 249 Name Topic Supervisor Date Dr.-Ing. Jörg Egbers +FGPVKƄMCVKQPWPF#FCRVKQPXQP#TDGKVURNÀV\GPHØTNGKUVWPIU Prof. Dr.-Ing. Reinhart March 21, 2013 IGYCPFGNVG/KVCTDGKVGTGPVNCPIFGU/QPVCIGRNCPWPIURTQ\GUUGU Dr.-Ing. Philipp Böck 'KPƅWUUPGWCTVKIGT(NWI\GWIMQP\GRVGCWHFKG(NWIJCHGPMCRC\KVÀV Prof. Dr.-Ing. Hornung March 21, 2013 Dr.-Ing. Daniel Wiedemann Permanent magnet reluctance actuators for vibration testing Prof. i. R. Dr.-Ing. Ulbrich April 3, 2013 Dr.-Ing. Johann Becher 8CNKFCVKQPQHURGEVTCNICUTCFKCVKQPOQFGNUWPFGTQZ[HWGN Prof. Dr.-Ing. Spliethoff April 11, 2013 conditions Dr.-Ing. Thomas Maier-Eschenlohr 'KP5[UVGO\WT/KMTQ6GNGOCPKRWNCVKQPCO/KVVGNQJT Prof. Dr. Lüth April 12, 2013 &T+PI,QCEJKO5EJYKPI Über die Interaktion von transversalen akustischen Moden, Prof. Dr.-Ing. Sattelmayer April 18, 2013 5VTÒOWPIWPFFTCNNUVCDKNKUKGTVGT(NCOOGKP\[NKPFTKUEJGP(NCO- menrohren Dr.-Ing. Wolfram Remlinger #PCN[UGXQP5KEJVGKPUEJTÀPMWPIGPKO(CJT\GWI Prof. i. R. Dr. Bubb April 18, 2013 Dr.-Ing. Igor Pribicevic &KGUGNOQVQTKUEJG)GOKUEJDKNFWPIWPF8GTDTGPPWPIDGK'KP- Prof. Dr.-Ing. Sattelmayer April 22, 2013 URTKV\FTØEMGPDKU/RC Dr.-Ing. Wolfgang Wittmann %QORWVGTIGUVØV\VGITCƄUEJG2NCPWPIUWPF1RGTCVKQPUU[UVGOG Prof. Dr. Lüth April 29, 2013 HØTFKG*CNU0CUGP1JTGPEJKTWTIKG Dr.-Ing. Thomas Wenger 1RVKOKGTWPIWPF'PVYKEMNWPIPCXKIKGTVGT+PUVTWOGPVGHØTFKG Prof. Dr. Lüth April 29, 2013 *CNU0CUGP1JTGP%JKTWTIKG Dr.-Ing. Martin Knörr 4GFW\KGTWPIFGT8GTNWUVNGKUVWPIUUVTÒOGCO5[UVGO-QNDGP Prof. Dr.-Ing. Wachtmeister May 2, 2013 -QNDGPTKPIG<[NKPFGTNCWHDCJP Dr.-Ing. Peter Koller 5VGKIGTWPIFGT Dr.-Ing. Senthoorselvan CO2 separation by calcium looping from full and partial fuel Prof. Dr.-Ing. Spliethoff June 28, 2013 Sivalingam oxidation processes Dr.-Ing. Thomas Josef Schleich 6GORGTCVWTWPF8GTNWUVNGKUVWPIUXGTJCNVGPXQP9ÀN\NCIGTPKP Prof. i. R. Dr.-Ing. Höhn July 2, 2013 Getrieben Dr.-Ing. Johann-Paul Stemplinger Tragfähigkeit und Wirkungsgrad von Stirnradgetrieben bei Prof. i. R. Dr.-Ing. Höhn July 3, 2013 5EJOKGTWPIOKVJQEJXKUMQUGP(NWKFGPWPF(GVVGP0.)+WPF Dr.-Ing. Marc Leidenfrost 8CNKFKGTWPIFGT$GTGEJPWPIUOGVJQFG\WT.GDGPUFCWGTDGYGT- Prof. Dr. Werner July 9, 2013 tung von thermomechanisch beanspruchten Zylinderköpfen aus )WUUGKUGPOKV8GTOKEWNCTITCRJKV &T+PI#NGZCPFGT)ÒV\HTKGF #PCN[UGWPF8GTINGKEJHGTVKIWPIUVGEJPKUEJGT2TQ\GUUMGVVGPHØT Prof. Dr.-Ing. Zäh July 10, 2013 (NWI\GWIVTKGDYGTMU4QVQTGP Dr.-Ing. Michael Meyer 5KOWNCVKQPQHEQORNGZVWTDWNGPVƅQYUQPECTVGUKCPCFCRVKXG Prof. Dr.-Ing. Adams July 12, 2013 grids &T+PI&CPKGNC)GYCNF Waste heat recovery of stationary internal combustion engines Prof. Dr.-Ing. Spliethoff July 12, 2013 HQTRQYGTIGPGTCVKQP Dr.-Ing. Paul Maier-Komor +ORWNUOCIPGVUEJPGKFGPXQPFØPPYCPFKIGP*QJNRTQƄNGP Prof. i. R. Dr.-Ing. Hoffmann July 16, 2013 &T+PI&CPKGN.QTGP\ W»GTG'KPƅWUURCTCOGVGTCWH5KV\RQUKVKQPGPKO(CJT\GWI Prof. i. R. Dr. Bubb July 16, 2013 Dr.-Ing. Matthias Fürstenberger $GVTKGDUXGTJCNVGPXGTNWUVQRVKOKGTVGT-WPUVUVQHH\CJPTÀFGT Prof. i. R. Dr.