DOCSLIB.ORG

Information on Sustainable Use of Agricultural Residues for Bioenergy Supply“

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Information on Sustainable Use of Agricultural Residues for Bioenergy Supply“ Thuringian Center for Renewable Resources Available potentials of straw in Germany (potentials, provision costs for straw) Results from the project: „Information on sustainable use of agricultural residues for bioenergy supply“ Christian Weiser, Dr. Armin Vetter, Thuringian State Institute for Agriculture, Dornburg-Camburg Frank Reinicke, Institut für Nachhaltige Landbewirtschaftung e.V., Halle Supported by: 2nd International Symposium 'Energy from Straw' Berlin, 29th-30th March 2012, Christian Weiser Thuringian Center for Renewable Resources Background – increasing pressure on croplands for bioenergy purposes • change from conventional to renewable energy sources • important role of biomass – the production of biomass is linked to the limited resource soil • bioenergy strategies and policy initiatives focus on the implementation of the agricultural residue potential (f.e. German Renewable Energy Source Act) • possible environmental and cost benefits of these resources 2nd International Symposium 'Energy from Straw' Berlin, 29th-30th March 2012, Christian Weiser Thuringian Center for Renewable Resources Background – recent occurence and utilization of agricultural residues and by-products Residue Quantity Current utilization [million tons dry [%] matter] Cereal Straw 25.8 ~ 17 % for straw based animal housing Cattle- and Pigslurry 12.2 ~ 12 % feedstock for biogas, organic fertilizer Rapeseed- and 9.5 100 % organic fertilizer maizestraw reproduction of soil organic matter Solid manure 7.5 ~ 3 % feedstock for biogas, organic fertilizer Sugar beet- and 3.1 100 % organic fertilizer potatoleaf reproduction of soil organic matter Rapeseed cake 2.7 fodder 2nd International Symposium 'Energy from Straw' Berlin, 29th-30th March 2012, Christian Weiser Thuringian Center for Renewable Resources Utilization of cereal straw without recirculation of carbon to the soil Photo: TLL Photo: TLL Straw-fired heating plant in Jena supplies heat to facilities of the Thuringian State Institute of Agriculture 2nd International Symposium 'Energy from Straw' Berlin, 29th-30th March 2012, Christian Weiser Thüringer Zentrum Nachwachsende Rohstoffe Definition - potentials ????? theoretical potential technical potential sustainable potential available ?? ??? potential 2nd International Symposium 'Energy from Straw' Berlin, 29th-30th March 2012, Christian Weiser Thuringian Center for Renewable Resources Humus balance as criteria for potential estimation • determination of the removeable residues (cereal straw) from agriculture cycle for bioenergy supply without recirculation of carbon to the soil • criteria for sustainability = remove only this amount of organic matter that does not disrupt the carbon balance • the ratio between input (manure, by-products) and loss (decay, harvest) of soil organic matter is a crucial criteria for the assessment of sustainable agricultural practice • site-specific reproduction of soil organic matter in agricultural farms is an important precondition to ensure high and stable yields 2nd International Symposium 'Energy from Straw' Berlin, 29th-30th March 2012, Christian Weiser Thuringian Center for Renewable Resources Humus balance • VDLUFA1 and the HE (dynamisch)2 balancing tools are used to calculate the humus balance on NUTS-3 level • the balance is calculated on the base of coefficients accounting for the demand of different crops and the compensation of humus by organic fertilizers • coefficients were derived from long term experiments • due to the empirical character a range between “lower” and “higher” values is given for the VDLUFA model 1 VDLUFA (Association of the German Agricultural Research Institutes) (2004) 2 dynamische Humuseinheitenmethode Hülsbergen (2003) 2nd International Symposium 'Energy from Straw' Berlin, 29th-30th March 2012, Christian Weiser Thuringian Center for Renewable Resources Input parameter – cultivation area by crop, by-products • humus- increasing • by-products and organic • minus 10 % for and decreasing fertilizers receive humus material crops increasing coefficients purposes • fallow land • catch crops • varying crop – coefficients for the HE -method 2nd International Symposium 'Energy from Straw' Berlin, 29th-30th March 2012, Christian Weiser Thuringian Center for Renewable Resources Input parameter input - parameter / district VDLUFA HE –dynamisch area cultivated per crop x X harvest - x by - products x x fallowland x x area cultivated with catch crops x x animal residues x x other organic fertilizer x x mineral nitrogen fertillizer - x nitrogen deposits - x precipitation - x soil fertility index - x 2nd International Symposium 'Energy from Straw' Berlin, 29th-30th March 2012, Christian Weiser Thuringian Center for Renewable Resources Results – humus balance VDLUFA lower values VDLUFA higher values HE - method / Cross Compliance 2 districts with 31 districts with 57 districts with negative balances negative balances negative balances balances limit balances limit balances limit potential in 9% potential in 38 % potential in 32 % 2nd International Symposium 'Energy from Straw' Berlin, 29th-30th March 2012, Christian Weiser Thuringian Center for Renewable Resources Results - regional straw potential VDLUFA VDLUFA HE – dyn. higher values lower values (CC) ~8 m. tFM ~10 m. tFM ~13 m. tFM 2nd International Symposium 'Energy from Straw' Berlin, 29th-30th March 2012, Christian Weiser Thuringian Center for Renewable Resources Conditions – calculation of scenarios • 1st Scenario „Business as usual“ increasing harvest 1 %, change in cattle housing types from straw to slurry based diminishing grazing period • 2nd Scenario „increasing straw demand“ technical limited recovery rate increases from 66 % to 90 % share of grassland increases up to 5% in each district instead of area cultivated with silomaize • 3rd Scenario „extensification of crop production“ decreasing harvest for all crops for 10 % 2nd International Symposium 'Energy from Straw' Berlin, 29th-30th March 2012, Christian Weiser cereal straw in m. t FM 10 15 20 25 0 5 2 nd International Symposium 'Energy from Straw' Berlin, 29 Baseline 1st Scenario 2nd Scenario 3rd Scenario Results - scenarios Thuringian Center for Renewable Resources th -30 th March 2012, Christian Weiser HE -method VDLUFA higher values VDLUFA lower values Thuringian Center for Renewable Resources Intermediate results – sustainable straw potential theoretical technical sustainable potential potential potential VDLUFA lower value CC-regulations VDLUFA higher value HE method 30 m. 15 m. 13 m. 10 m. 8 m. t FM t FM t FM t FM t FM • 8 – 13 million tons straw fresh matter are available for recovery according to the humus balance models and scenario calculations • 8 – 13 million tons fm is equal to 114 – 186 Petajoule • farmers should carry out balances at field scale • nutrient loss and erosion issues should be considered • a short term and method independent possibilty to improve the results are site specific grain-to-straw ratios 2nd International Symposium 'Energy from Straw' Berlin, 29th-30th March 2012, Christian Weiser Thuringian Center for Renewable Resources Available potential – price • the available potential depends highly on the attendance to pay a certain price • the price compensates the expenditures for the recovery, handling, transport, storage and should include a profit for the farmer • the following calculation includes baling, handling and short distance transport to the (intermediate) storage-/farm- or conversion facility • factors of influence: harvest, field area, machinery (acquisition costs, performance, economic life- time, recovery rate, distance between swaths), costs for fertilizers and other operating resources 2nd International Symposium 'Energy from Straw' Berlin, 29th-30th March 2012, Christian Weiser Thuringian Center for Renewable Resources Price for cereal straw (without storage, long distance transport) position Var. 1 Var. 2 harvest (dt/ha) 3 3 transport distance (km) 5 5 baling (wfh/ha) 0,4 0,4 handling/transport (wfh/ha) 0,99 nk. workforce for handling and transport 4 1 costs for baling (€/t) 19,80 19,80 costs for handling and transport (€/t) 14,60 7,90 nutrient value straw (€/t) 17,40 17,40 total (€/t) 51,80 45,10 2nd International Symposium 'Energy from Straw' Berlin, 29th-30th March 2012, Christian Weiser Impact of field area on time/cost for straw baling 2 nd International Symposium 'Energy from Straw' Berlin, 29 time wfh/ha 0,1 0,2 0,3 0,4 0,5 0,6 0,7 0 1 ha 2 ha 10 ha 20 ha 40 ha 80 ha Thuringian Center for Renewable Resources machinery cost of time th -30 th March 2012, Christian Weiser 0 10 20 30 40 50 60 costs of machinery €/ha price incices of agricultural operating resources (without purchase tax) 100 110 120 130 140 150 160 170 180 190 90 price indices of agricultural operating resources 2 nd International