Multiomics Dissection of Molecular Regulatory Mechanisms Underlying Autoimmune-Associated Noncoding Snps

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Multiomics dissection of molecular regulatory mechanisms underlying autoimmune-associated noncoding SNPs Xiao-Feng Chen, … , Yan Guo, Tie-Lin Yang JCI Insight. 2020;5(17):e136477. https://doi.org/10.1172/jci.insight.136477. Research Article Genetics More than 90% of autoimmune-associated variants are located in noncoding regions, leading to challenges in deciphering the underlying causal roles of functional variants and genes and biological mechanisms. Therefore, to reduce the gap between traditional genetic findings and mechanistic understanding of disease etiologies and clinical drug development, it is important to translate systematically the regulatory mechanisms underlying noncoding variants. Here, we prioritized functional noncoding SNPs with regulatory gene targets associated with 19 autoimmune diseases by incorporating hundreds of immune cell–specific multiomics data. The prioritized SNPs are associated with transcription factor (TF) binding, histone modification, or chromatin accessibility, indicating their allele-specific regulatory roles. Their target genes are significantly enriched in immunologically related pathways and other known immunologically related functions. We found that 90.1% of target genes are regulated by distal SNPs involving several TFs (e.g., the DNA-binding protein CCCTC-binding factor [CTCF]), suggesting the importance of long-range chromatin interaction in autoimmune diseases. Moreover, we predicted potential drug targets for autoimmune diseases, including 2 genes (NFKB1 and SH2B3) with known drug indications on other diseases, highlighting their potential drug repurposing opportunities. Taken together, these findings may provide useful information for future experimental follow-up and drug applications on autoimmune diseases. Find the latest version: https://jci.me/136477/pdf RESEARCH ARTICLE Multiomics dissection of molecular regulatory mechanisms underlying autoimmune-associated noncoding SNPs Xiao-Feng Chen, Ming-Rui Guo, Yuan-Yuan Duan, Feng Jiang, Hao Wu, Shan-Shan Dong, Xiao-Rong Zhou, Hlaing Nwe Thynn, Cong-Cong Liu, Lin Zhang, Yan Guo, and Tie-Lin Yang Key Laboratory of Biomedical Information Engineering of Ministry of Education and Biomedical Informatics & Genomics Center, School of Life Science and Technology, Xi’an Jiaotong University, Xi’an, China. More than 90% of autoimmune-associated variants are located in noncoding regions, leading to challenges in deciphering the underlying causal roles of functional variants and genes and biological mechanisms. Therefore, to reduce the gap between traditional genetic findings and mechanistic understanding of disease etiologies and clinical drug development, it is important to translate systematically the regulatory mechanisms underlying noncoding variants. Here, we prioritized functional noncoding SNPs with regulatory gene targets associated with 19 autoimmune diseases by incorporating hundreds of immune cell–specific multiomics data. The prioritized SNPs are associated with transcription factor (TF) binding, histone modification, or chromatin accessibility, indicating their allele-specific regulatory roles. Their target genes are significantly enriched in immunologically related pathways and other known immunologically related functions. We found that 90.1% of target genes are regulated by distal SNPs involving several TFs (e.g., the DNA-binding protein CCCTC-binding factor [CTCF]), suggesting the importance of long-range chromatin interaction in autoimmune diseases. Moreover, we predicted potential drug targets for autoimmune diseases, including 2 genes (NFKB1 and SH2B3) with known drug indications on other diseases, highlighting their potential drug repurposing opportunities. Taken together, these findings may provide useful information for future experimental follow-up and drug applications on autoimmune diseases. Introduction Autoimmune diseases are groups of complex immune system disorders with high prevalence rates world- wide (4.5%) (1). High heritabilities have been previously observed on various autoimmune diseases (~60%– 90%) (2). In addition, GWAS have unraveled hundreds of susceptible loci associated with autoimmune diseases (3), suggesting many functional genes involved in some key immunological pathways (e.g., MHC gene clusters in antigen presentation, TYK2 in cytokine signals) (4). However, the true functional variants and target genes for most GWAS variants remain largely unknown (4), and their discovery may be limited Conflict of interest: The authors have by 2 challenges. First, the detected variants may be in linkage disequilibrium (LD) with causal functional declared that no conflict of interest SNPs without genotyping. Second, more than 90% of GWAS variants are located in the