HYAL3 Antibody (R30955)

Total Page：16

File Type：pdf, Size：1020Kb

HYAL3 Antibody (R30955) Catalog No. Formulation Size R30955 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug Bulk quote request Availability 1-3 business days Species Reactivity Human, Mouse Format Antigen affinity purified Clonality Polyclonal (rabbit origin) Isotype Rabbit IgG Purity Antigen affinity Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide/thimerosal UniProt O43820 Applications Western blot : 0.5-1ug/ml IHC (FFPE) : 0.5-1ug/ml Limitations This HYAL3 antibody is available for research use only. Western blot testing of HYAL3 antibody and Lane 1: 22RV; 2: HeLa; 3: V20S cell lysate. Expected size: ~47KD IHC-P: HYAL3 antibody testing of human breast cancer tissue Description Hyaluronoglucosaminidase 3 is anenzyme that in humans is encoded by the HYAL3 gene, also known as LUCA3, Hyaluronidase-3, Lung carcinoma protein 3, LUCA-3, LUCA14, and Minna14. By Northern blot analysis, expression of a 2.1-kb transcript that was strongest in testis and bone marrow, but relatively weak in other organs. HYAL3 encodes a predicted 417-amino acid protein. This gene encodes a protein which is similar in structure to hyaluronidases. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is though to be involved in cell proliferation, migration and differentiation. However, this protein has not yet been shown to have hyaluronidase activity. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. Application Notes The stated application concentrations are suggested starting amounts. Titration of the HYAL3 antibody may be required due to differences in protocols and secondary/substrate sensitivity. Immunogen An amino acid sequence from the C-terminus of human Hyaluronoglucosaminidase 3 (SHQRCHGHGRCARRD) was used as the immunogen for this HYAL3 antibody. Storage After reconstitution, the HYAL3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. Ordering: Phone:858.663.9055 | Fax:1.267.821.0800 | Email:[email protected] Copyright © NSJ Bioreagents. All rights reserved.

Copy Link

Recommended publications

Hyaluronidase PH20 (SPAM1) Rabbit Polyclonal Antibody – TA337855
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA337855 Hyaluronidase PH20 (SPAM1) Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-SPAM1 antibody is: synthetic peptide directed towards the C- terminal region of Human SPAM1. Synthetic peptide located within the following region: CYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPMETEEPQIFYNASP Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Affinity Purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 58 kDa Gene Name: sperm adhesion molecule 1 Database Link: NP_694859 Entrez Gene 6677 Human P38567 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 Hyaluronidase PH20 (SPAM1) Rabbit Polyclonal Antibody – TA337855 Background: Hyaluronidase degrades hyaluronic acid, a major structural proteoglycan found in extracellular matrices and basement membranes. Six members of the hyaluronidase family are clustered into two tightly linked groups on chromosome 3p21.3 and 7q31.3. This gene was previously referred to as HYAL1 and HYA1 and has since been assigned the official symbol SPAM1; another family member on chromosome 3p21.3 has been assigned HYAL1.
[Show full text]
Identifying Host Genetic Factors Controlling Susceptibility to Blood-Stage Malaria in Mice
Identifying host genetic factors controlling susceptibility to blood-stage malaria in mice Aurélie Laroque Department of Biochemistry McGill University Montreal, Quebec, Canada December 2016 A thesis submitted to McGill University in partial fulfilment of the requirements of the degree of Doctor of Philosophy. © Aurélie Laroque, 2016 ABSTRACT This thesis examines genetic factors controlling host response to blood stage malaria in mice. We first phenotyped 25 inbred strains for resistance/susceptibility to Plasmodium chabaudi chabaudi AS infection. A broad spectrum of responses was observed, which suggests rich genetic diversity among different mouse strains in response to malaria. A F2 intercross was generated between susceptible SM/J and resistant C57BL/6 mice and the progeny was phenotyped for susceptibility to P. chabaudi chabaudi AS infection. A whole genome scan revealed the Char1 locus as a key regulator of parasite density. Using a haplotype mapping approach, we reduced the locus to a 0.4Mb conserved interval that segregates with resistance/susceptibility to infection for the search of positional candidate genes. In addition, I pursued the work on the Char10 locus that was previously identified in [AcB62xCBA/PK]F2 animals (LOD=10.8, 95% Bayesian CI=50.7-75Mb). Pyruvate kinase deficiency was found to protect mice and humans against malaria. However, AcB62 mice are susceptible to P. chabaudi infection despite carrying the protective PklrI90N mutation. We characterized the Char10 locus and showed that it modulates the severity of the pyruvate deficiency phenotype by regulating erythroid responses. We created 4 congenic lines carrying different portions of the Char10 interval and demonstrated that Char10 is found within a maximal 4Mb interval.