-Ing. Höhn July 17, 2013 250 Appendix Name Topic Supervisor Date &T+PI/CTVKP/GT\ &[PCOKUEJGU4GFGRNQ[OGPVXQP5VGWGTWPIUUQHVYCTGKPXGT 2TQH&T+PI8QIGN*GWUGT July 18, 2013 VGKNVGP#WVQOCVKUKGTWPIUU[UVGOGPYÀJTGPFFGT.CWH\GKV Dr.-Ing. Fang Li Anforderungsermittlung an ein Beschreibungsmittel und 2TQH&T+PI8QIGN*GWUGT July 18, 2013 'TYGKVGTWPIGKPGT)GTÀVGDGUEJTGKDWPIUURTCEJGHØTFKGOQFWNCTG Automatisierung im Maschinen- und Anlagenbau Dr.-Ing. Felix Grödl 5KOWNCVKQPUVQQN\WT#WUNGIWPIVTCPUMWVCPGT'PGTIKGØDGTVTC- Prof. Dr. med. Dr.-Ing. July 19, 2013 gungssysteme Wintermantel Dr.-Ing. Philipp Hager Dynamic thermal modeling for moving objects on the moon Prof. Dr. Walter August 13, 2013 Dr.-Ing. Daniel Damböck #WVQOCVKQPUGHHGMVGKO(CJT\GWIsXQPFGT4GCMVKQP\WT¸DGT- Prof. Dr. Bengler September 6, 2013 nahme Dr.-Ing. Marcus Giglmaier Strömungsphysikalische Phänomene bei der gasdynamisch Prof. Dr.-Ing. Adams September 9, 2013 KPKVKKGTVGP2CTVKMGNGT\GWIWPI Dr.-Ing. Eric Lauer 0WOGTKECNUKOWNCVKQPCPFKPXGUVKICVKQPQHJKIJURGGFDWDDNG Prof. Dr.-Ing. Adams September 23, 2013 F[PCOKEUKPECXKVCVKPIƅQY Dr.-Ing. Christoph Schaupp .CTIG'FF[5KOWNCVKQPVWTDWNGPVGT8GTDTGPPWPIGKPGU9CUUGT- Prof. i. R. Dr.-Ing. Friedrich September 25, 2013 stoffstrahls in kompressibler Luftströmung &T+PI$GCV*GKP\GNOCPP +PVGTCMVKQP\YKUEJGP#GTQF[PCOKMWPFVJGTOKUEJGT#DUKEJGTWPI Prof. Dr.-Ing. Adams September 25, 2013 DGKOQFGTPGP0WV\HCJT\GWIMQP\GRVGP Dr.-Ing. Cornelia Hertl Sauerstoffdiffusionshärtung funktioneller metallischer Schichten Prof. Dr. Werner October 9, 2013 CWH6KVCPHØTFKGDKQOGFK\KPKUEJG#PYGPFWPI Dr.-Ing. Andreas Hubert 'OKUUKQPUOQFGNN\WT$GTGEJPWPIFGT2CTVKMGNGOKUUKQPGKPGU Prof. Dr.-Ing. Wachtmeister October 11, 2013 Dieselmotors insbesondere für den Transientbetrieb Dr.-Ing. Andreas Suhrer Generische Parametrik in der Simulation und Optimierung von Prof. Dr.-Ing. Baier October 15, 2013 -CTQUUGTKGMQP\GRVGP Dr.-Ing. Roland Spies 'PVYKEMNWPIWPF'XCNWKGTWPIGPGKPGU6QWEJRCFDGFKGPMQP\GRVU Prof. i. R. Dr. Bubb October 17, 2013 OKVCFCRVKXJCRVKUEJXGTÀPFGTNKEJGT1DGTƅÀEJG\WT/GPØDGFKG- PWPIKO(CJT\GWI Dr.-Ing. Andreas Gantner 'PVYKEMNWPIGKPGUGHƄ\KGPVGP5[UVGOUHØTFGP'PVYWTHWPFFKG Prof. i. R. Dr.-Ing. Schilling October 21, 2013 Optimierung von Francis Turbinen Dr.-Ing. Michael Hombauer )TCWƅGEMGPCP-GIGNTCFWPF*[RQKFXGT\CJPWPIGPWPFFGTGP Prof. i. R. Dr.-Ing. Höhn October 24, 2013 'KPƅWUUCWHFKG)TØDEJGPVTCIHÀJKIMGKV &T+PI(CDKCP)ØP\MQHGT 'NDQYUVTGPIVJOQFGNNNKPIHQTFKIKVCNJWOCPOQFGNU Prof. i. R. Dr. Bubb October 24, 2013 Dr.-Ing. Christian Schuhbauer &[PCOKECPFEQWRNGFUKOWNCVKQPQHVJG%EQCNƄTGFRQYGT Prof. Dr.-Ing. Spliethoff October 25, 2013 plant Dr.-Ing. Florian Kammergruber /QDKNGU8KTVWCN4GCNKV[5[UVGO\WT2NCPWPIWPF5EJWNWPIKPFGT Prof. Dr.-Ing. Günthner 0QXGODGT Logostik Dr.-Ing. Regine Wolff Ein intraoperatives optisches Messsystem für die Mund-, Kiefer- Prof. Dr. Lüth 0QXGODGT und Gesichtschirurgie &T+PI/W\KQ)TKNNK #PCN[UKUQHVJGWPUVGCF[DGJCXKQTKPUJQEMYCXGVWTDWNGPV Prof. Dr.-Ing. Adams 0QXGODGT boundary layer interaction Dr.