DOCSLIB.ORG

Atlas Journal

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Atlas Journal Atlas of Genetics and Cytogenetics in Oncology and Haematology Home Genes Leukemias Solid Tumours Cancer-Prone Deep Insight Portal Teaching X Y 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 NA Atlas Journal Atlas Journal versus Atlas Database: the accumulation of the issues of the Journal constitutes the body of the Database/Text-Book. TABLE OF CONTENTS Volume 12, Number 4, Jul-Aug 2008 Previous Issue / Next Issue Genes AKR1C3 (aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II)) (10p15.1). Hsueh Kung Lin. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 498-502. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/AKR1C3ID612ch10p15.html CASP1 (caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase)) (11q22.3). Yatender Kumar, Vegesna Radha, Ghanshyam Swarup. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 503-518. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/CASP1ID145ch11q22.html GCNT3 (glucosaminyl (N-acetyl) transferase 3, mucin type) (15q21.3). Prakash Radhakrishnan, Pi-Wan Cheng. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 519-524. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/GCNT3ID44105ch15q21.html HYAL2 (Hyaluronoglucosaminidase 2) (3p21.3). Lillian SN Chow, Kwok-Wai Lo. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 525-529. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/HYAL2ID40904ch3p21.html LMO2 (LIM domain only 2 (rhombotin-like 1)) (11p13) - updated. Pieter Van Vlierberghe, Jean Loup Huret. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 530-535. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/RBTN2ID34.html PEBP1 (phosphatidylethanolamine binding protein 1) (12q24.23). Sandy Beach, Kam C Yeung. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 536-543. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/PEBP1ID44021ch12q24.html RNF7 (RING finger protein-7) (3q22-24). Yi Sun. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 544-549. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/RNF7ID44108ch3q22.html STARD13 (StAR-related lipid transfer (START) domain containing 13) (13q13.3). Thomas Ho-Yin Leung, Judy Wai Ping Yam, Irene Oi-lin Ng. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 550-555. [Full Text] [PDF] Atlas Genet Cytogenet Oncol Haematol 2008; 4 I URL : http://atlasgeneticsoncology.org/Genes/STARD13ID44051ch13q13.html TTL (Twelve-thirteen Translocation Leukemia) (13q14.11). Jean-Loup Huret. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 556-558. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/TTLID529ch13q14.html ZFP36L1 (Zinc finger protein 36, C3H type-like 1) (14q24.1). Deborah J Stumpo, Perry J Blackshear. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 559-565. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/ZFP36L1ID42866ch14q22.html ZNF384 (Zinc Finger protein 384) (12p13.31). Paolo Gorello, Roberta La Starza, Cristina Mecucci. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 566-571. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/ZNF384ID42881ch12p13.html CD53 (CD53 molecule) (1p13.3). Pedro A Lazo. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 572-577. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/CD53ID983ch1p13.html EVI1 (Ecotropic Viral Integration Site 1 (EVI1) and Myelodysplastic Syndrome 1 (MDS1)- EVI1) (3q26.2) - updated. Rotraud Wieser. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 578-587. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/EVI103q26ID19.html KIF14 (kinesin family member 14) (1q32.1). Brigitte L Thériault, Timothy W Corson. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 588-592. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/KIF14ID44138ch1q32.html NTRK2 (Neurotrophic tyrosine kinase, receptor, type 2) (9q21.33). Nadia Gabellini. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 593-600. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/NTRK2ID41589ch9q21.html PAK1 (p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast)) (11q13.5). Dina Stepanova, Jonathan Chernoff. