DOCSLIB.ORG

Candidate Tumor Suppressor HYAL2 Is a Glycosylphosphatidylinositol (GPI

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Candidate Tumor Suppressor HYAL2 Is a Glycosylphosphatidylinositol (GPI Candidate tumor suppressor HYAL2 is a glycosylphosphatidylinositol (GPI)-anchored cell-surface receptor for jaagsiekte sheep retrovirus, the envelope protein of which mediates oncogenic transformation Sharath K. Rai*†, Fuh-Mei Duh†‡, Vladimir Vigdorovich*, Alla Danilkovitch-Miagkova§, Michael I. Lerman§, and A. Dusty Miller*¶ *Fred Hutchinson Cancer Research Center, Seattle, WA 98109; and ‡Intramural Research Support Program, Science Applications International Corporation-Frederick, §Laboratory of Immunobiology, Division of Basic Sciences, National Cancer Institute, Frederick Cancer Research and Development Center, Frederick, MD 21702 Edited by John M. Coffin, Tufts University School of Medicine, Boston, MA, and approved January 29, 2001 (received for review December 4, 2000) Jaagsiekte sheep retrovirus (JSRV) can induce rapid, multifocal lung targeted to the lung, provided that the pathogenic features of the cancer, but JSRV is a simple retrovirus having no known oncogenes. virus can be controlled. Identification of the JSRV receptor and Here we show that the envelope (env) gene of JSRV has the unusual determination of the pattern of receptor expression in the lung will property that it can induce transformation in rat fibroblasts, and thus help identify cells that can be targeted by JSRV vectors. is likely to be responsible for oncogenesis in animals. Retrovirus entry To facilitate identification of the JSRV receptor, we made into cells is mediated by Env interaction with particular cell-surface retrovirus packaging cells that produce a retrovirus vector with Gag receptors, and we have used phenotypic screening of radiation hybrid and Pol proteins from Moloney murine leukemia virus, Env protein cell lines to identify the candidate lung cancer tumor suppressor from JSRV, and a retroviral vector genome (LAPSN) that encodes HYAL2͞LUCA2 as the receptor for JSRV. HYAL2 was previously de- human placental alkaline phosphatase (AP) as a marker for vector scribed as a lysosomal hyaluronidase, but we show that HYAL2 is transduction (4). This vector was able to transduce sheep and actually a glycosylphosphatidylinositol (GPI)-anchored cell-surface human cells, with the exception of HeLa cells, but was unable to protein. Furthermore, we could not detect hyaluronidase activity transduce cells from mice, rats, and hamsters because of the lack of associated with or secreted by cells expressing HYAL2, whereas we functional receptors for JSRV Env. could easily detect such activity from cells expressing the related The presence of a functional receptor in human cells and its serum hyaluronidase HYAL1. Although the function of HYAL2 is absence in hamster cells allowed us to use phenotypic screening currently unknown, other GPI-anchored proteins are involved in of human͞hamster radiation hybrid cell lines (5) to localize the signal transduction, and some mediate mitogenic responses, suggest- receptor in the human genome. We assayed the Stanford G3 ing a potential role of HYAL2 in JSRV Env-mediated oncogenesis. Lung panel of 83 human͞hamster radiation hybrid clones for suscep- cancer induced by JSRV closely resembles human bronchiolo-alveolar tibility to transduction by the JSRV vector. Each hybrid contains carcinoma, a disease that is increasing in frequency and now accounts a full complement of hamster chromosomes and multiple radi- for Ϸ25% of all lung cancer. The finding that JSRV env is oncogenic ation-fragmented pieces of human DNA with average size of Ϸ4 and the identification of HYAL2 as the JSRV receptor provide tools for megabases and representing Ϸ18% of the human genome. These further investigation of the mechanism of JSRV oncogenesis