[Show full text]
HYAL3 (E-11): Sc-377430
SANTA CRUZ BIOTECHNOLOGY, INC. HYAL3 (E-11): sc-377430 BACKGROUND APPLICATIONS Hyaluronidases (HAases or HYALs) are a family of lysosomal enzymes that are HYAL3 (E-11) is recommended for detection of HYAL3 of human origin by crucial for the spread of bacterial infections and of toxins present in a vari- Western Blotting (starting dilution 1:100, dilution range 1:100-1:1000), ety of venoms. HYALs may also be involved in the progression of cancer. In immunoprecipitation [1-2 µg per 100-500 µg of total protein (1 ml of cell humans, six HYAL proteins have been identified. HYAL proteins use hydroly- lysate)], immunofluorescence (starting dilution 1:50, dilution range 1:50- sis to degrade hyaluronic acid (HA), which is present in body fluids, tissues, 1:500), immunohistochemistry (including paraffin-embedded sections) and the extracellular matrix of vertebrate tissues. HA keeps tissues hydrated, (starting dilution 1:50, dilution range 1:50-1:500) and solid phase ELISA maintains osmotic balance, and promotes cell proliferation, differentiation, (starting dilution 1:30, dilution range 1:30-1:3000). and metastasis. HA is also an important structural component of cartilage Suitable for use as control antibody for HYAL3 siRNA (h): sc-60826, HYAL3 and acts as a lubricant in joints. HYAL3 is a 417-amino acid protein that is shRNA Plasmid (h): sc-60826-SH and HYAL3 shRNA (h) Lentiviral Particles: highly expressed in testis and bone marrow, but has relatively low expression sc-60826-V. in all other tissues. Unlike HYAL 1 and HYAL2, HYAL3 is an unlikely tumor supressor candidate, given the lack of detected mutations in its gene.
[Show full text]
Hyaluronidase PH20 (SPAM1) (NM 003117) Human Mass Spec Standard – PH305378 | Origene
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for PH305378 Hyaluronidase PH20 (SPAM1) (NM_003117) Human Mass Spec Standard Product data: Product Type: Mass Spec Standards Description: SPAM1 MS Standard C13 and N15-labeled recombinant protein (NP_003108) Species: Human Expression Host: HEK293 Expression cDNA Clone RC205378 or AA Sequence: Predicted MW: 58.2 kDa Protein Sequence: >RC205378 representing NM_003117 Red=Cloning site Green=Tags(s) MGVLKFKHIFFRSFVKSSGVSQIVFTFLLIPCCLTLNFRAPPVIPNVPFLWAWNAPSEFCLGKFDEPLDM SLFSFIGSPRINATGQGVTIFYVDRLGYYPYIDSITGVTVNGGIPQKISLQDHLDKAKKDITFYMPVDNL GMAVIDWEEWRPTWARNWKPKDVYKNRSIELVQQQNVQLSLTEATEKAKQEFEKAGKDFLVETIKLGKLL RPNHLWGYYLFPDCYNHHYKKPGYNGSCFNVEIKRNDDLSWLWNESTALYPSIYLNTQQSPVAATLYVRN RVREAIRVSKIPDAKSPLPVFAYTRIVFTDQVLKFLSQDELVYTFGETVALGASGIVIWGTLSIMRSMKS CLLLDNYMETILNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSSDYLHLNPDNFAIQLEKGGKFTVRGK PTLEDLEQFSEKFYCSCYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPMETEEPQIFYNASPSTLS ATMFIWRLEVWDQGISRIGFF myc-FLAG tag Tag: C-Myc/DDK Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining Concentration: 50 ug/ml as determined by BCA Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. RefSeq:
[Show full text]
HYAL1LUCA-1, a Candidate Tumor Suppressor Gene on Chromosome 3P21.3, Is Inactivated in Head and Neck Squamous Cell Carcinomas by Aberrant Splicing of Pre-Mrna