-Ing. Mathieu Zellhuber High frequency response of auto-ignition and heat release to Prof. Polifke, Ph.D. 0QXGODGT acoustic perturbations Dr.-Ing. Sunpeth Cumnuantip .CPFKPIIGCTRQUKVKQPKPICPFUVTWEVWTCNOCUUQRVKOK\CVKQPHQTC Prof. Dr.-Ing. Baier 0QXGODGT NCTIGDNGPFGFYKPIDQF[CKTETCHV &T+PI&CPKGN/QTIGPYGEM /QFGNNKGTWPIFGU6TCPUHGTXGTJCNVGPUKO Appendix 251 Name Topic Supervisor Date Dr.-Ing. Michaela Brummer Wärmebehandelndes Heißisostatisches Pressen von Aluminium- Prof. i. R. Dr.-Ing. Hoffmann December 12, 2013 gusslegierungen Dr.-Ing. Josef Mayer 'KPƅWUUFGT1DGTƅÀEJGWPFFGU5EJOKGTUVQHHUCWHFCU Prof. i. R. Dr.-Ing. Höhn December 16, 2013 Reibungs verhalten im EHD-Kontakt Dr.-Ing. Johannes Pohl Adaption von Produktionsstrukturen unter Berücksichtigung von Prof. Dr.-Ing. Reinhart December 17, 2013 .GDGPU\[MNGP Dr.-Ing. Tobias Philipp 4(+&IGUVØV\VG2TQFWMVKQPUUVGWGTWPIUXGTHCJTGPHØTFKG*GTUVGN- Prof. Dr.-Ing. Reinhart December 17, 2013 lung von Bauteilen aus Faserverbundkunststoffen Dr.-Ing. Stefan Braunreuther 7PVGTUWEJWPIGP\WT.CUGTUKEJGTJGKVHØT/CVGTKCNDGCTDGKVWPIU Prof. Dr.-Ing. Zäh December 17, 2013 CPYGPFWPIGPOKVDTKNNCPVGP.CUGTUVTCJNSWGNNGP Dr.-Ing. Sabine Wacker *ÀOCVQIGPG9CEJUVWOUHCMVQTGP +UQNCVKQP#RRNKMCVKQPWPF Prof. Dr. med. Dr.-Ing. December 19, 2013 biologische Wirkung Wintermantel Dr.-Ing. Bernhard Schröer .ÒUWPIUMQORQPGPVG/GPUEJ0WV\GTUGKVKIG*CPFNWPIU- Prof. Dr.-Ing. Lindemann December 19, 2013 OÒINKEJMGKVGPCNU$CWUVGKPGHØTFKGMTGCVKXG'PVYKEMNWPIXQP Interaktionslösungen Dr.-Ing. Markus Pietras End-to-end simulation of teleoperated on-orbit robotics Prof. Dr. Walter January 13, 2014 Dr.-Ing. Max Wedekind %JCTCMVGTKUKGTWPIXQP5VGKƄIMGKVWPF(GUVKIMGKVJGVGTQIGP Prof. Dr.-Ing. Baier January 16, 2014 XGTUVÀTMVGT8GTDWPFUVTCPIRTGUURTQƄNG Dr.-Ing. Jannis Gikadi 2TGFKEVKQPQHCEQWUVKEOQFGUKPEQODWUVQTUWUKPINKPGCTK\GF Prof. Dr.-Ing. Sattelmayer January 16, 2014 navier-stokes equations in frequency space Dr.-Ing. Stephan Franke 5VTCVGIKGQTKGPVKGTVG8QTGPVYKEMNWPIMQORNGZGT2TQFWMVG Prof. Dr.-Ing. Lindemann January 17, 2014 2TQ\GUUGWPF/GVJQFGP\WT\KGNIGTKEJVGVGP-QORQPGPVGP GPVYKEMNWPICO$GKURKGN2MY Dr.-Ing. Jan Thomas Harder Optimal quality of service for space communication architectures Prof. Dr. Walter January 20, 2014 YKVJHQEWUQPTGCNVKOGVGNGQRGTCVGFURCEGETCHV Dr.-Ing. Wolfgang Schmid 'PVYKEMNWPIGKPGUCMVKXGP4CFVTÀIGTU\WT$GGKPƅWUUWPIFGU Prof. Dr.-Ing. Lienkamp January 30, 2014 (CJTXGTJCNVGPUXQP5VTC»GPHCJT\GWIGP Dr.-Ing. Tobias Brunner 'ZEKVCVKQPQHJGCVCPFOQOGPVWOVTCPURQTVKPVWTDWNGPVYCMG Prof. Dr.-Ing. Wengle January 30, 2014 ƅQY Dr.-Ing. Peter Philipp %GPVTCNK\GFCPF&KUVTKDWVGF/QXKPI*QTK\QP5VTCVGIKGUHQT5VCVG Prof Dr.-Ing. Lohmann January 31, 2014 'UVKOCVKQPQH0GVYQTMGF%QPVTQN5[UVGOU Dr.-Ing. Qian Xu Extended Surrogate Modeling Techniques for Large Scale Prof. Dr.-Ing. Baier February 10, 2014 5VTWEVWTCN&GUKIP1RVKOK\CVKQP Dr.-Ing. Dino Bortot Ergonomic Human-Robot Coexistence in the Branch of Produc- Prof. Dr. Bengler February 10, 2014 tion Dr.