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 601-605. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/PAK1ID41633ch11q13.html POU4F1 (POU class 4 homeobox 1) (13q31.1). Vishwanie Budhram-Mahadeo, David S Latchman. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 606-616. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/POU4F1ID44173ch13q31.html PPP1R1B (protein phosphatase 1, regulatory (inhibitor) subunit 1B (dopamine and cAMP regulated phosphoprotein, DARPP-32)) (17q12). Wael El-Rifai, Abbes Belkhiri. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 617-622. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/PPP1R1BID44096ch17q12.html RMRP (RNA component of mitochondrial RNA processing endoribonuclease) (9p21-p12). Pia Hermanns, Kerstin Reicherter, Brendan Lee. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 623-632. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/RMRPID44001ch9p21.html TNFRSF6B (tumor necrosis factor receptor superfamily, member 6b, decoy) (20q13.3). Jiangping Wu, Bing Han. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 633-642. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/TNFRSF6BID42628ch20q13.html TNFSF10 (tumor necrosis factor (ligand) superfamily, member 10) (3q26). Maria Grazia di Iasio, Elisabetta Melloni, Paola Secchiero, Silvano Capitani. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 643-650. [Full Text] [PDF] Atlas Genet Cytogenet Oncol Haematol 2008; 4 II URL : http://atlasgeneticsoncology.org/Genes/TNFSF10ID42632ch3q26.html Leukaemias dic(1;15)(p11;p11). Jean-Loup Huret. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 651-653. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Anomalies/dic0115p11p11ID1159.html t(2;19)(p11;p13). Jean-Loup Huret. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 654. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Anomalies/t0219p11p13ID1288.html t(3;18)(q26;q11). Jean-Loup Huret. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 655. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Anomalies/t0318q26q11ID1283.html t(3;4)(p21;q34). Adriana Zamecnikova. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 656-658. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Anomalies/t0304p21q34ID1433.html t(4;21)(q31;q22). Jean-Loup Huret. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 659-660. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Anomalies/t0421q31q22ID1448.html Solid Tumours Cancer Prone Diseases Deep Insights Case Reports Translocation t(8;12)(q13;p13) in a case with acute leukemia of ambiguous lineage. Marta Gallego, Mariela Coccé, Andrea Bernasconi, Maria Felice, Cristina Alonso, Myriam Guitter. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 661-663. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Reports/0812GallegoID100029.html A case of Chronic Lymphocytic Leukemia (CLL) with a rare chromosome abnormality: t(1;14;6)(q21;q32;p21), a variant of t(6;14)(p21;q32). Alka Dwivedi, Thomas Casey, Siddharth G Adhvaryu. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 664-667. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Reports/0614AdhvaryuID100033.html Educational Items © Atlas of Genetics and Cytogenetics in Oncology and Haematology X Y 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 NA Home Genes Leukemias Solid Tumours Cancer-Prone Deep Insight Portal Teaching For comments and suggestions or contributions, please contact us [email protected]. Atlas Genet Cytogenet Oncol Haematol 2008; 4 III Atlas of Genetics and Cytogenetics in Oncology and Haematology AKR1C3 (aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II)) Identity Other names DD3 HA1753 HAKRB HAKRe HSD17B5 KIAA0119 hluPGFS HGNC AKR1C3 Location 10p15.1 DNA/RNA Transcription 1170 bp mRNA; transcript has been detected in brain, lung, liver, small intestine, mammary gland, uterus, prostate, testis. Protein Description 323 amino acids, molecular weight 37 kDa. Expression Activated macrophage, malignant prostate epithelium, normal mammary epithelium, mature blood vessel. Localisation Mainly in cytoplasm. Function AKR1C3 metabolizes various androgen metabolites