and its hybrids have been screened by PCR for the presence or absence relationship to human bronchiolo-alveolar carcinoma. of Ͼ15,000 unique human DNA markers to generate a high resolution map of the human genome. Assuming that vector aagsiekte sheep retrovirus (JSRV) is the causative agent of a transduction correlates with the presence of the receptor gene, Jcontagious lung cancer of sheep called ovine pulmonary carci- we identified several markers that were closely linked to the noma or sheep pulmonary adenomatosis (1). Tumors originate JSRV receptor and thereby localized the receptor to the p21.3 from type II secretory alveolar and nonciliated bronchiolar epithe- band of human chromosome 3 (4). lial cells, and late stages of the disease are accompanied by the Here, we show that the JSRV receptor maps to a region of secretion of copious lung fluid containing the virus. Purified virus 3p21.3 that had previously been sequenced in a search for lung induces multifocal tumors in as little as 10 days (2), suggesting the cancer tumor suppressor genes localized to this region by analysis role of a viral oncogene. However, JSRV is a simple retrovirus with of chromosomal deletions in lung and breast cancers (6, 7), and typical gag, pol, and env genes and no known oncogenes. The viral show that the receptor is HYAL2. We have characterized the structural (Gag) and enzymatic (Pol) proteins are unlikely to be responsible, because they interact primarily with viral components, but there is precedent for alteration of cellular functions by the This paper was submitted directly (Track II) to the PNAS office. envelope (Env) protein of retroviruses, which interacts with cellular Abbreviations: JSRV, jaagsiekte sheep retrovirus; GPI, glycosylphosphatidylinositol; AP, CELL BIOLOGY components to mediate virus entry. For example, the deleted Env alkaline phosphatase; Env, envelope; PI-PLC, phosphatidylinositol-specific phospholipase C; CMV, cytomegalovirus; ␤-gal, ␤-galactosidase. protein of the Friend spleen focus-forming virus causes erythro- leukemia by binding to and activating the erythropoietin receptor See commentary on page 4285. † (3). If the JSRV Env protein was indeed oncogenic, identification S.K.R. and F.-M.D. contributed equally to this work. of the host cell receptor for JSRV would provide key insights into ¶To whom reprint requests should be addressed at: Fred Hutchinson Cancer Research Center, Room C2-105, 1100 Fairview Avenue North, Seattle, WA 98109-1024. E-mail: the oncogenic mechanism of this highly pathogenic retrovirus. [email protected]. Furthermore, the contagious nature of JSRV and its ability to The publication costs of this article were defrayed in part by page charge payment. This survive exposure to proteases and surfactants present in lung fluid article must therefore be hereby marked “advertisement” in accordance with 18 U.S.C. suggest that vectors based on JSRV might be useful for gene therapy §1734 solely to indicate this fact. www.pnas.org͞cgi͞doi͞10.1073͞pnas.071572898 PNAS ͉ April 10, 2001 ͉ vol. 98 ͉ no. 8 ͉ 4443–4448 Downloaded by guest on October 2, 2021 receptor and show that it is a glycosylphosphatidylinositol (GPI)- 1unit͞ml, and the cells were incubated at 4°C for 4 h. Cells were anchored cell-surface protein. Although HYAL2 is related to pelleted, and the supernatants were transferred into new tubes known hyaluronidases, HYAL2 exhibited no hyaluronidase ac- containing protease inhibitor mixture (Sigma) for Western blot- tivity, and its normal function is currently unknown. Finally, we ting analysis. The pelleted cells were washed two times with PBS show that the env gene of JSRV can transform cultured fibro- and divided into two fractions for immunostaining and Western blasts, setting the stage for further work to determine the role of blot analysis. the receptor in JSRV Env-mediated oncogenesis. For Western