-Ing. Martin Rosenberger 4GIGNWPITCFPCJGTGNGMVTKUEJGT'KP\GNTCFCPVTKGDGYÀJTGPFFGT Prof. Dr.-Ing. Lienkamp February 13, 2014 ABS-Bremsung Dr.-Ing. Sonja Huber +PUKVW.GIKGTWPIUDGUVKOOWPIDGKO.CUGTUVTCJNUEJYGK»GP Prof. Dr.-Ing. Zäh February 14, 2014 Dr.-Ing. Thomas Eberl Charakterisierung und Gestaltung des Fahr-Erlebens der Längs- Prof. Dr.-Ing. Lindemann February 18, 2014 HØJTWPIXQP'NGMVTQHCJT\GWIGP Dr.-Ing. Sascha Seidl 'KPJ[DTKFGU8GTHCJTGP\WTPWOGTKUEJGP5KOWNCVKQPFGUUVTÒ- Prof. i. R. Dr.-Ing. Schilling February 19, 2014 OWPIUKPFW\KGTVGP5EJCNNUCWH$CUKUXQPCMWUVKUEJGP5VÒTINGK- chungen Dr.-Ing. Mathey Wiesbeck 5VTWMVWT\WT4GRTÀUGPVCVKQPXQP/QPVCIGUGSWGP\GPHØTFKG Prof. Dr.-Ing. Zäh February 21, 2014 situationsorientierte Werkerführung Dr.-Ing. Abdullah Essa Ali Alali &GXGNQROGPVCPF8CNKFCVKQPQHCPGY5QNXGT$CUGFQPVJG Prof. Macian-Juan, Ph. D. February 21, 2014 +PVGTHCEKCN#TGC6TCPURQTV'SWCVKQPHQTVJG0WOGTKECN5KOWNCVKQP QH5WDEQQNGF$QKNKPIYKVJ1RGP(1#/%(&%QFGHQT0WENGCT Safety Applications &T+PI-YQM-CK5Q Uncertainty analysis of shock-bubble interaction Prof. Dr.-Ing. Adams February 24, 2014 Dr.-Ing. Jiaxi Shi Leistungssteuerung chirurgischer Instrumente mit funktionellen Prof. Dr. Lüth February 25, 2014 EMG-Daten Dr.-Ing. Sandra Schmidt Optimierung und experimentelle Untersuchung der CO2-Abtren- Prof. Dr.-Ing. Klein February 25, 2014 PWPIOKV/QPQGVJCPQNCOKPHØTDTCWPMQJNGIGHGWGTVG-TCHVYGTMG Dr.-Ing. Jan Both Tragfähigkeit von CFK-Metall-Laminaten unter mechanischer Prof. Dr.-Ing. Baier February 25, 2014 und thermischer Belastung Dr.-Ing. Andreas Kain /GVJQFKM\WT7OUGV\WPIFGTQHHGPGP2TQFWMVGPVYKEMNWPI Prof. Dr.-Ing. Lindemann March 3, 2014 &T+PI-CVTKP0QVJJCHV 5EJGTUEJPGKFGPJÒEJUVHGUVGT$NGEJYGTMUVQHHGKOQHHGPGP5EJPKVV Prof. i. R. Dr.-Ing. Hoffmann March 5, 2014 Dr.-Ing. Thomas Hecht 5VCVKE(NQY+PUVCDKNKVKGUKP2NCVG(KP*GCV'ZEJCPIGTU Prof. Dr.-Ing. Klein March 6, 2014 Dr.-Ing. Martin Hauser 252 Appendix Name Topic Supervisor Date Dr.-Ing. Matthias Baur #MVKXGU&ÀORHWPIUU[UVGO\WT4CVVGTWPVGTFTØEMWPICP Prof. Dr.-Ing. Zäh March 11, 2014 URCPGPFGP9GTM\GWIOCUEJKPGPs'PVYWTHWPFGZRGTKOGPVGNNG 8CNKFKGTWPI Dr.-Ing. Markus Kahnert 5ECPUVTCVGIKGP\WTXGTDGUUGTVGP2TQ\GUUHØJTWPIDGKO'NGMVTQ- Prof. Dr.-Ing. Zäh March 14, 2014 PGPUVTCJNUEJOGN\GP '$/ Dr.-Ing. Martin Werner 'PVYKEMNWPIGKPGU/QVQTRTØHUVCPFU\WT7PVGTUWEJWPIFGT Prof. Dr.-Ing. Wachtmeister March 17, 2014 -QNDGPITWRRGPTGKDWPIWPFFGTGP*CWRVGKPƅWUUITÒ»GP Dr.-Ing. Josef Streit Appendix 253 Name Topic Supervisor Date &T+PI5VGRJCP2CT\KPIGT Analytische Modellierung der temperatur- und gasdruck- Prof. Dr.-Ing. Sattelmayer May 30, 2014 abhängigen effektiven Wärmeleitfähigkeit von Pulvern Dr.-Ing. Sebastian Schindler Strategische Planung von Technologieketten für die Produktion Prof. Dr.-Ing. Reinhart June 3, 2014 Dr.-Ing. Claus Lechner 'PGTIKGDKNCP\KGTWPIFGU%86*[DTKF Prof. i. R. Dr.-Ing. Höhn June 3, 2014 Dr.-Ing. Sebastian Kortler Absicherung von Eigenschaften komplexer und variantenreicher Prof. Dr.