including 5a-dihydrotestosterone to 5a-androstane-3a,17b-diol, Delta4-androstene-3,17-dione to testosterone, androstanedione to 5a-dihydrotestosterone, androsterone to 5a-androstane-3a,17b- diol. AKR1C3 is also involved in estrogen metabolism converting estrone to 17b-estradiol as well as progesterone metabolism converting prostaglandin D2 to 9a,11b-prostaglandin F2a. AKR1C3 has the capability of regulating the trans-activation of various nuclear receptors including androgen receptor, estrogen receptor, and peroxisome proliferator activated receptor (PPARG) by regulating the ligand availability for the nuclear receptors. Homology A member of the of AKR1C family proteins; AKR1C1, AKR1C2, AKR1C3, AKR1C4 in human, and AKR1C9 in rat. Mutations Note Mutation of AKR1C3 has not been identified. Implicated in Entity Various cancers Note Elevated levels of AKR1C3 expression are implicated in leukemia cell differentiation, prostate cancer (in both androgen-dependent and androgen-independent prostate cancer), and endometrial cancer. Expression
Load more

Recommended publications
  • Identification of Novel Genetic Variants Associated with Short Stature in A
    Human Genetics https://doi.org/10.1007/s00439-020-02191-x ORIGINAL INVESTIGATION Identifcation of novel genetic variants associated with short stature in a Baka Pygmies population Matteo Zoccolillo1 · Claudia Moia2 · Sergio Comincini2 · Davide Cittaro3 · Dejan Lazarevic3 · Karen A. Pisani1 · Jan M. Wit4 · Mauro Bozzola5 Received: 1 April 2020 / Accepted: 30 May 2020 © The Author(s) 2020 Abstract Human growth is a complex trait determined by genetic factors in combination with external stimuli, including environment, nutrition and hormonal status. In the past, several genome-wide association studies (GWAS) have collectively identifed hundreds of genetic variants having a putative efect on determining adult height in diferent worldwide populations. Theo- retically, a valuable approach to better understand the mechanisms of complex traits as adult height is to study a population exhibiting extreme stature phenotypes, such as African Baka Pygmies. After phenotypic characterization, we sequenced the whole exomes of a cohort of Baka Pygmies and their non-Pygmies Bantu neighbors to highlight genetic variants associated with the reduced stature. Whole exome data analysis revealed 29 single nucleotide polymorphisms (SNPs) signifcantly associated with the reduced height in the Baka group. Among these variants, we focused on SNP rs7629425, located in the 5′-UTR of the Hyaluronidase-2 (HYAL2) gene. The frequency of the alternative allele was signifcantly increased compared to African and non-African populations. In vitro luciferase assay showed signifcant diferences in transcription modulation by rs7629425 C/T alleles. In conclusion, our results suggested that the HYAL2 gene variants may play a role in the etiology of short stature in Baka Pygmies population.
    [Show full text]
  • Hyaluronidase PH20 (SPAM1) Rabbit Polyclonal Antibody – TA337855
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA337855 Hyaluronidase PH20 (SPAM1) Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-SPAM1 antibody is: synthetic peptide directed towards the C- terminal region of Human SPAM1. Synthetic peptide located within the following region: CYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPMETEEPQIFYNASP Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Affinity Purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 58 kDa Gene Name: sperm adhesion molecule 1 Database Link: NP_694859 Entrez Gene 6677 Human P38567 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 Hyaluronidase PH20 (SPAM1) Rabbit Polyclonal Antibody – TA337855 Background: Hyaluronidase degrades hyaluronic acid, a major structural proteoglycan found in extracellular matrices and basement membranes. Six members of the hyaluronidase family are clustered into two tightly linked groups on chromosome 3p21.3 and 7q31.3. This gene was previously referred to as HYAL1 and HYA1 and has since been assigned the official symbol SPAM1; another family member on chromosome 3p21.3 has been assigned HYAL1.