blot analysis, the cells were lysed in 50 mM Hepes (pH 7.4), 150 mm NaCl, 10% glycerol, 1 mM EDTA, 1 mM Materials and Methods sodium orthovanadate, 10 mM sodium pyrophosphate, 100 mM Plasmid Expression Vectors. All cDNAs were expressed by using a NaF, 1% Triton X-100, 10 ␮g͞ml leupeptin, 10 units͞ml apro- cytomegalovirus (CMV) immediate early promoter and a bovine tinin, and 1 mM PMSF. Insoluble material was removed by growth hormone gene polyadenylation signal. By convention, hu- centrifugation. Flag-tagged HYAL2 was immunoprecipitated man protein names are capitalized whereas only the initial letter is from the clarified cell lysates and supernatants from PI-PLC- capitalized for those of mouse. Most were expressed by using treated cells by using anti-Flag goat antibodies (Santa Cruz pCR3.1 (Invitrogen), with the exception of mouse Hyal1, which was Biotechnology) and protein-G-agarose conjugate (GIBCO͞ expressed by using pcDNA3.1 (Invitrogen). Expression vectors for BRL). Precipitated proteins were separated by electrophoresis human HYAL4 and SPAM1 and for mouse Hyal1 and Hyal3 were in 8–16% polyacrylamide gels containing SDS and were trans- kind gifts from Antonei Csoka and Robert Stern (University of ferred to a nitrocellulose membrane; Flag-tagged HYAL2 was California, San Francisco). Accession numbers for hyaluronidase detected by using anti-Flag monoclonal antibodies (Upstate family member cDNAs are as follows: HYAL1, U03056; HYAL2, Biotechnology, Lake Placid, NY). U09577; HYAL3, AF036035; HYAL4, AF009010; human For immunofluorescence analysis, the transfected 293 cells SPAM1, L13781; Hyal1, AF011567; and Hyal2, AF302843. Amino- were placed on coverslips precoated with polylysine (molecular terminal Flag-tagged proteins were made by cloning the cDNAs weight 70,000–150,000, Sigma) and were fixed in 3.7% formal- into pFLAG-CMV2 (Flag tag without an endoplasmic reticulum dehyde in PBS for 30 min at room temperature. For some signal sequence) or pFLAG-CMV1 (preprotrypsin
Load more

Recommended publications
  • Identification of Novel Genetic Variants Associated with Short Stature in A
    Human Genetics https://doi.org/10.1007/s00439-020-02191-x ORIGINAL INVESTIGATION Identifcation of novel genetic variants associated with short stature in a Baka Pygmies population Matteo Zoccolillo1 · Claudia Moia2 · Sergio Comincini2 · Davide Cittaro3 · Dejan Lazarevic3 · Karen A. Pisani1 · Jan M. Wit4 · Mauro Bozzola5 Received: 1 April 2020 / Accepted: 30 May 2020 © The Author(s) 2020 Abstract Human growth is a complex trait determined by genetic factors in combination with external stimuli, including environment, nutrition and hormonal status. In the past, several genome-wide association studies (GWAS) have collectively identifed hundreds of genetic variants having a putative efect on determining adult height in diferent worldwide populations. Theo- retically, a valuable approach to better understand the mechanisms of complex traits as adult height is to study a population exhibiting extreme stature phenotypes, such as African Baka Pygmies. After phenotypic characterization, we sequenced the whole exomes of a cohort of Baka Pygmies and their non-Pygmies Bantu neighbors to highlight genetic variants associated with the reduced stature. Whole exome data analysis revealed 29 single nucleotide polymorphisms (SNPs) signifcantly associated with the reduced height in the Baka group. Among these variants, we focused on SNP rs7629425, located in the 5′-UTR of the Hyaluronidase-2 (HYAL2) gene. The frequency of the alternative allele was signifcantly increased compared to African and non-African populations. In vitro luciferase assay showed signifcant diferences in transcription modulation by rs7629425 C/T alleles. In conclusion, our results suggested that the HYAL2 gene variants may play a role in the etiology of short stature in Baka Pygmies population.