uncultivated non- exists. coding regions, complicating their functional interpretation. Recent studies have integrated functional epigenetic data to predict noncoding SNP function. Many of Copyright: © 2020, Chen et al. This is an open access article published under these methods, such as CADD (5), DeepSEA (6), GWAVA (7), FATHMM-MKL (8), ReMM (9), and FIRE the terms of the Creative Commons (10), adopted machine-learning algorithms to develop classifiers through integrating various annotations Attribution 4.0 International License. and labeled training data to distinguish potential functional and nonfunctional SNPs. However, the prior Submitted: January 17, 2020 labeled training data may be both inaccurate and impractical owing to the current knowledge limitation Accepted: July 16, 2020 in functional roles underlying noncoding SNPs. Other methods, such as RegulomeDB (11), 3DSNP (12), Published: September 3, 2020. GWAS4D (13), IW-Scoring (14), Eigen (15), and FunSeq2 (16), either directly combined various epigenetic regulatory features to rank SNP functionality or adopted a weighted scoring scheme by considering the Reference information: JCI Insight. 2020;5(17):e136477. relative importance of each feature to assign SNP functionality scores. However, these approaches incor- https://doi.org/10.1172/jci. porated epigenetic or transcriptional annotation across all cells or tissues, omitting the cell- or context-spe- insight.136477. cific regulation, aiming to prioritize potential functional variants rather than to dissect the downstream insight.jci.org https://doi.org/10.1172/jci.insight.136477 1 RESEARCH ARTICLE regulatory circuits linking functional variants to disease etiology. Autoimmune disease–associated variants are significantly enriched in blood cell-specific enhancers (17), implying that the integration of cell-specific functional data are required for dissecting molecular regulatory mechanisms underlying noncoding vari- ants associated with autoimmune diseases. The incorporation of cell-specific multiomics data has accelerated the decryption of functional mecha- nisms underlying noncoding GWAS variants (18, 19). Recently, we identified a functional SNP, associated with 2 autoimmune diseases, that exerted allele-specific enhancer regulation onIRF5 expression through long-rang loop formation (20). Nevertheless, these studies primarily focused on one GWAS susceptibility loci on one disease, and only a limited number of functional causal variants predisposing to autoimmune diseases have been validated (20). The autoimmune diseases share substantial common susceptibility vari- ants and immunopathology (21). Therefore, deciphering the functions of GWAS noncoding variants sys- tematically is essential for accelerating GWAS findings into useful biological and clinical insight into the causes of autoimmune diseases. To address these issues, we devised an integrative analysis frame to prioritize potential functional non- coding SNPs on 19 autoimmune diseases and further predicted their local and distal regulatory target genes using epigenetic, transcriptional, and 3D chromatin interaction data across hundreds of blood immune cell types (Supplemental Tables 2, 3, and 6; supplemental material available online with this article; https:// doi.org/10.1172/jci.insight.136477DS1). Our analysis contains an integrative functional SNP prioritiza- tion method combing cell-specific epigenetic scoring and allele-specific regulatory analysis. We next evalu- ated the performance of our method by comparing it with other representative methods. We then explored the immunologically related function as well as potential clinical drug applications for predicted target genes. In addition, we analyzed the roles of long-range chromatin interactions on autoimmune SNPs as well as potential key regulatory transcription factors (TFs). Finally, we developed an open web resource (http://fnGWAS.online/) and a local analytical pipeline (https://github.com/xjtugenetics/fnGWAS). Results Integrative analysis prioritized potential noncoding functional autoimmune SNPs with causal target genes. We col- lected 18,857 autoimmune noncoding tag SNPs predisposed to 19 distinct autoimmune diseases (report- ed P < 5×10–8) from multiple resources (3, 22, 23) (Supplemental Table 1). LD analysis retained 51,594 noncoding tags and LD-expanded (r2 > 0.8 in European ancestry) SNPs in 333 genome-wide significant loci (autoimmune-positive SNPs). We next collected 26,922,878 background SNPs in all 333 loci, and collected 47,131,427 negative SNPs beyond these loci (Supplemental Figure 1, further details in Meth- ods). To explore potential key epigenetic regulatory features for autoimmune diseases, we collected 606 epigenetic annotation data across 47 blood immune cell types from Roadmap (24) and
Recommended publications
  • Aberrant Methylation Underlies Insulin Gene Expression in Human Insulinoma