Oncogene (2000) 19, 870 ± 878 ã 2000 Macmillan Publishers Ltd All rights reserved 0950 ± 9232/00 $15.00 www.nature.com/onc HYAL1LUCA-1, a candidate tumor suppressor gene on chromosome 3p21.3, is inactivated in head and neck squamous cell carcinomas by aberrant splicing of pre-mRNA Gregory I Frost1,3, Gayatry Mohapatra2, Tim M Wong1, Antonei Benjamin CsoÂ ka1, Joe W Gray2 and Robert Stern*,1 1Department of Pathology, School of Medicine, University of California, San Francisco, California, CA 94143, USA; 2Cancer Genetics Program, UCSF Cancer Center, University of California, San Francisco, California, CA 94115, USA The hyaluronidase ®rst isolated from human plasma, genes in the process of carcinogenesis (Sager, 1997; Hyal-1, is expressed in many somatic tissues. The Hyal- Baylin et al., 1998). Nevertheless, functionally 1 gene, HYAL1, also known as LUCA-1, maps to inactivating point mutations are generally viewed as chromosome 3p21.3 within a candidate tumor suppressor the critical `smoking gun' when de®ning a novel gene locus de®ned by homozygous deletions and by TSG. functional tumor suppressor activity. Hemizygosity in We recently mapped the HYAL1 gene to human this region occurs in many malignancies, including chromosome 3p21.3 (CsoÂ ka et al., 1998), con®rming its squamous cell carcinomas of the head and neck. We identity with LUCA-1, a candidate tumor suppressor have investigated whether cell lines derived from such gene frequently deleted in small cell lung carcinomas malignancies expressed Hyal-1 activity, using normal (SCLC) (Wei et al., 1996). The HYAL1 gene resides human keratinocytes as controls. Hyal-1 enzyme activity within a commonly deleted region of 3p21.3 where a and protein were absent or markedly reduced in six of potentially informative 30 kb homozygous deletion has seven carcinoma cell lines examined.
[Show full text]
Cross-Disorder Genetic Analyses Implicate Dopaminergic Signaling As a Biological Link Between Attention-Deficit/Hyperactivity Di
Cross-disorder genetic analyses implicate dopaminergic signaling as a biological link between Attention-Deficit/Hyperactivity Disorder and obesity measures SUPPLEMENTARY MATERIAL Supportive information – Methods Candidate gene-set association analyses Gene-set assembly For our candidate gene-set analyses, we assembled dopaminergic neurotransmission (DOPA) and circadian rhythm (CIRCA) gene-sets based on the Kyoto Encyclopedia of Genes and Genomes (KEGG) and the Gene Ontology (GO) databases, queried in September 2016. DOPA gene set: From the KEGG database, we included genes covered by the Dopaminergic synapse (hsa04728) and/or Tyrosine metabolism (hsa00350) pathways and from the GO database we included genes present in (at least) one of the following terms (GO: accession number): dopamine transport (GO:0015872), dopamine receptor signaling pathway (GO:0007212), dopamine receptor binding (GO:0050780), synaptic transmission, dopaminergic (GO:0001963), dopaminergic neuron axon guidance (GO:0036514), dopaminergic neuron differentiation (GO:0071542), response to dopamine (GO:1903350), and dopamine metabolic process (GO:0042417). This resulted in 155 genes from KEGG database and 144 genes from GO, of which 24 were in common, totalizing 275 genes. From these, we found 273 genes in the MAGMA gene template ("KIF5C" and "PPP2R3B" were not present), including 9 genes located on chromosome X, which was not covered by our analyses. CIRCA gene set: From the KEGG database, we included genes comprised by the Circadian rhythm (hsa04710) and/or Circadian entrainment (hsa04713) pathways and, from the GO database we included genes present in the circadian rhythm (GO:0007623) GO term. This resulted in 123 genes from the KEGG database and 197 genes from GO, of which 27 were in common, totalizing 293 genes.