    [Show full text]
  • Hyaluronidase PH20 (SPAM1) Rabbit Polyclonal Antibody – TA337855
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA337855 Hyaluronidase PH20 (SPAM1) Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-SPAM1 antibody is: synthetic peptide directed towards the C- terminal region of Human SPAM1. Synthetic peptide located within the following region: CYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPMETEEPQIFYNASP Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Affinity Purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 58 kDa Gene Name: sperm adhesion molecule 1 Database Link: NP_694859 Entrez Gene 6677 Human P38567 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 Hyaluronidase PH20 (SPAM1) Rabbit Polyclonal Antibody – TA337855 Background: Hyaluronidase degrades hyaluronic acid, a major structural proteoglycan found in extracellular matrices and basement membranes. Six members of the hyaluronidase family are clustered into two tightly linked groups on chromosome 3p21.3 and 7q31.3. This gene was previously referred to as HYAL1 and HYA1 and has since been assigned the official symbol SPAM1; another family member on chromosome 3p21.3 has been assigned HYAL1.
    [Show full text]
  • HYAL2 Antibody (R30915)
    HYAL2 Antibody (R30915) Catalog No. Formulation Size R30915 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug Bulk quote request Availability 1-3 business days Species Reactivity Human, Mouse, Rat. Format Antigen affinity purified Clonality Polyclonal (rabbit origin) Isotype Rabbit IgG Purity Antigen affinity Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide/thimerosal UniProt Q12891 Applications Western blot : 0.5-1ug/ml Limitations This HYAL2 antibody is available for research use only. Western blot testing of HYAL2 antibody and Lane 1: HeLa; 2: SMMC-7721; 3: COLO320; 4: MCF-7; 5: HT1080 cell lysate Description Hyaluronoglucosaminidase 2, also known as hyaluronidase 2, and LuCa-2, is an enzyme that in humans is encoded by the HYAL2 gene. HYAL2 cDNAs encode a preprotein with an N-terminal signal peptide. Northern blot analysis indicated that the gene was expressed in all human tissues tested except adult brain, and Western blot analysis detected the protein in all mouse tissues examined except adult brain. HYAL2 is a glycosylphosphatidylinositol (GPI)-anchored protein on the cell surface and serves as a receptor for entry into the cell of the jaagsiekte sheep retrovirus (JSRV). The findings of Rai et al.(2001) that HYAL2 is a GPI-anchored protein on the cell surface showed that GFP would likely be cleaved from HYAL2 during GPI addition, leaving HYAL2 on the cell surface and resulting in GFP transit to the lysosome for degradation. Application Notes The stated application concentrations are suggested starting amounts. Titration of the HYAL2 antibody may be required due to differences in protocols and secondary/substrate sensitivity.
    [Show full text]
  • Identifying Host Genetic Factors Controlling Susceptibility to Blood-Stage Malaria in Mice
    Identifying host genetic factors controlling susceptibility to blood-stage malaria in mice Aurélie Laroque Department of Biochemistry McGill University Montreal, Quebec, Canada December 2016 A thesis submitted to McGill University in partial fulfilment of the requirements of the degree of Doctor of Philosophy. © Aurélie Laroque, 2016 ABSTRACT This thesis examines genetic factors controlling host response to blood stage malaria in mice. We first phenotyped 25 inbred strains for resistance/susceptibility to Plasmodium chabaudi chabaudi AS infection. A broad spectrum of responses was observed, which suggests rich genetic diversity among different mouse strains in response to malaria. A F2 intercross was generated between susceptible SM/J and resistant C57BL/6 mice and the progeny was phenotyped for susceptibility to P. chabaudi chabaudi AS infection. A whole genome scan revealed the Char1 locus as a key regulator of parasite density. Using a haplotype mapping approach, we reduced the locus to a 0.4Mb conserved interval that segregates with resistance/susceptibility to infection for the search of positional candidate genes. In addition, I pursued the work on the Char10 locus that was previously identified in [AcB62xCBA/PK]F2 animals (LOD=10.8, 95% Bayesian CI=50.7-75Mb). Pyruvate kinase deficiency was found to protect mice and humans against malaria. However, AcB62 mice are susceptible to P. chabaudi infection despite carrying the protective PklrI90N mutation. We characterized the Char10 locus and showed that it modulates the severity of the pyruvate deficiency phenotype by regulating erythroid responses. We created 4 congenic lines carrying different portions of the Char10 interval and demonstrated that Char10 is found within a maximal 4Mb interval.