    Aberrant Methylation Underlies Insulin Gene Expression in Human Insulinoma

    ARTICLE https://doi.org/10.1038/s41467-020-18839-1 OPEN Aberrant methylation underlies insulin gene expression in human insulinoma Esra Karakose1,6, Huan Wang 2,6, William Inabnet1, Rajesh V. Thakker 3, Steven Libutti4, Gustavo Fernandez-Ranvier 1, Hyunsuk Suh1, Mark Stevenson 3, Yayoi Kinoshita1, Michael Donovan1, Yevgeniy Antipin1,2, Yan Li5, Xiaoxiao Liu 5, Fulai Jin 5, Peng Wang 1, Andrew Uzilov 1,2, ✉ Carmen Argmann 1, Eric E. Schadt 1,2, Andrew F. Stewart 1,7 , Donald K. Scott 1,7 & Luca Lambertini 1,6 1234567890():,; Human insulinomas are rare, benign, slowly proliferating, insulin-producing beta cell tumors that provide a molecular “recipe” or “roadmap” for pathways that control human beta cell regeneration. An earlier study revealed abnormal methylation in the imprinted p15.5-p15.4 region of chromosome 11, known to be abnormally methylated in another disorder of expanded beta cell mass and function: the focal variant of congenital hyperinsulinism. Here, we compare deep DNA methylome sequencing on 19 human insulinomas, and five sets of normal beta cells. We find a remarkably consistent, abnormal methylation pattern in insu- linomas. The findings suggest that abnormal insulin (INS) promoter methylation and altered transcription factor expression create alternative drivers of INS expression, replacing cano- nical PDX1-driven beta cell specification with a pathological, looping, distal enhancer-based form of transcriptional regulation. Finally, NFaT transcription factors, rather than the cano- nical PDX1 enhancer complex, are predicted to drive INS transactivation. 1 From the Diabetes Obesity and Metabolism Institute, The Department of Surgery, The Department of Pathology, The Department of Genetics and Genomics Sciences and The Institute for Genomics and Multiscale Biology, The Icahn School of Medicine at Mount Sinai, New York, NY 10029, USA.
  • Nucleoporin 107, 62 and 153 Mediate Kcnq1ot1 Imprinted Domain Regulation in Extraembryonic Endoderm Stem Cells

    ARTICLE DOI: 10.1038/s41467-018-05208-2 OPEN Nucleoporin 107, 62 and 153 mediate Kcnq1ot1 imprinted domain regulation in extraembryonic endoderm stem cells Saqib S. Sachani 1,2,3,4, Lauren S. Landschoot1,2, Liyue Zhang1,2, Carlee R. White1,2, William A. MacDonald3,4, Michael C. Golding 5 & Mellissa R.W. Mann 3,4 1234567890():,; Genomic imprinting is a phenomenon that restricts transcription to predominantly one par- ental allele. How this transcriptional duality is regulated is poorly understood. Here we perform an RNA interference screen for epigenetic factors involved in paternal allelic silen- cing at the Kcnq1ot1 imprinted domain in mouse extraembryonic endoderm stem cells. Multiple factors are identified, including nucleoporin 107 (NUP107). To determine NUP107’s role and specificity in Kcnq1ot1 imprinted domain regulation, we deplete Nup107, as well as Nup62, Nup98/96 and Nup153. Nup107, Nup62 and Nup153, but not Nup98/96 depletion, reduce Kcnq1ot1 noncoding RNA volume, displace the Kcnq1ot1 domain from the nuclear periphery, reactivate a subset of normally silent paternal alleles in the domain, alter histone modifications with concomitant changes in KMT2A, EZH2 and EHMT2 occupancy, as well as reduce cohesin interactions at the Kcnq1ot1 imprinting control region. Our results establish an important role for specific nucleoporins in mediating Kcnq1ot1 imprinted domain regulation. 1 Departments of Obstetrics & Gynaecology, and Biochemistry, Western University, Schulich School of Medicine and Dentistry, London, ON N6A 5W9, Canada. 2 Children’s Health Research Institute, London, ON N6C 2V5, Canada. 3 Departments of Obstetrics, Gynecology and Reproductive Sciences, University of Pittsburgh School of Medicine, Pittsburgh, PA 15213, USA. 4 Magee-Womens Research Institute, Pittsburgh, PA 15213, USA.
  • Hyaluronidase PH20 (SPAM1) Rabbit Polyclonal Antibody – TA337855