    [Show full text]
  • Whole-Genome Microarray Detects Deletions and Loss of Heterozygosity of Chromosome 3 Occurring Exclusively in Metastasizing Uveal Melanoma
    Anatomy and Pathology Whole-Genome Microarray Detects Deletions and Loss of Heterozygosity of Chromosome 3 Occurring Exclusively in Metastasizing Uveal Melanoma Sarah L. Lake,1 Sarah E. Coupland,1 Azzam F. G. Taktak,2 and Bertil E. Damato3 PURPOSE. To detect deletions and loss of heterozygosity of disease is fatal in 92% of patients within 2 years of diagnosis. chromosome 3 in a rare subset of fatal, disomy 3 uveal mela- Clinical and histopathologic risk factors for UM metastasis noma (UM), undetectable by fluorescence in situ hybridization include large basal tumor diameter (LBD), ciliary body involve- (FISH). ment, epithelioid cytomorphology, extracellular matrix peri- ϩ ETHODS odic acid-Schiff-positive (PAS ) loops, and high mitotic M . Multiplex ligation-dependent probe amplification 3,4 5 (MLPA) with the P027 UM assay was performed on formalin- count. Prescher et al. showed that a nonrandom genetic fixed, paraffin-embedded (FFPE) whole tumor sections from 19 change, monosomy 3, correlates strongly with metastatic death, and the correlation has since been confirmed by several disomy 3 metastasizing UMs. Whole-genome microarray analy- 3,6–10 ses using a single-nucleotide polymorphism microarray (aSNP) groups. Consequently, fluorescence in situ hybridization were performed on frozen tissue samples from four fatal dis- (FISH) detection of chromosome 3 using a centromeric probe omy 3 metastasizing UMs and three disomy 3 tumors with Ͼ5 became routine practice for UM prognostication; however, 5% years’ metastasis-free survival. to 20% of disomy 3 UM patients unexpectedly develop metas- tases.11 Attempts have therefore been made to identify the RESULTS. Two metastasizing UMs that had been classified as minimal region(s) of deletion on chromosome 3.12–15 Despite disomy 3 by FISH analysis of a small tumor sample were found these studies, little progress has been made in defining the key on MLPA analysis to show monosomy 3.
    [Show full text]
  • Molecular Subtypes of Diffuse Large B-Cell Lymphoma Arise by Distinct Genetic Pathways
    Molecular subtypes of diffuse large B-cell lymphoma arise by distinct genetic pathways Georg Lenza, George W. Wrightb, N. C. Tolga Emrea, Holger Kohlhammera, Sandeep S. Davea, R. Eric Davisa, Shannon Cartya, Lloyd T. Lama, A. L. Shaffera, Wenming Xiaoc, John Powellc, Andreas Rosenwaldd, German Ottd,e, Hans Konrad Muller-Hermelinkd, Randy D. Gascoynef, Joseph M. Connorsf, Elias Campog, Elaine S. Jaffeh, Jan Delabiei, Erlend B. Smelandj,k, Lisa M. Rimszal, Richard I. Fisherm,n, Dennis D. Weisenburgero, Wing C. Chano, and Louis M. Staudta,q aMetabolism Branch, bBiometric Research Branch, cCenter for Information Technology, and hLaboratory of Pathology, Center for Cancer Research, National Cancer Institute, Bethesda, MD 20892; dDepartment of Pathology, University of Wu¨rzburg, 97080 Wu¨rzburg, Germany; eDepartment of Clinical Pathology, Robert-Bosch-Krankenhaus, 70376 Stuttgart, Germany; fBritish Columbia Cancer Agency, Vancouver, British Columbia, Canada V5Z 4E6; gHospital Clinic, University of Barcelona, 08036 Barcelona, Spain; iPathology Clinic and jInstitute for Cancer Research, Rikshospitalet Hospital, Oslo, Norway; kCentre for Cancer Biomedicine, Faculty Division the Norwegian Radium Hospital, N-0310, Oslo, Norway; lDepartment of Pathology, University of Arizona, Tucson, AZ 85724; mSouthwest Oncology Group, 24 Frank Lloyd Wright Drive, Ann Arbor, MI 48106 ; nJames P. Wilmot Cancer Center, University of Rochester, Rochester, NY 14642; and oDepartments of Pathology and Microbiology, University of Nebraska, Omaha, NE 68198 Edited by Ira