Symposium 'Energy from Straw' Berlin, 29 2005 2006 2007 2008 2009 2010 machinery for recovery maintenance of machinery fertilizer fuel operating resources total Thuringian Center for Renewable Resources th -30 th March 2012, Christian Weiser Thuringian Center for Renewable Resources Comparison of different price calculations 70 handling and transport to the field/storage 60 baling 50 nutrient costs ] t / 40 € [ s t s o c 30 20 10 0 Hanff Degner Lorenz Schindler Wagner Var. 1 Var. 2 (2010) (2007) (2011) (2008) (2011) 2nd International Symposium 'Energy from Straw' Berlin, 29th-30th March 2012, Christian Weiser Thuringian Center for Renewable Resources Discussion price – „value“ for soil organic matter • according
Load more

Recommended publications
  • Combining Short Rotation Coppice \Vith Annual Crops­ Modern Agroforestry Systems for Sustainable Land Use
    19th European Biomass Conference and Exhibition, 6-10 lune 2011, Berlin, Germany COMBINING SHORT ROTATION COPPICE \VITH ANNUAL CROPS­ MODERN AGROFORESTRY SYSTEMS FOR SUSTAINABLE LAND USE 1 M. Bärwolff , C. Böhm 2, C. Sclunidt 3, K.-U Schwarz 4, A. Vetter 1 I Thuringian State Institute ofAgriculture, Apoldaer Straße 4, 07774 Dornburg-Camburg, Germany, Tel.: +49 36427 868-117, Fax: +49 36427 22340, [email protected] 2 Brandenburg University ofTechnology, Konrad-Wachsmann-Allee 6, 03046 Cottbus, Germany, Tel.: +49 35569-4145, Fax: +4935569-2323, [email protected] 3 Justus Liebig University, Senckenbergstraße 3, 35390 Gießen, Germany, Tel.: +49 0641 99-37244, [email protected] 4 Julius Kühn-Institute, Bundesallee 50, 38116 Braunschweig, Germany, Tel.: +49 531 596-2335, Fax: +49 531 596-2399, [email protected] ABSTRACT: The production offuelwood in short rotation coppice (SRC) is considered as one compartment in the upcoming intensification of the generation of renewable resources, which importance is undoubted in terms of reducing carbon dioxide in the atmosphere and gaining independence offossil fuels. Increased production ofbiomass for energy recovery will intensify the pressure on land, leading to further intensification ofagricultural management. Combining forestry and agricultural systems seem to be a promising solution. In a joint research project four agroforestry systems combining SRC strips and crop strips were established in Germany. Each site otTers different initial conditions for combined wood and crop production. Main focus on all sites is the evaluation of economic and ecological issues. The objective is to deduce possibilities ofimprovement and to make relevant information available for practice and consultancy.
    [Show full text]
  • IN FO R M a TIO N to U SERS This Manuscript Has Been Reproduced from the Microfilm Master. UMI Films the Text Directly From
    INFORMATION TO USERS This manuscript has been reproduced from the microfilm master. UMI films the text directly from the original or copy submitted. Thus, some thesis and dissertation copies are in typewriter face, while others may be from any type of computer printer. The quality of this reproduction is dependent upon the quality of the copy submitted. Broken or indistinct print, colored or poor quality illustrations and photographs, print bleed through, substandard margin*, and improper alignment can adversely affect reproduction. In the unlikely event that the author did not send UMI a complete manuscript and there are missing pages, these will be noted. Also, if unauthorized copyright material had to be removed, a note will indicate the deletion. Oversize materials (e.g., maps, drawings, charts) are reproduced by sectioning the original, beginning at the upper left-hand comer and continuing from left to right in equal sections with small overlaps. Each original is also photographed in one exposure and is included in reduced form at the back of the book. Photographs included in the original manuscript have been reproduced xerographically in this copy. Higher quality 6" x 9" black and white photographic prints are available for any photographs or illustrations appearing in this copy for an additional charge. Contact UMI directly to order. A Ben A Howeii Information Company 300 North Zeeb Road Ann Arbor. Ml 48106-1346 USA 313.761-4700 800.521-0600 RENDERING TO CAESAR: SECULAR OBEDIENCE AND CONFESSIONAL LOYALTY IN MORITZ OF SAXONY'S DIPLOMACY ON THE EVE OF THE SCMALKALDIC WAR DISSERTATION Presented in Partial Fulfillment of the Requirements for the Degree Doctor of Philosophy in the Graduate School of The Ohio State University By James E.