    Hyaluronidase PH20 (SPAM1) Rabbit Polyclonal Antibody – TA337855

    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA337855 Hyaluronidase PH20 (SPAM1) Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-SPAM1 antibody is: synthetic peptide directed towards the C- terminal region of Human SPAM1. Synthetic peptide located within the following region: CYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPMETEEPQIFYNASP Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Affinity Purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 58 kDa Gene Name: sperm adhesion molecule 1 Database Link: NP_694859 Entrez Gene 6677 Human P38567 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 Hyaluronidase PH20 (SPAM1) Rabbit Polyclonal Antibody – TA337855 Background: Hyaluronidase degrades hyaluronic acid, a major structural proteoglycan found in extracellular matrices and basement membranes. Six members of the hyaluronidase family are clustered into two tightly linked groups on chromosome 3p21.3 and 7q31.3. This gene was previously referred to as HYAL1 and HYA1 and has since been assigned the official symbol SPAM1; another family member on chromosome 3p21.3 has been assigned HYAL1.
  • Podocyte Specific Knockdown of Klf15 in Podocin-Cre Klf15flox/Flox Mice Was Confirmed

    Podocyte Specific Knockdown of Klf15 in Podocin-Cre Klf15flox/Flox Mice Was Confirmed

    SUPPLEMENTARY FIGURE LEGENDS Supplementary Figure 1: Podocyte specific knockdown of Klf15 in Podocin-Cre Klf15flox/flox mice was confirmed. (A) Primary glomerular epithelial cells (PGECs) were isolated from 12-week old Podocin-Cre Klf15flox/flox and Podocin-Cre Klf15+/+ mice and cultured at 37°C for 1 week. Real-time PCR was performed for Nephrin, Podocin, Synaptopodin, and Wt1 mRNA expression (n=6, ***p<0.001, Mann-Whitney test). (B) Real- time PCR was performed for Klf15 mRNA expression (n=6, *p<0.05, Mann-Whitney test). (C) Protein was also extracted and western blot analysis for Klf15 was performed. The representative blot of three independent experiments is shown in the top panel. The bottom panel shows the quantification of Klf15 by densitometry (n=3, *p<0.05, Mann-Whitney test). (D) Immunofluorescence staining for Klf15 and Wt1 was performed in 12-week old Podocin-Cre Klf15flox/flox and Podocin-Cre Klf15+/+ mice. Representative images from four mice in each group are shown in the left panel (X 20). Arrows show colocalization of Klf15 and Wt1. Arrowheads show a lack of colocalization. Asterisk demonstrates nonspecific Wt1 staining. “R” represents autofluorescence from RBCs. In the right panel, a total of 30 glomeruli were selected in each mouse and quantification of Klf15 staining in the podocytes was determined by the ratio of Klf15+ and Wt1+ cells to Wt1+ cells (n=6 mice, **p<0.01, unpaired t test). Supplementary Figure 2: LPS treated Podocin-Cre Klf15flox/flox mice exhibit a lack of recovery in proteinaceous casts and tubular dilatation after DEX administration.
  • Mediator of DNA Damage Checkpoint 1 (MDC1) Is a Novel Estrogen Receptor Co-Regulator in Invasive 6 Lobular Carcinoma of the Breast 7 8 Evelyn K

    Mediator of DNA Damage Checkpoint 1 (MDC1) Is a Novel Estrogen Receptor Co-Regulator in Invasive 6 Lobular Carcinoma of the Breast 7 8 Evelyn K