[Show full text]
Qt8b18n6c6 Nosplash Caf9e24
Copyright 2014 by Christopher K. Fuller ii For Kai and Lena iii Acknowledgements This work would not have been possible without the support of my research advisor Hao Li. His broad base of interests gave me the freedom to search for something that so well matches my inclinations. I appreciate his insight, enthusiasm, skepticism, and overall encouragement of this effort. I wish to thank my committee, Saunak Sen and Kathleen Giacomini, for their suggestions and support. I wish to thank postdoctoral scholar Xin He for catalyzing the research that became the focus of my work. In addition, I wish to thank postdoctoral scholar Jiashun Zheng for his numerous suggestions and support. I wish to thank the thousands of anonymous individuals who make integrative genomics research possible by providing samples and the researchers dedicated to making these widely available. In addition, I wish to thank the MuTHER and DIAGRAM consortia for providing access to their full summary results. I wish to thank my wife, Sharoni, for her support and for permitting me to encroach on her domain of expertise. You are still the real biologist in the family. Finally, I wish to thank my Mom and Dad ... who took me to the library. iv Abstract Genome-wide association studies (GWAS) have linked various complex diseases to many dozens, sometimes hundreds, of individual genomic loci. Since these are generally of small effect and may lack both functional annotations and an obvious relation to other disease-associated regions, they are difficult to place in a functional context that advances our understanding of the disease.
[Show full text]
Atlas Journal
Atlas of Genetics and Cytogenetics in Oncology and Haematology Home Genes Leukemias Solid Tumours Cancer-Prone Deep Insight Portal Teaching X Y 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 NA Atlas Journal Atlas Journal versus Atlas Database: the accumulation of the issues of the Journal constitutes the body of the Database/Text-Book. TABLE OF CONTENTS Volume 12, Number 4, Jul-Aug 2008 Previous Issue / Next Issue Genes AKR1C3 (aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II)) (10p15.1). Hsueh Kung Lin. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 498-502. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/AKR1C3ID612ch10p15.html CASP1 (caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase)) (11q22.3). Yatender Kumar, Vegesna Radha, Ghanshyam Swarup. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 503-518. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/CASP1ID145ch11q22.html GCNT3 (glucosaminyl (N-acetyl) transferase 3, mucin type) (15q21.3). Prakash Radhakrishnan, Pi-Wan Cheng. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 519-524. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/GCNT3ID44105ch15q21.html HYAL2 (Hyaluronoglucosaminidase 2) (3p21.3). Lillian SN Chow, Kwok-Wai Lo. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 525-529. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/HYAL2ID40904ch3p21.html LMO2 (LIM domain only 2 (rhombotin-like 1)) (11p13) - updated. Pieter Van Vlierberghe, Jean Loup Huret. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 530-535. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/RBTN2ID34.html PEBP1 (phosphatidylethanolamine binding protein 1) (12q24.23).