    [Show full text]
  • Iv. Pilot Projects to Strengthen Regional Identities and Local Economies
    Role of pilot projects... 4. PILOT PROJECTS TO STRENGTHEN REGIONAL IDENTITIES AND LOCAL ECONOMIES 4.1. ROLE OF PILOT PROJECTS AND PRINCIPLES 2)*22'35$&7,&(,1352&(66(62)$&7,9(/$1'6&$3( SHAPING AND MANAGEMENT OF CULTURAL AND NATURAL LANDSCAPE ELEMENTS AS WELL AS THEIR PROTECTION AND SPATIAL PLANNING .U]\V]WRI*DZURĔVNL 4.1.1. Principles of good practice and pilot projects The term ‘good practice’ can be found in numerous aspects of human activ- LW\DQGLWUHIHUVERWKWRHFRQRPLFDFWLYLW\WRFRQVFLHQWLRXVVFLHQWL¿FUHVHDUFKDQG WRDFWLYLWLHVZLWKLQSXEOLFDGPLQLVWUDWLRQ6XFKVHWVRISULQFLSOHVKDYHDFKDUDFWHU of norms accepted by the members of a particular community and, to a certain H[WHQWFRQFHUQDOVRHWKLFDOTXHVWLRQV 7KHEDVLFLVVXHFRQQHFWHGZLWKWKHWHUP³JRRGSUDFWLFH´LVWKHTXHVWLRQRI FULWHULDHYDOXDWLQJYDULRXVXQGHUWDNLQJVIURPWKLVSRLQWRIYLHZ,WVHHPVWKDWWKH basic principle here is the compatibility of planned and realized aims with an accu- UDWHQHHGVDQDO\VLV7KHUHIRUHWKHWHUP³JRRGSUDFWLFH´ZLOOUHIHUWRWKDWFULWHULRQ ZKLFKDSDUWLFXODUJURXSRIEHQH¿FLDULHVDFWXDOO\QHHGVZKLFKWULJJHUVRUHQDEOHV IXUWKHUGHYHORSPHQWRUZKLFKRYHUFRPHVPRVWVLJQL¿FDQWGLI¿FXOWLHV>)HQU\FK @$QRWKHUVLJQL¿FDQW³JRRGSUDFWLFH´FULWHULRQLQYROYHVWKHSDUWLFLSDWLRQRI WKHORFDOFRPPXQLW\ EHQH¿FLDULHV LQWKHSURFHVVRISUHSDUDWLRQLPSOHPHQWDWLRQ and utilization of practical results of conducted activities. ,W LV DOVR QHFHVVDU\ WR GH¿QH WKH WHUPV ³PDQDJHPHQW´ DQG ³VKDSLQJ´ $FFRUGLQJWR7DGHXV].RWDUELĔVNL³PDQDJHPHQW´FDQEHXQGHUVWRRGDVFRPLQJ WRDGHFLVLRQEDVHGRQWKHNQRZOHGJHRIDLPVDQGPHDQVDVWRWKHLQLWLDWLRQRU WHUPLQDWLRQRIDFWLYLWLHV>.RWDUELĔVNL@7KXVWKHHVVHQFHRIWKLVWHUPOLHVLQ
    [Show full text]
  • Aus Dem Inhalt: Amtlicher Teil
    Amtsblatt_0907_neu 12.09.2007 13:14 Uhr Seite 1 Im Internet: www.saaleholzlandkreis.de 24. September 2007 · Ausgabe 09/2007 Beginn des amtlichen Teils Aus dem Inhalt: Amtlicher Teil: ■ Neue Telefonnummern im Landratsamt ■ Zweckvereinbarung zur Übertragung von Aufgaben nach dem Thüringer Schiedsstellengesetz Achtung! Ab 1.9.2007 neue Struktur und veränderte Telefonnummern im Landratsamt SHK Ab 1.9.07 verfügt das Landratsamt des SHK über eine veränderte Abteilungs- und Ämterstruktur. Parallel dazu gibt es teilweise neue Te- lefonnummern, die wir nachfolgend mitteilen. Bei Nichterreichbarkeit einzelner Ämter oder Mitarbeiter im Landratsamt wenden Sie sich bitte an die Zentrale Vermittlung Tel. 036691/70-0, Fax 70-166 E-mail: [email protected] Hier erhalten Sie umfassend Auskunft. Weiterhin wird es bis zum Jahresende 2007 Ämterumzüge innerhalb Eisenbergs geben. Auch hierbei wenden sich Auskunftssuchende an die zentrale Vermittlung. Amtsblatt_0907_neu 12.09.2007 13:14 Uhr Seite 2 Seite 2 Amtsblatt des Saale-Holzland-Kreises 24.09.2007 Landratsamt Saale-Holzland-Kreis Zweckvereinbarung Im Schloß, 07607 Eisenberg zur