    bioRxiv preprint doi: https://doi.org/10.1101/2020.12.16.423142; this version posted December 16, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC 4.0 International license. 1 Running Title: MDC1 co-regulates ER in ILC 2 3 Research article 4 5 Mediator of DNA damage checkpoint 1 (MDC1) is a novel estrogen receptor co-regulator in invasive 6 lobular carcinoma of the breast 7 8 Evelyn K. Bordeaux1+, Joseph L. Sottnik1+, Sanjana Mehrotra1, Sarah E. Ferrara2, Andrew E. Goodspeed2,3, James 9 C. Costello2,3, Matthew J. Sikora1 10 11 +EKB and JLS contributed equally to this project. 12 13 Affiliations 14 1Dept. of Pathology, University of Colorado Anschutz Medical Campus 15 2Biostatistics and Bioinformatics Shared Resource, University of Colorado Comprehensive Cancer Center 16 3Dept. of Pharmacology, University of Colorado Anschutz Medical Campus 17 18 Corresponding author 19 Matthew J. Sikora, PhD.; Mail Stop 8104, Research Complex 1 South, Room 5117, 12801 E. 17th Ave.; Aurora, 20 CO 80045. Tel: (303)724-4301; Fax: (303)724-3712; email: [email protected]. Twitter: 21 @mjsikora 22 23 Authors' contributions 24 MJS conceived of the project. MJS, EKB, and JLS designed and performed experiments. JLS developed models 25 for the project. EKB, JLS, SM, and AEG contributed to data analysis and interpretation. SEF, AEG, and JCC 26 developed and performed informatics analyses. MJS wrote the draft manuscript; all authors read and revised the 27 manuscript and have read and approved of this version of the manuscript.
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
  • The Alternative Role of DNA Methylation in Splicing Regulation

    The Alternative Role of DNA Methylation in Splicing Regulation

    TIGS-1191; No. of Pages 7 Review The alternative role of DNA methylation in splicing regulation Galit Lev Maor, Ahuvi Yearim, and Gil Ast Department of Human Molecular Genetics and Biochemistry, Sackler Medical School, Tel Aviv University, Tel Aviv, Israel Although DNA methylation was originally thought to only Alternative splicing is an evolutionarily conserved mech- affect transcription, emerging evidence shows that it also anism that increases transcriptome and proteome diversity regulates alternative splicing. Exons, and especially splice by allowing the generation of multiple mRNA products from sites, have higher levels of DNA methylation than flanking a single gene [10]. More than 90% of human genes were introns, and the splicing of about 22% of alternative exons shown to undergo alternative splicing [11,12]. Furthermore, is regulated by DNA methylation. Two different mecha- the average number of spliced isoforms per gene is higher in nisms convey DNA methylation information into the vertebrates [13], implying that the prevalence of alternative regulation of alternative splicing. The first involves mod- splicing in these organisms is important for their greater ulation of the elongation rate of RNA polymerase II (Pol II) complexity. The splicing reaction is regulated by various by CCCTC-binding factor (CTCF) and methyl-CpG binding activating and repressing elements such as cis-acting se- protein 2 (MeCP2); the second involves the formation of a quence signals and RNA-binding proteins [13–15]. Its regu- protein bridge by heterochromatin protein 1 (HP1) that lation is essential for providing cells and tissues their recruits splicing factors onto transcribed alternative specific features, and for their response to environmental exons.
  • A Newly Assigned Role of CTCF in Cellular Response to Broken Dnas

    A Newly Assigned Role of CTCF in Cellular Response to Broken Dnas

    biomolecules Review A Newly Assigned Role of CTCF in Cellular Response to Broken DNAs Mi Ae Kang and Jong-Soo Lee * Department of Life Sciences, Ajou University, Suwon 16499, Korea; [email protected] * Correspondence: [email protected]; Tel.: +82-31-219-1886; Fax: +82-31-219-1615 Abstract: Best known as a transcriptional factor, CCCTC-binding factor (CTCF) is a highly con- served multifunctional DNA-binding protein with 11 zinc fingers. It functions in diverse genomic processes, including transcriptional activation/repression, insulation, genome imprinting and three- dimensional genome organization. A big surprise has recently emerged with the identification of CTCF engaging in the repair of DNA double-strand breaks (DSBs) and in the maintenance of genome fidelity. This discovery now adds a new dimension to the multifaceted attributes of this protein. CTCF facilitates the most accurate DSB repair via homologous recombination (HR) that occurs through an elaborate pathway, which entails a chain of timely assembly/disassembly of various HR-repair complexes and chromatin modifications and coordinates multistep HR processes to faithfully restore the original DNA sequences of broken DNA sites. Understanding the functional crosstalks between CTCF and other HR factors will illuminate the molecular basis of various human diseases that range from developmental disorders to cancer and arise from impaired repair. Such knowledge will also help understand the molecular mechanisms underlying the diverse functions of CTCF in genome biology. In this review, we discuss the recent advances regarding this newly assigned versatile role of CTCF and the mechanism whereby CTCF functions in DSB repair. Keywords: CTCF; DNA damage repair; homologous recombination Citation: Kang, M.A.; Lee, J.-S.
  • Identifying Host Genetic Factors Controlling Susceptibility to Blood-Stage Malaria in Mice