    [Show full text]
  • Program Nr: 1 from the 2004 ASHG Annual Meeting Mutations in A
    Program Nr: 1 from the 2004 ASHG Annual Meeting Mutations in a novel member of the chromodomain gene family cause CHARGE syndrome. L.E.L.M. Vissers1, C.M.A. van Ravenswaaij1, R. Admiraal2, J.A. Hurst3, B.B.A. de Vries1, I.M. Janssen1, W.A. van der Vliet1, E.H.L.P.G. Huys1, P.J. de Jong4, B.C.J. Hamel1, E.F.P.M. Schoenmakers1, H.G. Brunner1, A. Geurts van Kessel1, J.A. Veltman1. 1) Dept Human Genetics, UMC Nijmegen, Nijmegen, Netherlands; 2) Dept Otorhinolaryngology, UMC Nijmegen, Nijmegen, Netherlands; 3) Dept Clinical Genetics, The Churchill Hospital, Oxford, United Kingdom; 4) Children's Hospital Oakland Research Institute, BACPAC Resources, Oakland, CA. CHARGE association denotes the non-random occurrence of ocular coloboma, heart defects, choanal atresia, retarded growth and development, genital hypoplasia, ear anomalies and deafness (OMIM #214800). Almost all patients with CHARGE association are sporadic and its cause was unknown. We and others hypothesized that CHARGE association is due to a genomic microdeletion or to a mutation in a gene affecting early embryonic development. In this study array- based comparative genomic hybridization (array CGH) was used to screen patients with CHARGE association for submicroscopic DNA copy number alterations. De novo overlapping microdeletions in 8q12 were identified in two patients on a genome-wide 1 Mb resolution BAC array. A 2.3 Mb region of deletion overlap was defined using a tiling resolution chromosome 8 microarray. Sequence analysis of genes residing within this critical region revealed mutations in the CHD7 gene in 10 of the 17 CHARGE patients without microdeletions, including 7 heterozygous stop-codon mutations.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Integrating Single-Step GWAS and Bipartite Networks Reconstruction Provides Novel Insights Into Yearling Weight and Carcass Traits in Hanwoo Beef Cattle
    animals Article Integrating Single-Step GWAS and Bipartite Networks Reconstruction Provides Novel Insights into Yearling Weight and Carcass Traits in Hanwoo Beef Cattle Masoumeh Naserkheil 1 , Abolfazl Bahrami 1 , Deukhwan Lee 2,* and Hossein Mehrban 3 1 Department of Animal Science, University College of Agriculture and Natural Resources, University of Tehran, Karaj 77871-31587, Iran; [email protected] (M.N.); [email protected] (A.B.) 2 Department of Animal Life and Environment Sciences, Hankyong National University, Jungang-ro 327, Anseong-si, Gyeonggi-do 17579, Korea 3 Department of Animal Science, Shahrekord University, Shahrekord 88186-34141, Iran; [email protected] * Correspondence: [email protected]; Tel.: +82-31-670-5091 Received: 25 August 2020; Accepted: 6 October 2020; Published: 9 October 2020 Simple Summary: Hanwoo is an indigenous cattle breed in Korea and popular for meat production owing to its rapid growth and high-quality meat. Its yearling weight and carcass traits (backfat thickness, carcass weight, eye muscle area, and marbling score) are economically important for the selection of young and proven bulls. In recent decades, the advent of high throughput genotyping technologies has made it possible to perform genome-wide association studies (GWAS) for the detection of genomic regions associated with traits of economic interest in different species. In this study, we conducted a weighted single-step genome-wide association study which combines all genotypes, phenotypes and pedigree data in one step (ssGBLUP). It allows for the use of all SNPs simultaneously along with all phenotypes from genotyped and ungenotyped animals. Our results revealed 33 relevant genomic regions related to the traits of interest.