    [Show full text]
  • HYAL3 (E-11): Sc-377430
    SANTA CRUZ BIOTECHNOLOGY, INC. HYAL3 (E-11): sc-377430 BACKGROUND APPLICATIONS Hyaluronidases (HAases or HYALs) are a family of lysosomal enzymes that are HYAL3 (E-11) is recommended for detection of HYAL3 of human origin by crucial for the spread of bacterial infections and of toxins present in a vari- Western Blotting (starting dilution 1:100, dilution range 1:100-1:1000), ety of venoms. HYALs may also be involved in the progression of cancer. In immunoprecipitation [1-2 µg per 100-500 µg of total protein (1 ml of cell humans, six HYAL proteins have been identified. HYAL proteins use hydroly- lysate)], immunofluorescence (starting dilution 1:50, dilution range 1:50- sis to degrade hyaluronic acid (HA), which is present in body fluids, tissues, 1:500), immunohistochemistry (including paraffin-embedded sections) and the extracellular matrix of vertebrate tissues. HA keeps tissues hydrated, (starting dilution 1:50, dilution range 1:50-1:500) and solid phase ELISA maintains osmotic balance, and promotes cell proliferation, differentiation, (starting dilution 1:30, dilution range 1:30-1:3000). and metastasis. HA is also an important structural component of cartilage Suitable for use as control antibody for HYAL3 siRNA (h): sc-60826, HYAL3 and acts as a lubricant in joints. HYAL3 is a 417-amino acid protein that is shRNA Plasmid (h): sc-60826-SH and HYAL3 shRNA (h) Lentiviral Particles: highly expressed in testis and bone marrow, but has relatively low expression sc-60826-V. in all other tissues. Unlike HYAL 1 and HYAL2, HYAL3 is an unlikely tumor supressor candidate, given the lack of detected mutations in its gene.
    [Show full text]
  • Molecular Basis, Diagnosis and Clinical Management Of
    cardio_special issue 2013_biomarin:Hrev_master 05/03/13 09.19 Pagina 2 Cardiogenetics 2013; 3(s1):exxxx3(s1):e2 Molecular basis, diagnosis storage of glycosaminoglycans (GAGs), previ- ously called mucopolysaccharides.1 The defi- Correspondence: Rossella Parini, Department of and clinical management of ciency of one of the enzymes participating in Pediatrics, San Gerardo Hospital, Via Pergolesi mucopolysaccharidoses the GAGs degradation pathway causes progres- 33, 20900 Monza, Italy. sive storage in the lysosomes and consequently Tel. +39.039.2333286 - Fax: +39.039.2334364. E-mail: [email protected] Rossella Parini,1 Francesca Bertola,2 in the cells and results in tissues and organs 3 Pierluigi Russo dysfunction. The damage is both direct or by Key words: mucopolysaccharidoses (MPS), heart, 1UOS Malattie Metaboliche Rare, activation of secondary and tertiary pathways heart and MPS, genetics and MPS. 2 Department of Pediatrics, Fondazione among which a role is played by inflammation. The incidence of MPSs as a group is reported Acknowledgments: RP and PR acknowledge MBBM, Azienda Ospedaliera San between 1:25000 and 1:45000.3 At present 11 dif- patients and their families and Drs. Andrea Gerardo, University of Milano-Bicocca; ferent enzyme deficiencies are involved in Imperatori and Lucia Boffi who collaborated in 2Consortium for Human Molecular the clinical cardiological evaluation of MPSs MPSs producing 7 distinct clinical phenotypes1 Genetics, University of Milano-Bicocca; patients. RP thanks Fondazione Pierfranco e (Table 1).4 Depending on the enzyme deficien- 3UO Department of Cardiology, Azienda Luisa Mariani of Milano for providing financial cy, the catabolism of dermatan sulphate, support for clinical assistance to metabolic Ospedaliera San Gerardo, Monza, Italy heparan sulphate, keratan sulphate, chon- patients and Mrs.