Übertragung von Aufgaben nach dem (036691) 70-0 Thüringer Schiedsstellengesetz www.saaleholzlandkreis.de [email protected] Aufgrund des § 47 (3) der Thüringer Gemeinde- und Landkreisord- Landrat 70-101 nung (Thüringer Kommunalordnung – ThürKO) vom 16.August Erster Beigeordneter 70-106 1993 (GVBl.S.501) in der Fassung der Neubekanntmachung vom Büro Landrat (Presse/Öffentlichkeitsarbeit) 70-107 28.Januar 2003 (GVBl.S.41), der §§ 7 – 15 des Thüringer Gesetzes Beauftragte des Landrates 70-194 über die kommunale Gemeinschaftsarbeit (ThürKGG) vom 11.Juni 1992 (GVBl.S.232) in der Fassung der Neubekanntmachung vom Rechnungsprüfungsamt 70-168 10.Oktober 2001 (GVBl.S.290) und § 1 (3) des Thüringer Schieds- Kommunalaufsicht 70-648 stellengesetzes (ThürSchStG) vom 13.September 1990 (GBl.
    [Show full text]
  • Management Plan 2017
    Nomination for Inscription on the UNESCO World Heritage List Management Plan Management The Naumburg CaThedral aNd The laNdsCape of The rivers saale aNd uNsTruT — TerriTories of power iN The high middle ages The Naumburg Cathedral and the landscape of the rivers Saale and Unstrut — territories of power in the High Middle Ages power in the High Middle Ages of Saale and Unstrut — territories the rivers and the landscape of Cathedral The Naumburg Management Plan Förderverein Welterbe an Saale und Unstrut e.V. Schönburger Straße 41 06618 Naumburg Germany http://www.welterbeansaaleundunstrut.de Naumburg, Juni 2013 Nomination for Inscription on the UNESCO World Heritage List THE NAUMBURG CATHEDRAL AND THE LANDSCAPE OF THE RIVERS SAALE AND UNSTRUT — TERRITORIES OF POWER IN THE HIGH MIDDLE AGES Management Plan The Annex E consists of the Management Plan prepared for the first nomination dossier entitled „The Naumburg Cathedral and the Landscape of the Rivers Saale and Unstrut – Territories of Power in the High Middle Ages“ that was submitted in January 2014 and discussed by the World Heritage Committee in July 2015. This Management Plan covers the area of the property΄s component parts and the buffer zone of this revised nomination to the largest extend. It is in a review and adaptation process to the revised nomination. For easy reference, however, the current version is submitted here as Annex E in order to continue to serve as a baseline for information, evaluation and consultation. INDEX INDEX 1. Content and setting the aims 9 2. World Heritage characteristics 13 2.1. Significance of the site 15 2.2 Statement of Outstanding Universal Value 19 2.2.1 Description 19 2.2.2 Properties, values 20 2.2.3 Justification of the criteria 21 2.2.3.1 Criterion IV 21 2.2.3.2 Criterion V 21 2.2.4 Statement of integrity 22 2.2.5 Statement of authenticity 23 Index 2.2.5.1 Form and design 23 2.2.5.2 Materials and substance 23 2.2.6 Location and setting 23 2.2.7 Use and function 24 2.2.8 Requirements of protection and management 24 3.