-Ing. Lindemann June 4, 2014 2TQFWMVGKPFGT2TQFWMVGPVYKEMNWPI &T+PI8QNMGT5GKFGN 0WOGTKUEJGWPFGZRGTKOGPVGNNG7PVGTUWEJWPIGPFGT#GTQ Prof. Dr.-Ing. Sattelmayer June 13, 2014 F[PCOKMWPF8GTDTGPPWPIUUVCDKNKVÀVGKPGU8QTOKUEJDTGPPGTU Dr.-Ing. Andreas Koukal Crash- und Bruchverhalten von Kunststoffen im Fußgänger- Prof. Dr.-Ing. Baier June 17, 2014 UEJWV\XQP(CJT\GWIGP Dr.-Ing. Timo Frank 'PVYKEMNWPIWPF'XCNWCVKQPGKPGT/QFGNNKGTWPIUURTCEJGHØTFGP 2TQH&T+PI8QIGN*GWUGT June 17, 2014 #TEJKVGMVWTGPVYWTHXQPXGTVGKNVGP#WVQOCVKUKGTWPIUCPNCIGPCWH Basis der Systems Modelling Language (SysML) Dr.-Ing. Pascal Schlagermann Exergoökonomische Analyse geothermischer Strombereitstel- Prof. Dr.-Ing. Spliethoff June 18, 2014 lung am Beispiel des Oberrheingrabens Dr.-Ing. Dominik Stockenberger 5EJWV\XQT2TQFWMVRKTCVGTKGFWTEJ-GPP\GKEJPWPIWPF#WVJGPVK- Prof. Dr.-Ing. Günthner June 23, 2014 Ƅ\KGTWPIXQP-QORQPGPVGPWPF'TUCV\VGKNGPKO/CUEJKPGPWPF Anlagenbau &T+PI/CTMWU5EJYKGPDCEJGT 'HƄEKGPV#NIQTKVJOUHQT$KRGF4QDQVUs5KOWNCVKQP%QNNKUKQP Prof. i. R. Dr.-Ing. Ulbrich June 23, 2014 Avoidance and Angular Momentum Tracking Dr. rer. nat. Boqiao Sun 5VGTGQUGNGMVKXGOGJTUVWƄIG4GFWMVKQPXQP&GJ[FTQEJQNUÀWTG 2TQH&T+PI9GWUVGT$QV\ June 24, 2014 mit Hydroxysteroiddehydrogenasen Dr.-Ing. Daniel Scherer /GVJQFGP\WT#WVQOCVKUKGTWPIFGTKPMTGOGPVGNNGP$NGEJ Prof. i. R. Dr.-Ing. Hoffmann June 27, 2014 umformung Dr.-Ing. Mahmoud Ismail Reduced Dimensional Modeling of the Entire Human Lung Prof. Dr.-Ing. Wall June 27, 2014 Dr.-Ing. Michael Hinterstoißer Zur Optimierung des Wirkungsgrades von Stirnradgetrieben Prof. i. R. Dr.-Ing. Höhn June 30, 2014 Dr.-Ing. Kei Wieland Müller Simulation of Self-assembly and Mechanics of Transiently Prof. Dr.-Ing. Wall July 2, 2014 %TQUUNKPMGF5GOKƅGZKDNG$KQRQN[OGT0GVYQTMU Dr.-Ing. Johannes Wimmer Ereignisorientierte Simulation und Optimierung im Erdbau Prof. Dr.-Ing. Günthner July 4, 2014 Dr.-Ing. Tim Horenburg 5KOWNCVKQPUIGUVØV\VG#DNCWHRNCPWPIWPVGT$GTØEMUKEJVKIWPI Prof. Dr.-Ing. Günthner July 4, 2014 aktueller Baufortschrittsinformationen Dr.-Ing. Martin Schmid Thermoakustische Kopplungsmechanismen in Flüssigkeits- Prof. Dr.-Ing. Sattelmayer July 8, 2014 TCMGVGPVTKGDYGTMGP Dr.-Ing. Simone Lombardo 'KPƅWUUXQPXGTUEJKGFGPGP%CTDQPKVTKGTXGTHCJTGPCWHFKG Prof. i. R. Dr.-Ing. Höhn July 10, 2014 254 Appendix Name Topic Supervisor Date Dr.-Ing. Thomas Kirchmeier /GVJQFG\WT#PYGPFWPIFGTDGTØJTWPIUNQUGP*CPFJCDWPI Prof. Dr.-Ing. Reinhart July 22, 2014 OKVVGNU7NVTCUEJCNNKOCWVQOCVKUKGTVGP/QPVCIGRTQ\GUU Dr.-Ing. Marcelo Magnoli 0WOGTKECNUKOWNCVKQPQHRTGUUWTGQUEKNNCVKQPUKPNCTIG(TCPEKU Prof. i. R. Dr.-Ing. Schilling July 24, 2014 turbines at partial and full load operating conditions and their effects on the runner structural behaviour and fatigue life Dr.-Ing. Thomas Irrenhauser $GYGTVWPIFGT9KTVUEJCHVNKEJMGKVXQP4(+&KO9GTVUEJÒRHWPIU- Prof. Dr.-Ing. Reinhart July 25, 2014 PGV\ Dr.-Ing. Daniel Zielinski 5[UVGOQH5[UVGOU/QFGNNKGTWPIWPF$GYGTVWPIHCEJNKEJ Prof. i. R. Dr.-Ing. Igenbergs July 29, 2014 CDIGITGP\VGTKPFWUVTKGNNGT$GTGKEJG Dr.