    [Show full text]
  • Genetic Deletions in Sputum As Diagnostic Markers for Early Detection of Stage I Non ^ Small Cell Lung Cancer Ruiyun Li,1Nevins W
    Imaging, Diagnosis, Prognosis Genetic Deletions in Sputum as Diagnostic Markers for Early Detection of Stage I Non ^ Small Cell Lung Cancer Ruiyun Li,1Nevins W. Todd,2 Qi Qiu,3 Ta o F a n , 3 Richard Y. Zhao,3 William H. Rodgers,3 Hong-Bin Fang,4 Ruth L. Katz,5 Sanford A. Stass,3 and Feng Jiang3 Abstract Purpose: Analysis of molecular genetic markers in biological fluids has been proposed as a powerful tool for cancer diagnosis. We have characterized in detail the genetic signatures in primary non ^ small cell lung cancer, which provided potential diagnostic biomarkers for lung cancer. The aim of this study was to determine whether the genetic changes can be used as markers in sputum specimen for the early detection of lung cancer. Experimental Design: Genetic aberrations in the genes HYAL2, FHIT,andSFTPC were evalu- ated in paired tumors and sputum samples from 38 patients with stage I non ^ small cell lung cancer and in sputum samples from 36 cancer-free smokers and 28 healthy nonsmokers by using fluorescence in situ hybridization. Results: HYAL2 and FHIT weredeletedin84%and79%tumorsandin45%and40%paired sputum, respectively. SFTPC was deleted exclusively in tumor tissues (71%).There was concor- dance of HYAL2 or FHIT deletions in matched sputum and tumor tissues from lung cancer patients (r =0.82,P =0.04;r =0.84,P = 0.03), suggesting that the genetic changes in sputum might indicate the presence of the same genetic aberrations in lung tumors. Furthermore, abnor- mal cells were found in 76% sputum by detecting combined HYAL2 and FHIT deletions whereas in 47% sputum by cytology, of the cancer cases, implying that detecting the combination of HYAL2 and FHIT deletions had higher sensitivity than that of sputum cytology for lung cancer diagnosis.
    [Show full text]
  • Genome Sequencing Unveils a Regulatory Landscape of Platelet Reactivity
    ARTICLE https://doi.org/10.1038/s41467-021-23470-9 OPEN Genome sequencing unveils a regulatory landscape of platelet reactivity Ali R. Keramati 1,2,124, Ming-Huei Chen3,4,124, Benjamin A. T. Rodriguez3,4,5,124, Lisa R. Yanek 2,6, Arunoday Bhan7, Brady J. Gaynor 8,9, Kathleen Ryan8,9, Jennifer A. Brody 10, Xue Zhong11, Qiang Wei12, NHLBI Trans-Omics for Precision (TOPMed) Consortium*, Kai Kammers13, Kanika Kanchan14, Kruthika Iyer14, Madeline H. Kowalski15, Achilleas N. Pitsillides4,16, L. Adrienne Cupples 4,16, Bingshan Li 12, Thorsten M. Schlaeger7, Alan R. Shuldiner9, Jeffrey R. O’Connell8,9, Ingo Ruczinski17, Braxton D. Mitchell 8,9, ✉ Nauder Faraday2,18, Margaret A. Taub17, Lewis C. Becker1,2, Joshua P. Lewis 8,9,125 , 2,14,125✉ 3,4,125✉ 1234567890():,; Rasika A. Mathias & Andrew D. Johnson Platelet aggregation at the site of atherosclerotic vascular injury is the underlying patho- physiology of myocardial infarction and stroke. To build upon prior GWAS, here we report on 16 loci identified through a whole genome sequencing (WGS) approach in 3,855 NHLBI Trans-Omics for Precision Medicine (TOPMed) participants deeply phenotyped for platelet aggregation. We identify the RGS18 locus, which encodes a myeloerythroid lineage-specific regulator of G-protein signaling that co-localizes with expression quantitative trait loci (eQTL) signatures for RGS18 expression in platelets. Gene-based approaches implicate the SVEP1 gene, a known contributor of coronary artery disease risk. Sentinel variants at RGS18 and PEAR1 are associated with thrombosis risk and increased gastrointestinal bleeding risk, respectively. Our WGS findings add to previously identified GWAS loci, provide insights regarding the mechanism(s) by which genetics may influence cardiovascular disease risk, and underscore the importance of rare variant and regulatory approaches to identifying loci contributing to complex phenotypes.