    Identifying Host Genetic Factors Controlling Susceptibility to Blood-Stage Malaria in Mice

    Identifying host genetic factors controlling susceptibility to blood-stage malaria in mice Aurélie Laroque Department of Biochemistry McGill University Montreal, Quebec, Canada December 2016 A thesis submitted to McGill University in partial fulfilment of the requirements of the degree of Doctor of Philosophy. © Aurélie Laroque, 2016 ABSTRACT This thesis examines genetic factors controlling host response to blood stage malaria in mice. We first phenotyped 25 inbred strains for resistance/susceptibility to Plasmodium chabaudi chabaudi AS infection. A broad spectrum of responses was observed, which suggests rich genetic diversity among different mouse strains in response to malaria. A F2 intercross was generated between susceptible SM/J and resistant C57BL/6 mice and the progeny was phenotyped for susceptibility to P. chabaudi chabaudi AS infection. A whole genome scan revealed the Char1 locus as a key regulator of parasite density. Using a haplotype mapping approach, we reduced the locus to a 0.4Mb conserved interval that segregates with resistance/susceptibility to infection for the search of positional candidate genes. In addition, I pursued the work on the Char10 locus that was previously identified in [AcB62xCBA/PK]F2 animals (LOD=10.8, 95% Bayesian CI=50.7-75Mb). Pyruvate kinase deficiency was found to protect mice and humans against malaria. However, AcB62 mice are susceptible to P. chabaudi infection despite carrying the protective PklrI90N mutation. We characterized the Char10 locus and showed that it modulates the severity of the pyruvate deficiency phenotype by regulating erythroid responses. We created 4 congenic lines carrying different portions of the Char10 interval and demonstrated that Char10 is found within a maximal 4Mb interval.
  • Legionella Genus Genome Provide Multiple, Independent Combinations for Replication in Human Cells

    Legionella Genus Genome Provide Multiple, Independent Combinations for Replication in Human Cells

    Supplemental Material More than 18,000 effectors in the Legionella genus genome provide multiple, independent combinations for replication in human cells Laura Gomez-Valero1,2, Christophe Rusniok1,2, Danielle Carson3, Sonia Mondino1,2, Ana Elena Pérez-Cobas1,2, Monica Rolando1,2, Shivani Pasricha4, Sandra Reuter5+, Jasmin Demirtas1,2, Johannes Crumbach1,2, Stephane Descorps-Declere6, Elizabeth L. Hartland4,7,8, Sophie Jarraud9, Gordon Dougan5, Gunnar N. Schroeder3,10, Gad Frankel3, and Carmen Buchrieser1,2,* Table S1: Legionella strains analyzed in the present study Table S2: Type IV secretion systems predicted in the genomes analyzed Table S3: Eukaryotic like domains identified in the Legionella proteins analyzed Table S4: Small GTPases domains detected in the genus Legionella as defined in the CDD ncbi domain database Table S5: Eukaryotic like proteins detected in the Legionella genomes analyzed in this study Table S6: Aminoacid identity of the Dot/Icm components in Legionella species with respect to orthologous proteins in L. pneumophila Paris Table S7: Distribution of seventeen highly conserved Dot/Icm secreted substrates Table S8: Comparison of the effector reperotoire among strains of the same Legionella species Table S9. Number of Dot/Icm secreted proteins predicted in each strain analyzed Table S10: Replication capacity of the different Legionella species analyzed in this study and collection of literature data on Legionella replication Table S11: Orthologous table for all genes of the 80 analyzed strains based on PanOCT. The orthologoss where defined with the program PanOCT using the parameters previously indicated in material and methods.) Figure S1: Distribution of the genes predicted to encode for the biosynthesis of flagella among all Legionella species.
  • A Shunt Pathway Limits the Caax Processing of Hsp40 Ydj1p and Regulates Ydj1p-Dependent