-Ing. Thomas Bierling Comparative Analysis of Adaptive Control Techniques for Impro- 2TQH&T+PI*QN\CRHGN July 31, 2014 ved Robust Performance Dr.-Ing. Christian Sorg &CVC/KPKPICNU/GVJQFG\WT+PFWUVTKCNKUKGTWPIWPF3WCNKƄ\KG- Prof. Dr.-Ing. Drechsler August 1, 2014 TWPIPGWGT(GTVKIWPIURTQ\GUUGHØT%(-$CWVGKNGKPCWVQOQDKNGT Großserienproduktion Dr.-Ing. Georg Wiedemann #DNGKVWPIXQP'NGMVTQHCJT\GWIMQP\GRVGPCWU'KIGPUEJCHVU\KGNGP Prof. Dr.-Ing. Lienkamp August 5, 2014 &T+PI$GPGFKMV0KGU 0WV\WPIUIGTGEJVG&KOGPUKQPKGTWPIFGUGNGMVTKUEJGP#PVTKGDU- Prof. Dr.-Ing. Lindemann August 7, 2014 systems für Plug-In Hybride Dr.-Ing. Anja Marosky 'KPƅWUUFGT-ØJNNWHVGKPFØUWPICWHFCU$GVTKGDUXGTJCNVGPXQP Prof. Dr.-Ing. Sattelmayer August 21, 2014 Drallbrennern &T+PI%JTKUVQRJ0GTN 5KOWNCVKQPUIGUVØV\VG8GTHCJTGPUGPVYKEMNWPI\WOMQPVKPWKGT Prof. i. R. Dr.-Ing. Hoffmann September 4, 2014 NKEJGP8GTDWPFIKG»GPXQP#NWOKPKWOJCND\GWIGP Dr.-Ing. Sophie Hippmann 2WNXGTWPFUEJOGN\OGVCNNWTIKUEJG8GTHCJTGP\WT*GTUVGNNWPIXQP Prof. i. R. Dr.-Ing. Hoffmann September 12, 2014 -WRHGTOCVTKZ%06-QORQUKVGPHØTFGP'KPUCV\CNU)NGKVNCIGT- YGTMUVQHH &T+PI/CTVKP$GFPCT\ 'PVYKEMNWPIGKPGTQRVKOKGTVGP/GUUGTIGQOGVTKGHØTFCUGKP Prof. i. R. Dr.-Ing. Hoffmann September 12, 2014 UVWƄIG Appendix 255 Name Topic Supervisor Date &T+PI4QDGTV/GV\MG Modeling and experimental investigation of the mechanobiologi- Prof. Dr.-Ing. Wall October 17, 2014 ECNGPXKTQPOGPVCUUQEKCVGFYKVJCNXGQNCTRPGWOQE[VGU &T+PI$GPLCOKP-TGWV\MCO Analyse des Depositionsverhaltens bei staubförmiger Kohlever- Prof. Dr.-Ing. Spliethoff October 17, 2014 brennung unter Berücksichtigung der Partikelfragmentation Dr.-Ing. Tobias Kloiber %QPUVTWEVKXG2CUUKXKV[$CUGF%QPVTQNQH5OQQVJCPF5YKVEJGF Prof. Dr.-Ing. Lohmann October 17, 2014 0QPNKPGCT5[UVGOU Dr.-Ing. Sebastian Idler Die Fresstragfähigkeit stufenloser Umschlingungsgetriebe Prof. i. R. Dr.-Ing. Höhn October 17, 2014 Dr.-Ing. Andreas Blattner $GFKGPMQP\GRVGPVYKEMNWPIHØT(CJTGTKPHQTOCVKQPUU[UVGOG Prof. Dr. Bengler October 17, 2014 basierend auf einem Touchpad mit haptischer Rückmeldung Dr.-Ing. Christoph Kirchberger Investigation on Heat Transfer in Small Hydrocarbon Rocket Prof. Dr.-Ing. Haidn October 21, 2014 Combustion Chambers Dr.-Ing. Oliver Fritsch Energiebasierte Lage- und Positionsfolgeregelung für einen Prof. Dr.-Ing. Lohmann October 22, 2014 Quadrocopter &T+PI,QCEJKO2ƅGIJCCT 'PGTIKGGHƄ\KGPVGCMVKXG&ÀORHWPIXQP6QTUKQPUUEJYKPIWPIGP Prof. Dr.-Ing. Lohmann October 24, 2014 im KFZ-Antriebsstrang Dr.-Ing. Maximilian Kissel Mustererkennung in komplexen Produktportfolios Prof. Dr.-Ing. Lindemann October 28, 2014 Dr.-Ing. Anja Schneider Feldeffektivitätsanalyse integraler Sicherheitssysteme Prof. i. R. Dr.-Ing. Heißing October 29, 2014 Dr.-Ing. Andreas Mackensen 2TGUUYGTMQTKGPVKGTVG#PCN[UGFGT7OHQTOWPF5EJGTUEJPGKF Prof. i. R. Dr.-Ing. Hoffmann October 29, 2014 eigenschaften von Mehrphasenstählen &T+PI(TCP\5EJCWGT 7PVGTUWEJWPIOQFGTPGTQVVQOQVQTKUEJGT$TGPPXGTHCJTGP\WT Prof. Dr.