    [Show full text]
  • Hyaluronidase PH20 (SPAM1) (NM 003117) Human Mass Spec Standard – PH305378 | Origene
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for PH305378 Hyaluronidase PH20 (SPAM1) (NM_003117) Human Mass Spec Standard Product data: Product Type: Mass Spec Standards Description: SPAM1 MS Standard C13 and N15-labeled recombinant protein (NP_003108) Species: Human Expression Host: HEK293 Expression cDNA Clone RC205378 or AA Sequence: Predicted MW: 58.2 kDa Protein Sequence: >RC205378 representing NM_003117 Red=Cloning site Green=Tags(s) MGVLKFKHIFFRSFVKSSGVSQIVFTFLLIPCCLTLNFRAPPVIPNVPFLWAWNAPSEFCLGKFDEPLDM SLFSFIGSPRINATGQGVTIFYVDRLGYYPYIDSITGVTVNGGIPQKISLQDHLDKAKKDITFYMPVDNL GMAVIDWEEWRPTWARNWKPKDVYKNRSIELVQQQNVQLSLTEATEKAKQEFEKAGKDFLVETIKLGKLL RPNHLWGYYLFPDCYNHHYKKPGYNGSCFNVEIKRNDDLSWLWNESTALYPSIYLNTQQSPVAATLYVRN RVREAIRVSKIPDAKSPLPVFAYTRIVFTDQVLKFLSQDELVYTFGETVALGASGIVIWGTLSIMRSMKS CLLLDNYMETILNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSSDYLHLNPDNFAIQLEKGGKFTVRGK PTLEDLEQFSEKFYCSCYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPMETEEPQIFYNASPSTLS ATMFIWRLEVWDQGISRIGFF myc-FLAG tag Tag: C-Myc/DDK Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining Concentration: 50 ug/ml as determined by BCA Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. RefSeq:
    [Show full text]
  • HYAL1LUCA-1, a Candidate Tumor Suppressor Gene on Chromosome 3P21.3, Is Inactivated in Head and Neck Squamous Cell Carcinomas by Aberrant Splicing of Pre-Mrna
    Oncogene (2000) 19, 870 ± 878 ã 2000 Macmillan Publishers Ltd All rights reserved 0950 ± 9232/00 $15.00 www.nature.com/onc HYAL1LUCA-1, a candidate tumor suppressor gene on chromosome 3p21.3, is inactivated in head and neck squamous cell carcinomas by aberrant splicing of pre-mRNA Gregory I Frost1,3, Gayatry Mohapatra2, Tim M Wong1, Antonei Benjamin Cso ka1, Joe W Gray2 and Robert Stern*,1 1Department of Pathology, School of Medicine, University of California, San Francisco, California, CA 94143, USA; 2Cancer Genetics Program, UCSF Cancer Center, University of California, San Francisco, California, CA 94115, USA The hyaluronidase ®rst isolated from human plasma, genes in the process of carcinogenesis (Sager, 1997; Hyal-1, is expressed in many somatic tissues. The Hyal- Baylin et al., 1998). Nevertheless, functionally 1 gene, HYAL1, also known as LUCA-1, maps to inactivating point mutations are generally viewed as chromosome 3p21.3 within a candidate tumor suppressor the critical `smoking gun' when de®ning a novel gene locus de®ned by homozygous deletions and by TSG. functional tumor suppressor activity. Hemizygosity in We recently mapped the HYAL1 gene to human this region occurs in many malignancies, including chromosome 3p21.3 (Cso ka et al., 1998), con®rming its squamous cell carcinomas of the head and neck. We identity with LUCA-1, a candidate tumor suppressor have investigated whether cell lines derived from such gene frequently deleted in small cell lung carcinomas malignancies expressed Hyal-1 activity, using normal (SCLC) (Wei et al., 1996). The HYAL1 gene resides human keratinocytes as controls. Hyal-1 enzyme activity within a commonly deleted region of 3p21.3 where a and protein were absent or markedly reduced in six of potentially informative 30 kb homozygous deletion has seven carcinoma cell lines examined.