    A Shunt Pathway Limits the Caax Processing of Hsp40 Ydj1p and Regulates Ydj1p-Dependent

    1 TITLE 2 A shunt pathway limits the CaaX processing of Hsp40 Ydj1p and regulates Ydj1p-dependent 3 phenotypes 4 Emily R. Hildebrandt, Michael Cheng, Peng Zhao, June H. Kim, Lance Wells, and Walter K. 5 Schmidt* 6 Department of Biochemistry and Molecular Biology, The University of Georgia, Athens, GA 7 30602, USA 8 *corresponding author: Walter K. Schmidt, 706-583-8241 (phone), 706-542-1738 (fax), 9 [email protected] (email) 10 11 COMPETING INTERESTS: none 12 13 Key words: CaaX, isoprenylation, HSP40, chaperone, thermotolerance 14 15 ABBREVIATIONS 16 polyacrylamide gel electrophoresis (PAGE) 17 sodium dodecyl sulfate (SDS) 18 heat shock protein 40 (Hsp40) 19 20 ABSTRACT 21 The modifications occurring to CaaX proteins have largely been established using few reporter 22 molecules (e.g. Ras, yeast a-factor mating pheromone). These proteins undergo three 23 coordinated COOH-terminal events: isoprenylation of the cysteine, proteolytic removal of aaX, 24 and COOH-terminal methylation. Here, we investigated the coupling of these modifications in 25 the context of the yeast Ydj1p chaperone. We provide genetic, biochemical, and biophysical 26 evidence that the Ydj1p CaaX motif is isoprenylated but not cleaved and carboxylmethylated. 27 Moreover, we demonstrate that Ydj1p-dependent thermotolerance and Ydj1p localization are 28 perturbed when alternative CaaX motifs are transplanted onto Ydj1p. The abnormal 29 phenotypes revert to normal when post-isoprenylation events are genetically interrupted. Our 30 findings indicate that proper Ydj1p function requires an isoprenylatable CaaX motif that is 31 resistant to post-isoprenylation events. These results expand on the complexity of protein 32 isoprenylation and highlight the impact of post-isoprenylation events in regulating the function of 33 Ydj1p and perhaps other CaaX proteins.
  • A Small-Molecule Inhibitor of Isoprenylcysteine Carboxyl Methyltransferase with Antitumor Activity in Cancer Cells

    A Small-Molecule Inhibitor of Isoprenylcysteine Carboxyl Methyltransferase with Antitumor Activity in Cancer Cells

    A small-molecule inhibitor of isoprenylcysteine carboxyl methyltransferase with antitumor activity in cancer cells Ann M. Winter-Vann*, Rudi A. Baron*, Waihay Wong*, June dela Cruz*, John D. York*, David M. Gooden†, Martin O. Bergo‡, Stephen G. Young§, Eric J. Toone†, and Patrick J. Casey*¶ Departments of *Pharmacology and Cancer Biology and †Chemistry, Duke University Medical Center, Durham, NC 27710; ‡Department of Internal Medicine, Sahlgrenska University Hospital, S-413 45 Gothenburg, Sweden; and §Department of Medicine, University of California, Los Angeles, CA 90095 Edited by John A. Glomset, University of Washington, Seattle, WA, and approved February 7, 2005 (received for review November 1, 2004) Many key regulatory proteins, including members of the Ras family proteins have also been implicated in oncogenesis and tumor of GTPases, are modified at their C terminus by a process termed progression, and these proteins most likely require processing via prenylation. This processing is initiated by the addition of an the prenylation pathway for function (2, 15). isoprenoid lipid, and the proteins are further modified by a pro- Both the membrane targeting and the transforming abilities of teolytic event and methylation of the C-terminal prenylcysteine. Ras require processing through the prenylation pathway (16, 17). Although the biological consequences of prenylation have been For this reason, the protein prenyltransferases, most notably characterized extensively, the contributions of prenylcysteine FTase, have been targets of major drug discovery programs for methylation to the functions of the modified proteins are not well the last decade (18, 19). Presently, several FTase inhibitors are understood. This reaction is catalyzed by the enzyme isoprenyl- being evaluated in clinical trials (15, 19).