-Ing. Wachtmeister 0QXGODGT Reduktion der Partikelemissionen Dr.-Ing. Andreas Langheinrich )GQOGVTKG$GCPURTWEJWPIWPF8GTHQTOWPICU[OOGVTKUEJGT Prof. i. R. Dr.-Ing. Höhn 0QXGODGT 5VKTPTCFXGT\CJPWPIGP Dr.-Ing. Johannes Fuchs #PCN[UGFGT9GEJUGNYKTMWPIGPWPF'PVYKEMNWPIURQVGPVKCNGKP Prof. Dr.-Ing. Lienkamp 0QXGODGT FGT#WUNGIWPIGNGMVTKƄ\KGTVGT(CJT\GWIMQP\GRVG Dr.-Ing. Alexander Heubuch $GKVTCI\WT'PVYKEMNWPIWPF7PVGTUWEJWPIGKPGU0GDGPUVTQO Prof. Dr.-Ing. Wachtmeister 0QXGODGT hyrolyseverfahrens für die Bereitstellung gasförmigen Ammoni- CMUCWUƅØUUKIGP2TÀMWTUQTGPHØTOQDKNG5%4#PYGPFWPIGP Dr.-Ing. Michael Graf /GVJQFG\WT'TUVGNNWPIWPF#DUKEJGTWPIGKPGTOQFGNNDCUKGTVGP Prof. Dr.-Ing. Lienkamp 0QXGODGT Sollvorgabe für Fahrdynamikregelsysteme Dr.-Ing. Peter Matt 'KPƅWUUFGT5VKTPMCPVGPCWHFKG6TCIHÀJKIMGKVXQP8GT\CJPWPIGP Prof. i. R. Dr.-Ing. Höhn 0QXGODGT Dr.-Ing. Markus Filippi /GVJQFUHQT'HƄEKGPV/QFGNNKPICPF1RVKOKUCVKQPQPVJG Prof. i. R. Dr.-Ing. Ulbrich 0QXGODGT Example of Timing-Chain Drives Dr.-Ing. Alejandro Cardénas +PƅWGPEGQH'PJCPEGF*GCV6TCPUHGTKP2WNUCVKPI(NQYQPVJG Prof. Polifke, Ph. D. 0QXGODGT Miranda Damping Characteristics of Resonator Rings Dr.-Ing. Jakob Huemer 'KPƅWUUKPUVCVKQPÀTGTCGTQF[PCOKUEJGT-TÀHVGCWHFKG(CJT Prof. Dr.-Ing. Wall 0QXGODGT F[PCOKMXQP2GTUQPGPMTCHVYCIGP Dr.-Ing. Ana da Silva Investigation of a Damage Tolerant Joining Technology for Prof. Dr.-Ing. Drechsler 0QXGODGT .KIJVYGKIJV5VTWEVWTGU Dr.-Ing. Thomas Wolf H2 Pseudo-optimal Model Order Reduction Prof. Dr.-Ing. Lohmann 0QXGODGT Dr.-Ing. Matthias Hensel Thermische Beanspruchbarkeit und Lebensdauerverhalten von Prof. i. R. Dr.-Ing. Höhn 0QXGODGT nasslaufenden Lamellenkupplungen Dr.-Ing. Daniel Paulus $GGKPƅWUUWPIFGT.CPIUCOƅWIGKIGPUEJCHVGPXQP0WTƅØIGN Prof. Dr.-Ing. Hornung 0QXGODGT MQPƄIWTCVKQPGPFWTEJ*QEJCWHVTKGDUU[UVGOGCPFGT(NØIGN vorder- und Hinterkante Dr.-Ing. Georg Faust 4GCMVKQPUVGEJPKUEJG7PVGTUWEJWPIGP\WT*GTUVGNNWPIGKPGU 2TQH&T+PI9GWUVGT$QV\ 0QXGODGT hydrophoben Spinnenseidenproteins mit Escherichia coli &T+PI#NGZCPFGT'YCNF +ORTQXKPIVJG8GTUCVKNKV[QH*WOCPQKF9CNMKPI/CEJKPGU Prof. i. R. Dr.-Ing. Ulbrich 0QXGODGT Dr.-Ing. Felix Zimmermann Generierung von maßgeschneiderten Bauteileigenschaften in 2TQH&T+PI8QNM December 1, 2014 PHS-Bauteilen durch Anlassen mittels Flamme Dr.-Ing. Oliver Rösch Steigerung der Arbeitsgenauigkeit bei der Fräsbearbeitung Prof. Dr.-Ing. Zäh December 2, 2014 metallischer Werkstoffe mit Industrierobotern Dr.-Ing. Florian Karl $GFCTHUGTOKVVNWPIWPF2NCPWPIXQP4GMQPƄIWTCVKQPGPCP Prof. Dr.-Ing. Reinhart December 2, 2014 Betriebsmitteln Dr.-Ing. Daniel Hofmann 5KOWNCVKQPUIGUVØV\VG#WUNGIWPIXQP1TFPWPIUUEJKMCPGPKP Prof. Dr.-Ing. Reinhart December 2, 2014 8KDTCVKQPUYGPFGNHÒTFGTGTP Dr.-Ing. Paul De Monte Adaptive Trajektorienfolgeregelung für Quadrokopter basierend Prof. Dr.-Ing. Lohmann December 2, 2014 auf der L1-adaptiven Regelungstheorie Dr.-Ing. Gundula Balan Untersuchungen des Partikelverhaltens und der Hochtempera- Prof. Dr.