    [Show full text]
  • Datasheet: 5030­9954
    Datasheet: 5030­9954 Description: NATIVE BOVINE HYALURONIDASE Name: HYALURONIDASE Format: Purified Product Type: Purified Protein Quantity: 0.5 g Product Details Applications This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit www.bio-rad-antibodies.com/protocols. Yes No Not Determined Suggested Dilution ELISA Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using the appropriate negative/positive controls. Target Species Bovine Product Form Purified enzyme from bovine testes - liquid Preservative None present Stabilisers Approx. Protein Total protein concentration 0.2 g/ml Concentrations External Database UniProt: Links Q8SQG8 Related reagents Q5E985 Related reagents Entrez Gene: 281838 HYAL2 Related reagents 515397 HYAL1 Related reagents Product Information Hyaluronidase catalyzes the depolymerization of mucopolysaccharides, hyaluronic acid, and the chondroitin sulfates A and C. The enzyme is widely distributed in animal tissues but is found in great concentrations in the bovine and ovine testes. Molecular Weight MW: 55 kD Activity 315 U/mg protein 1 unit is defined as the amount of enzyme that liberates one micromole of N-acetylglucosamine Page 1 of 2 per minute at 37ºC and pH 4.0. EC 3.2.1.36 Storage Store at -20oC only.
    [Show full text]
  • Oncogenic Transformation by the Jaagsiekte Sheep Retrovirus Envelope Protein
    Oncogene (2007) 26, 789–801 & 2007 Nature Publishing Group All rights reserved 0950-9232/07 $30.00 www.nature.com/onc REVIEW Oncogenic transformation by the jaagsiekte sheep retrovirus envelope protein S-L Liu1 and AD Miller2 1Department of Microbiology and Immunology, McGill University, Montreal, Canada and 2Division of Human Biology, Fred Hutchinson Cancer Research Center, Seattle, WA, USA Retroviruses have played profound roles in our under- sarcoma virus, both of which cause tumors in chickens standing of the genetic and molecular basis of cancer. (for a comprehensive review see Rosenberg and Jaagsiekte sheep retrovirus (JSRV) is a simple retrovirus Jolicoeur (1997)). Oncogenic retroviruses are historically that causes contagious lung tumors in sheep, known as classified into acute transforming retroviruses and ovine pulmonary adenocarcinoma (OPA). Intriguingly, nonacute retroviruses. Acute transforming retroviruses OPA resembles pulmonary adenocarcinoma in humans, induce tumors through acquisition and expression of and may provide a model for this frequent human cancer. cellular proto-oncogenes – a process referred to as Distinct from the classical mechanisms of retroviral oncogene capture. These retroviruses induce tumors oncogenesis by insertional activation of or virus capture rapidly, the tumors are of polyclonal origin, and the of host oncogenes, the native envelope (Env) structural viral oncogenes in these viruses are not essential for protein of JSRV is itself the active oncogene. A major virus replication. In fact, acute transforming retro- pathway for Env transformation involves interaction of viruses are often replication-defective (Rous sarcoma the Env cytoplasmic tail with as yet unidentified cellular virus is an exception) because of the loss or disruption of adaptor(s), leading to the activation of PI3K/Akt and essential viral genes during the oncogene capture MAPK signaling cascades.
    [Show full text]