    [Show full text]
  • „Nur Gemeinsam Sind Wir Stark“ Im März 2018
    Dokumentation zur Veranstaltungsreihe „Nur gemeinsam sind wir stark“ im März 2018 Nickelsdorf, 31. Mai 2018 Dokumentation zur Veranstaltungsreihe „Nur gemeinsam sind wir stark“ im März 2018 Inhalt 1. Anlass............................................................................................................................................... 3 2. Programmablauf .............................................................................................................................. 4 3. Ergebnisse aus den Workshops ....................................................................................................... 5 3.1 Gemeinsam unterwegs – gemeinsam mobil ........................................................................... 5 3.2 Gemeinsam mit Nachbarn ....................................................................................................... 7 3.3 Gemeinsam stark über Grenzen .............................................................................................. 9 3.4 Was wir noch gemeinsam machen wollen ............................................................................ 12 4. Fazit und Ausblick .......................................................................................................................... 13 5. Anhang .......................................................................................................................................... 14 2 Dokumentation zur Veranstaltungsreihe „Nur gemeinsam sind wir stark“ im März 2018 1. Anlass Die Regionale Aktionsgruppe
    [Show full text]
  • Saale-Holzland-Kreis Integriertes Regionales Entwicklungskonzept (IREK)
    Saale-Holzland-Kreis Integriertes Regionales Entwicklungskonzept (IREK) Teil 1 Bestandsanalyse Stand 15.04.2021 Auftraggeber Saale-Holzland-Kreis Im Schloß 07607 Eisenberg Ansprechpartnerin Christine Friedrich Leiterin Landkreisförderung T 036691 70-156 [email protected] Auftragnehmer KEM Kommunalentwicklung Mitteldeutschland GmbH Am Waldschlösschen 4 01099 Dresden T 0351 2105-0 F 0351 2105-111 [email protected] www.ke-mitteldeutschland.de Joris Schofenberg (Projektleiter) Nadine Schneider David Remetter Christin Swatek Christina Tesch Inhaltsverzeichnis Seite 1. Räumliche Lage und übergeordnete Planungen 1 1.1 Räumliche Lage und Einordnung 1 1.2 Übergeordnete Planungen und Konzepte 3 1.3 Weitere Konzepte, Strategien und Projekte mit Bezug zum Landkreis 6 2. Analyse und Bewertung des Untersuchungsraumes 8 2.1 Demografie 8 2.2 Siedlungsentwicklung, Baukultur und Wohnen 15 2.3 Verkehrssituation und Erreichbarkeit 28 2.4 Technische Infrastruktur 38 2.5 Wirtschaft und Tourismus 43 2.6 Soziale Infrastruktur/Daseinsvorsorge 70 2.7 Natur, Umwelt und Klimaschutz/Klimaanpassung 88 2.8 Öffentliche Finanzen und Verwaltung 106 2.9 SWOT-Analyse 116 Anhang 125 Anhang 1: Übersicht der Städte und Gemeinden im Landkreis 125 Anhang 2: Tarifzonenplan des VMT 127 Anhang 3: Schutzgebiete nach Naturschutzrecht im Landkreis 128 Planverzeichnis nach Seite Plan 1: Übersichtskarte 2 Plan 2: Siedlungsstruktur 16 Plan 3: Verkehr 28 Plan 4: Gewerbestandorte 54 Plan 5: Bildung 72 Plan 6: Umwelt 93 Saale-Holzland-Kreis Integriertes Regionales Entwicklungskonzept (IREK) – Bestandsanalyse 04/2021 1. Räumliche Lage und übergeordnete Planungen 1.1 Räumliche Lage und Einordnung Berücksichtigte Planungen, Konzepte und Strategien Beteiligte Akteure und Institutionen - Landesentwicklungsprogramm Thüringen 2025 (2014) - Regionale Planungsstelle Ostthüringen - Regionalplan Ostthüringen (Entwurf 2019) beim Thüringer Landesverwaltungsamt - Regionale Entwicklungsstrategie Saale-Holzland - Regionale Aktionsgruppe Saale-Holzland 2014–2020 (2019) e.
    [Show full text]
  • Amtsblatt Des Zweckverbandes Jenawasser 2 Amtsblatt
    4/2012 Amtsblatt des Zweckverbandes JenaWasser 2 Amtsblatt des Zweckverbandes JenaWasser für sein Verbandsgebiet mit den Mitgliedsgemeinden Jena, Bad Berka, Blankenhain, Dornburg-Camburg, Altenberga, Bucha, Frauenprießnitz, Golmsdorf, Großlöbichau, Hainichen, Hetschburg, Jenalöbnitz, Laasdorf, Lehesten, Löberschütz, Magdala, Milda, Neuengönna, Rothenstein, Ruttersdorf-Lotschen, Schöps, Sulza, Tautenburg, Wichmar, Zimmern und Zöllnitz. 26. Jahrgang Amtsblatt-Nr. 3/2021 Mittwoch, den 21. Juli 2021 Inhaltsverzeichnis: - A m t l i c h e r T e i l - ............................................................................................................. 14 Veröffentlichung des Beschlusses der 148. Verbandsversammlung am 28.06.2021 des Zweckverbandes JenaWasser ........................................................................................................... 14 Fortschreibung Abwasserbeseitigungskonzept 2021 - 2030 ................................................................ 14 Öffentliche Bekanntgabe zum Abwasserbeseitigungskonzept des Zweckverbandes JenaWasser .......................................................................................................................................... 14 Öffentliche Bekanntmachung über beitragspflichtige Maßnahmen nach § 13 Thüringer Kommunalabgabengesetz .................................................................................................................. 16 Zimmern................................................................................................................................................