-Ing. Spliethoff December 5, 2014 tur-Chlorkorrosion bei der Flugstromverbrennung mit dotierten Brennstoffen 256 Appendix Name Topic Supervisor Date &TTGTPCV0KNU,CP\GP /KMTQFQUKGTVGEJPKMWPF/KMTQUGPUQTGP\WTR*-QPVTQNNGKP 2TQH&T+PI9GWUVGT$QV\ December 9, 2014 Parallelbioreaktoren Dr.-Ing. Michael Werhahn Elektrokatalyse der Kohlenstoffoxidation in einer oxidkerami- Prof. Dr.-Ing. Spliethoff December 11, 2014 UEJGP$TGPPUVQHH\GNNG Dr.-Ing. Benoit Béguin &GXGNQROGPVCPF#PCN[UKUQHCP'NCUVQƅGZKDNG/QTRJKPI9KPI Prof. Dr.-Ing. Breitsamter December 12, 2014 Dr.-Ing. Georg Baumgartner Flame Flashback in Premixed Hydrogen-Air Combustion Prof. Dr.-Ing. Sattelmayer December 12, 2014 Systems Dr.-Ing. Jinming Lu Cathode shape design for steady-state electrochemical Prof. Dr. Werner December 15, 2014 machining Dr.-Ing. Frank Hohenstein 5[UVGOGPVYWTHWPF7OUGV\WPIGKPGTHWPMVKQPUKPVGITKGTGPFGP Prof. Dr.-Ing. Günthner December 15, 2014 )CDGNUVCRNGTNQMCNKUKGTWPIHØTGKPGYCPFNWPIUHÀJKIGWPFGHƄ\KGPVG Transportausführung Dr.-Ing. Daniel Schmid 4ØJTTGKDUEJYGK»GPXQP#NWOKPKWONGIKGTWPIGPOKV5VÀJNGPHØT Prof. Dr.-Ing. Zäh December 16, 2014 die Automobilindustrie Dr.-Ing. Stefanie Bade Messung und Modellierung der thermoakustischen Eigen- Prof. Dr.-Ing. Sattelmayer December 16, 2014 schaften eines modularen Brennersystems für vorgemischte &TCNNƅCOOGP Dr.-Ing. Phillip Schrieverhoff 8CNWCVKQPQH#FCRVCDKNKV[KP5[UVGO#TEJKVGEVWTG Prof. Dr.-Ing. Lindemann December 17, 2014 Dr.-Ing. Peter Burda 8GTHCJTGP\WT'PVYKEMNWPIWPF#WUNGIWPIXQP'PGTIKGURGKEJGT- Prof. Dr.-Ing. Lienkamp December 17, 2014 U[UVGOGPHØT'NGMVTQMTCHVHCJT\GWIG Dr.-Ing. Katrin Wülfert 'KPƅWUUXQP.CFWPIUYGEJUGNEJCTCMVGTKUVKMGPCWHFGP Prof. Dr.-Ing. Wachtmeister December 18, 2014 8GTDTGPPWPIUCDNCWHGKPGU)CUOQVQTU Dr.-Ing. Andrea Rauh 2TQIPQUGFGU8GTUCIGPUXGTJCNVGPUXQP%(--NGDXGTDKPFWPIGP Prof. Dr.-Ing. Drechsler December 18, 2014 unter Crashbelastung Dr.-Ing. Christoph Hahn A Simulation Approach of Permeability Prediction for RTM Prof. Dr.-Ing. Drechsler December 18, 2014 Process Simulation &T+PI/KEJCGN9ÒNƅG -QPVGZVUGPUKVKXG#TDGKVUCUUKUVGP\U[UVGOG\WT+PHQTOCVKQPU Prof. Dr.-Ing. Günthner December 19, 2014 bereitstellung in der Intralogistik Dr.-Ing. Florian Danner On the Prediction of Sound from Unducted Propulsors by Means Prof. Dr.-Ing. Kaltenbach December 19, 2014 of Computational Fluid Dynamics Dr.-Ing. Patrick Dems On Eulerian-Eulerian Large Eddy Simulation of Polydispersed, Prof. Polifke, Ph. D. December 23, 2014 4GCEVKPI5RTC[(NQYUYKVJ/QOGPV/GVJQFU Appendix 257 Technische Universität München Department of Mechanical Engineering $QNV\OCPPUVTC»G 85748 Garching near Munich Germany YYYOYVWOFG You can reach the Garching Research %GPVTG )CTEJKPI(QTUEJWPIU\GPVTWO using the U6 undergroung line (get off at n)CTEJKPI(QTUEJWPIU\GPVTWOo VJGDWU NKPGUCPFCUYGNNCUXKCVJG# OQVQTYC[ VCMGVJGn)CTEJKPI0QTFoGZKV CPFVJG$HGFGTCNJKIJYC[ Ernst-Otto-Fischer-Straße Am Coulombwall Freisinger Landstraße Lichtenbergstraße Walter-Meißner-Straß e A9 Garching Nord ße tra s ann Boltzm Ludwig-Prandt l-Straße