    [Show full text]
  • HYAL2 Antibody (R30915)
    HYAL2 Antibody (R30915) Catalog No. Formulation Size R30915 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug Bulk quote request Availability 1-3 business days Species Reactivity Human, Mouse, Rat. Format Antigen affinity purified Clonality Polyclonal (rabbit origin) Isotype Rabbit IgG Purity Antigen affinity Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide/thimerosal UniProt Q12891 Applications Western blot : 0.5-1ug/ml Limitations This HYAL2 antibody is available for research use only. Western blot testing of HYAL2 antibody and Lane 1: HeLa; 2: SMMC-7721; 3: COLO320; 4: MCF-7; 5: HT1080 cell lysate Description Hyaluronoglucosaminidase 2, also known as hyaluronidase 2, and LuCa-2, is an enzyme that in humans is encoded by the HYAL2 gene. HYAL2 cDNAs encode a preprotein with an N-terminal signal peptide. Northern blot analysis indicated that the gene was expressed in all human tissues tested except adult brain, and Western blot analysis detected the protein in all mouse tissues examined except adult brain. HYAL2 is a glycosylphosphatidylinositol (GPI)-anchored protein on the cell surface and serves as a receptor for entry into the cell of the jaagsiekte sheep retrovirus (JSRV). The findings of Rai et al.(2001) that HYAL2 is a GPI-anchored protein on the cell surface showed that GFP would likely be cleaved from HYAL2 during GPI addition, leaving HYAL2 on the cell surface and resulting in GFP transit to the lysosome for degradation. Application Notes The stated application concentrations are suggested starting amounts. Titration of the HYAL2 antibody may be required due to differences in protocols and secondary/substrate sensitivity.
    [Show full text]
  • Fine Mapping Studies of Quantitative Trait Loci for Baseline Platelet Count in Mice and Humans
    Fine mapping studies of quantitative trait loci for baseline platelet count in mice and humans A thesis submitted in fulfillment of the requirements for the degree of Doctor of Philosophy Melody C Caramins December 2010 University of New South Wales ORIGINALITY STATEMENT ‘I hereby declare that this submission is my own work and to the best of my knowledge it contains no materials previously published or written by another person, or substantial proportions of material which have been accepted for the award of any other degree or diploma at UNSW or any other educational institution, except where due acknowledgement is made in the thesis. Any contribution made to the research by others, with whom I have worked at UNSW or elsewhere, is explicitly acknowledged in the thesis. I also declare that the intellectual content of this thesis is the product of my own work, except to the extent that assistance from others in the project's design and conception or in style, presentation and linguistic expression is acknowledged.’ Signed …………………………………………….............. Date …………………………………………….............. This thesis is dedicated to my father. Dad, thanks for the genes – and the environment! ACKNOWLEDGEMENTS “Nothing can come out of nothing, any more than a thing can go back to nothing.” - Marcus Aurelius Antoninus A PhD thesis is never the work of one person in isolation from the world at large. I would like to thank the following people, without whom this work would not have existed. Thank you firstly, to all my teachers, of which there have been many. Undoubtedly, the greatest debt is owed to my supervisor, Dr Michael Buckley.
    [Show full text]
  • The Role of Structural Disorder in Cell Cycle Regulation, Related Clinical Proteomics, 5 Disease Development and Drug Targeting
    Review The role of structural disorder in cell cycle regulation, related clinical proteomics, 5 disease development and drug targeting Expert Rev. Proteomics 12(3), 000–000 (2015) 10 1 AQ2 Agnes Tantos , Understanding the molecular mechanisms of the regulation of cell cycle is a central issue in Lajos Kalmar2 and molecular cell biology, due to its fundamental role in the existence of cells. The regulatory Peter Tompa*1,2 circuits that make decisions on when a cell should divide are very complex and particularly subtly balanced in eukaryotes, in which the harmony of many different cells in an organism is 1 Institute of Enzymology, Research essential for life. Several hundred proteins are involved in these processes, and a great deal of 15 Centre for Natural Sciences of the Hungarian Academy of Sciences, studies attests that most of them have functionally relevant intrinsic structural disorder. Budapest, Hungary Structural disorder imparts many functional advantages on these proteins, and we discuss it 2 VIB Department of Structural Biology, in detail that it is involved in all key steps from signaling through the cell membrane to Vrije Universiteit Brussel, Brussels, Belgium regulating transcription of proteins that execute timely responses to an ever-changing *Author for correspondence: environment. 20 [email protected] KEYWORDS: cancer . cell-cycle . checkpoint . post-translational modification . protein disorder . signal transduction 25 of proteins are able to fulfill important func- Cell cycle: the cornerstone of tions without possessing a stable three- multicellular life dimensional structure [3,4]. These proteins, Every postembryonic eukaryotic cell goes termed intrinsically disordered proteins or through the distinct phases of cell cycle, regions (IDPs/IDRs), participate in many reg- G1, S, G2 and M.