    [Show full text]
  • VERWALTUNGSGEMEINSCHAFT DORNBURG-CAMBURG Der Gemeinschaftsvorsitzende
    VERWALTUNGSGEMEINSCHAFT DORNBURG-CAMBURG Der Gemeinschaftsvorsitzende Mitgliedsgemeinden: Dornburg-Camburg, Frauenprießnitz, Golmsdorf, Großlöbichau, Hainichen, Jenalöbnitz, Lehesten, Löberschütz, Neuengönna, Tautenburg, Thierschneck, Wichmar, Zimmern Verwaltungsgemeinschaft Dornburg-Camburg Rathausstraße 1, 07774 Dornburg-Camburg A n alle Bürgerinnen und Bürger in der VG Dornburg-Camburg Camburg, den 16.03.2020 Informationen über Maßnahmen um die Ausbreitung des Corona-Virus vorzubeugen Sehr geehrte Bürgerinnen und Bürger, die Maßnahmen zur Eindämmung und Ausbreitung des Corona-Virus hält das öffentliche Leben und unsere Gesellschaft auf Trab. Bei aller Verhältnismäßigkeit geht die Gesundheit der Bürgerinnen und Bürger vor. Deshalb wurden folgende Maßnahmen ergriffen: 1. Rückkehrer aus Risikogebieten haben die Allgemeinverfügung des Landratsamtes Saale-Holzland-Kreis zu beachten. Einwohnerinnen und Einwohner, die sich innerhalb der letzten 14 Tage in einem Risikogebiet entsprechend der aktuellen Festlegung durch das Robert Koch-Institut aufgehalten haben, sind für einen Zeitraum von 14 Tagen nach ihrer Rückkehr aus dem Risikogebiet verpflichtet, sich ausschließlich in ihrer Wohnung bzw. auf ausschließlich von ihnen selbst genutzten Bereichen ihres Wohngrundstückes aufzuhalten. 2. Gemäß Erlass des Thüringer Landesverwaltungsamtes zum Vollzug des Infektionsschutzgesetzes sind alle Veranstaltungen und Menschenansammlungen mit 50 und mehr Personen untersagt. Auch Veranstaltungen und Menschenansammlungen mit weniger als 50 Personen sind auf
    [Show full text]
  • Rankings Municipality of Dornburg-Camburg, Stadt
    9/24/2021 Maps, analysis and statistics about the resident population Demographic balance, population and familiy trends, age classes and average age, civil status and foreigners Skip Navigation Links GERMANIA / Thüringen / Province of Saale-Holzland-Kreis / Dornburg-Camburg, Stadt Powered by Page 1 L'azienda Contatti Login Urbistat on Linkedin Adminstat logo DEMOGRAPHY ECONOMY RANKINGS SEARCH GERMANIA Municipalities Powered by Page 2 Albersdorf Stroll up beside >> L'azienda Contatti Login Urbistat on Linkedin Jenalöbnitz AdminstatAltenberga logo DEMOGRAPHY ECONOMY RANKINGS SEARCH Kahla, Stadt Bad GERMANIA Klosterlausnitz Karlsdorf Bibra Kleinbockedra Bobeck Kleinebersdorf Bremsnitz Kleineutersdorf Bucha Laasdorf Bürgel, Stadt Lehesten Crossen an der Lindig Elster Lippersdorf- Dornburg- Erdmannsdorf Camburg, Löberschütz Stadt Mertendorf Eichenberg Meusebach Eineborn Milda Eisenberg, Stadt Möckern Frauenprießnitz Mörsdorf Freienorla Nausnitz Geisenhain Neuengönna Gneus Oberbodnitz Golmsdorf Orlamünde, Gösen Stadt Graitschen b. Ottendorf Bürgel Petersberg Großbockedra Poxdorf Großeutersdorf Rattelsdorf Großlöbichau Rauda Großpürschütz Rauschwitz Gumperda Rausdorf Hainichen Reichenbach Hainspitz Reinstädt Hartmannsdorf Renthendorf Heideland Rothenstein Hermsdorf, Stadt Ruttersdorf- Hummelshain Lotschen Scheiditz Powered by Page 3 Schkölen, Stadt L'azienda Contatti Login Urbistat on Linkedin Provinces Schleifreisen Adminstat logo DEMOGRAPHY ECONOMY RANKINGS SEARCH Schlöben GERMANIA Schöngleina Schöps Seitenroda Serba Silbitz St.Gangloff Stadtroda,
    [Show full text]
  • Cycling, Hiking and Canoeing