[Show full text]
HYAL3 (E-4): Sc-374036
SANTA CRUZ BIOTECHNOLOGY, INC. HYAL3 (E-4): sc-374036 BACKGROUND APPLICATIONS Hyaluronidases (HAases or HYALs) are a family of lysosomal enzymes that are HYAL3 (E-4) is recommended for detection of HYAL3 of mouse, rat and crucial for the spread of bacterial infections and of toxins present in a variety human origin by Western Blotting (starting dilution 1:100, dilution range of venoms. HYALs may also be involved in the progression of cancer. In 1:100-1:1000), immunoprecipitation [1-2 µg per 100-500 µg of total protein humans, six HYAL proteins have been identified. HYAL proteins use hydrolysis (1 mlof cell lysate)], immunofluorescence (starting dilution 1:50, dilution to degrade hyaluronic acid (HA), which is present in body fluids, tissues, and range 1:50-1:500), immunohistochemistry (including paraffin-embedded the extracellular matrix of vertebrate tissues. HA keeps tissues hydrated, sections) (starting dilution 1:50, dilution range 1:50-1:500) and solid phase maintains osmotic balance, and promotes cell proliferation, differentiation, ELISA (starting dilution 1:30, dilution range 1:30-1:3000). and metastasis. HA is also an important structural component of cartilage and Suitable for use as control antibody for HYAL3 siRNA (h): sc-60826, HYAL3 acts as a lubricant in joints. HYAL3 is a 417-amino acid protein that is highly siRNA (m): sc-60827, HYAL3 siRNA Plasmid (h): sc-60826-SH, HYAL3 shRNA expressed in testis and bone marrow, but has relatively low expression in all Plasmid (m): sc-60827-SH, HYAL3 shRNA (h) Lentiviral Particles: sc-60826-V other tissues. Unlike HYAL 1 and HYAL2, HYAL3 is an unlikely tumor supressor and HYAL3 shRNA (m) Lentiviral Particles: sc-60827-V.
[Show full text]
Genome-Wide Association Study and Pathway Analysis for Female Fertility Traits in Iranian Holstein Cattle
Ann. Anim. Sci., Vol. 20, No. 3 (2020) 825–851 DOI: 10.2478/aoas-2020-0031 GENOME-WIDE ASSOCIATION STUDY AND PATHWAY ANALYSIS FOR FEMALE FERTILITY TRAITS IN IRANIAN HOLSTEIN CATTLE Ali Mohammadi1, Sadegh Alijani2♦, Seyed Abbas Rafat2, Rostam Abdollahi-Arpanahi3 1Department of Genetics and Animal Breeding, University of Tabriz, Tabriz, Iran 2Department of Animal Science, Faculty of Agriculture, University of Tabriz, Tabriz, Iran 3Department of Animal Science, University College of Abureyhan, University of Tehran, Tehran, Iran ♦Corresponding author: [email protected] Abstract Female fertility is an important trait that contributes to cow’s profitability and it can be improved by genomic information. The objective of this study was to detect genomic regions and variants affecting fertility traits in Iranian Holstein cattle. A data set comprised of female fertility records and 3,452,730 pedigree information from Iranian Holstein cattle were used to predict the breed- ing values, which were then employed to estimate the de-regressed proofs (DRP) of genotyped animals. A total of 878 animals with DRP records and 54k SNP markers were utilized in the ge- nome-wide association study (GWAS). The GWAS was performed using a linear regression model with SNP genotype as a linear covariate. The results showed that an SNP on BTA19, ARS-BFGL- NGS-33473, was the most significant SNP associated with days from calving to first service. In total, 69 significant SNPs were located within 27 candidate genes. Novel potential candidate genes include OSTN, DPP6, EphA5, CADPS2, Rfc1, ADGRB3, Myo3a, C10H14orf93, KIAA1217, RBPJL, SLC18A2, GARNL3, NCALD, ASPH, ASIC2, OR3A1, CHRNB4, CACNA2D2, DLGAP1, GRIN2A and ME3.