    [Show full text]
  • Identifying Host Genetic Factors Controlling Susceptibility to Blood-Stage Malaria in Mice
    Identifying host genetic factors controlling susceptibility to blood-stage malaria in mice Aurélie Laroque Department of Biochemistry McGill University Montreal, Quebec, Canada December 2016 A thesis submitted to McGill University in partial fulfilment of the requirements of the degree of Doctor of Philosophy. © Aurélie Laroque, 2016 ABSTRACT This thesis examines genetic factors controlling host response to blood stage malaria in mice. We first phenotyped 25 inbred strains for resistance/susceptibility to Plasmodium chabaudi chabaudi AS infection. A broad spectrum of responses was observed, which suggests rich genetic diversity among different mouse strains in response to malaria. A F2 intercross was generated between susceptible SM/J and resistant C57BL/6 mice and the progeny was phenotyped for susceptibility to P. chabaudi chabaudi AS infection. A whole genome scan revealed the Char1 locus as a key regulator of parasite density. Using a haplotype mapping approach, we reduced the locus to a 0.4Mb conserved interval that segregates with resistance/susceptibility to infection for the search of positional candidate genes. In addition, I pursued the work on the Char10 locus that was previously identified in [AcB62xCBA/PK]F2 animals (LOD=10.8, 95% Bayesian CI=50.7-75Mb). Pyruvate kinase deficiency was found to protect mice and humans against malaria. However, AcB62 mice are susceptible to P. chabaudi infection despite carrying the protective PklrI90N mutation. We characterized the Char10 locus and showed that it modulates the severity of the pyruvate deficiency phenotype by regulating erythroid responses. We created 4 congenic lines carrying different portions of the Char10 interval and demonstrated that Char10 is found within a maximal 4Mb interval.
    [Show full text]
  • Noelia Díaz Blanco
    Effects of environmental factors on the gonadal transcriptome of European sea bass (Dicentrarchus labrax), juvenile growth and sex ratios Noelia Díaz Blanco Ph.D. thesis 2014 Submitted in partial fulfillment of the requirements for the Ph.D. degree from the Universitat Pompeu Fabra (UPF). This work has been carried out at the Group of Biology of Reproduction (GBR), at the Department of Renewable Marine Resources of the Institute of Marine Sciences (ICM-CSIC). Thesis supervisor: Dr. Francesc Piferrer Professor d’Investigació Institut de Ciències del Mar (ICM-CSIC) i ii A mis padres A Xavi iii iv Acknowledgements This thesis has been made possible by the support of many people who in one way or another, many times unknowingly, gave me the strength to overcome this "long and winding road". First of all, I would like to thank my supervisor, Dr. Francesc Piferrer, for his patience, guidance and wise advice throughout all this Ph.D. experience. But above all, for the trust he placed on me almost seven years ago when he offered me the opportunity to be part of his team. Thanks also for teaching me how to question always everything, for sharing with me your enthusiasm for science and for giving me the opportunity of learning from you by participating in many projects, collaborations and scientific meetings. I am also thankful to my colleagues (former and present Group of Biology of Reproduction members) for your support and encouragement throughout this journey. To the “exGBRs”, thanks for helping me with my first steps into this world. Working as an undergrad with you Dr.
    [Show full text]