    The way to conquer Bikes change, the landscape cycling is timeless. is on foot. FAIRY GROTTO TO FINNE HIKING TRAIL | 90KM UNSTRUT CYCLE PATH | 200KM ELSTER CYCLE PATH | 250KM SAALE CYCLE PATH | 427KM KYFFHÄUSER TRAIL | 240KM 90km, including 60km in the nature park The route connects the regions of Thuringia and Saxony- The lower reaches of the Elster Cycle Path from around The Saale Cycle Path begins in Zell in the Fichtel Moun- Saalfeld to Bad Frankenhausen, about 240km, of which The Finne is the easternmost foothill of the Harz Anhalt. It goes alongside the river from its source in Berga are for the most part near the banks of the River tains in northeast Bavaria, winds its way along the River 70km is in Saale-Unstrut-Triasland Geo Nature Park. mountains and is actually a ridge running through the Eichsfeld to its confluence with the Saale near Naumburg. Elster. This is not always the case in the upper reaches Saale through Thuringia and Saxony-Anhalt, and ends The trail follows the River Saale between Saalfeld and Saale-Unstrut region. A section of the Finne Hiking Trail It then continues through varied scenery such as Reiser because the river valley is narrow and rather steep. up in Barby on the Elbe. We recommend the section from Naumburg, and from Naumburg stays close to the River leads from Weissenfels to Rastenberg. Enjoy magnificent Valley (Reisersches Tal), the Unstrut Valley Nature Reserve This section is rather hilly and more suitable for athletic Jena to Wettin or Bernburg, which you can enjoy on well- Unstrut.
    [Show full text]
  • Interventional, Edoxaban Treatment in Routine Clinical Practice in Patients with Venous Thromboembolism in Europe (ETNA-VTE-Europe) Study Alexander T
    Cohen et al. Thrombosis Journal (2018) 16:9 https://doi.org/10.1186/s12959-018-0163-7 RESEARCH Open Access Design and rationale of the non- interventional, edoxaban treatment in routiNe clinical prActice in patients with venous ThromboEmbolism in Europe (ETNA-VTE-Europe) study Alexander T. Cohen1*,CihanAy2, Philippe Hainaut3,HervéDécousus4, Ulrich Hoffmann5,SeanGaine6, Michiel Coppens7, Pedro Marques da Silva8, David Jiménez9, Beatrice Amann-Vesti10, Bernd Brüggenjürgen11, Pierre Levy12, Julio Lopez Bastida13,EricVicaut14, Petra Laeis15, Eva-Maria Fronk15, Wolfgang Zierhut15,ThomasMalzer15, Peter Bramlage16 , Giancarlo Agnelli17 and on behalf of the ETNA-VTE-Europe investigators Abstract Background: Venous thromboembolism (VTE, including deep vein thrombosis [DVT] and pulmonary embolism [PE]) has an annual incidence rate of 104–183 per 100,000 person-years. After a VTE episode, the two-year recurrence rate is about 17%. Consequently, effective and safe anticoagulation is paramount. Edoxaban is a direct oral anticoagulant (DOAC) approved VTE treatment. Current safety and efficacy data are derived from clinical trials, and information about treatment durations beyond 12 months are not available. Methods: ETNA-VTE-Europe is an 18-month prospective, single-arm, non-interventional, multinational post-authorisation safety study. Approximately 310 sites across eight European countries (Austria, Belgium, Germany, Ireland, Italy, the Netherlands, Switzerland and the United Kingdom) will participate in the study, with the intention to represent the regional distributions of centres, healthcare settings and specialties. An estimated cohort of 2700 patients will be recruited, the only enrolment criteria being acute symptomatic VTE, no participation in an interventional study, and treating physician decision to prescribe edoxaban independently from the registry.
    [Show full text]