[Show full text]
Candidate Tumor Suppressor HYAL2 Is a Glycosylphosphatidylinositol (GPI
Candidate tumor suppressor HYAL2 is a glycosylphosphatidylinositol (GPI)-anchored cell-surface receptor for jaagsiekte sheep retrovirus, the envelope protein of which mediates oncogenic transformation Sharath K. Rai*†, Fuh-Mei Duh†‡, Vladimir Vigdorovich*, Alla Danilkovitch-Miagkova§, Michael I. Lerman§, and A. Dusty Miller*¶ *Fred Hutchinson Cancer Research Center, Seattle, WA 98109; and ‡Intramural Research Support Program, Science Applications International Corporation-Frederick, §Laboratory of Immunobiology, Division of Basic Sciences, National Cancer Institute, Frederick Cancer Research and Development Center, Frederick, MD 21702 Edited by John M. Cofﬁn, Tufts University School of Medicine, Boston, MA, and approved January 29, 2001 (received for review December 4, 2000) Jaagsiekte sheep retrovirus (JSRV) can induce rapid, multifocal lung targeted to the lung, provided that the pathogenic features of the cancer, but JSRV is a simple retrovirus having no known oncogenes. virus can be controlled. Identification of the JSRV receptor and Here we show that the envelope (env) gene of JSRV has the unusual determination of the pattern of receptor expression in the lung will property that it can induce transformation in rat ﬁbroblasts, and thus help identify cells that can be targeted by JSRV vectors. is likely to be responsible for oncogenesis in animals. Retrovirus entry To facilitate identification of the JSRV receptor, we made into cells is mediated by Env interaction with particular cell-surface retrovirus packaging cells that produce a retrovirus vector with Gag receptors, and we have used phenotypic screening of radiation hybrid and Pol proteins from Moloney murine leukemia virus, Env protein cell lines to identify the candidate lung cancer tumor suppressor from JSRV, and a retroviral vector genome (LAPSN) that encodes HYAL2͞LUCA2 as the receptor for JSRV.
[Show full text]
Genetic Association and Gene-Gene Interaction of HAS2, HABP1 and HYAL3 Implicate Hyaluronan Metabolic Genes in Glaucomatous Neurodegeneration
Disease Markers 33 (2012) 145–154 145 DOI 10.3233/DMA-2012-0915 IOS Press Genetic association and gene-gene interaction of HAS2, HABP1 and HYAL3 implicate hyaluronan metabolic genes in glaucomatous neurodegeneration Kaustuv Basua, Abhijit Senb, Kunal Rayc, Ilora Ghosha, Kasturi Dattaa,∗ and Arijit Mukhopadhyayd,∗ aBiochemistry Laboratory, School of Environmental Sciences, Jawaharlal Nehru University, New Delhi, India bDristi Pradip, Jodhpur Park, Kolkata, India cMolecular and Human Genetics Division, CSIR-Indian Institute of Chemical Biology, Kolkata, India dGenomics and Molecular Medicine, CSIR-Institute of Genomics and Integrative Biology, Delhi, India Abstract. Hyaluronan (HA) plays a significant role in maintaining aqueous humor outflow in trabecular meshwork, the primary ocular tissue involved in glaucoma. We examined potential association of the single nucleotide polymorphisms (SNPs) of the HA synthesizing gene – hyaluronan synthase 2 (HAS2), hyaluronan binding protein 1 (HABP1) and HA catabolic gene hyaluronidase 3(HYAL3) in the primary open angle glaucoma (POAG) patients in the Indian population. Thirteen tagged SNPs (6 for HAS2, 3forHABP1 and4forHYAL3) were genotyped in 116 high tension (HTG), 321 non-high tension glaucoma (NHTG) samples and 96 unrelated, age-matched, glaucoma-negative, control samples. Allelic and genotypic association were analyzed by PLINK v1.04; haplotypes were identified using PHASE v2.1 and gene-gene interaction was analyzed using multifactor dimensionality reduction (MDR) v2.0. An allelic association (rs6651224; p = 0.03; OR: 0.49; 95% CI: 0.25–0.94) was observed at the second intron (C>G) of HAS2 both for NHTG and HTG. rs1057308 revealed a genotypic association (p = 0.03) at the 5’ UTR of HAS2 with only HTG.
[Show full text]