Consigned by Darley Storm Cat Storm Bird Terlingua Forestry (USA

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Consigned by Darley 498 498 Storm Bird Storm Cat Terlingua Forestry (USA) Pleasant Colony LITTLE MISCHIEF Shared Interest (USA) Surgery (2006) Mr Prospector Sweet Arizona Gone West Bay Filly Secrettame (USA) Wild Again (1999) Cinnamon Sugar Sugar And Spice E.B.F. Nominated. LITTLE MISCHIEF (USA): winner at 3, 2009 in France and placed twice. Breeding Certificate at Sale. 1st dam SWEET ARIZONA (USA): ran in U.S.A. at 3; dam of 5 foals; 2 runners; 2 winners: Tommys Luck (USA) (c. by Maria's Mon (USA)): 3 wins at 3, 2008 in U.S.A. and £53,168 and placed 6 times. Little Mischief (USA) (f. by Forestry (USA)): see above. Distant Sky (USA) (c. by El Prado (IRE): 3-y-o in training. She also has a 2-y-o filly by Street Cry (IRE) and a yearling filly by Discreet Cat (USA). 2nd dam CINNAMON SUGAR (IRE): 6 wins at 2 to 4 in U.S.A. and £110,486 inc. Konica Long Look H., Gr.2 and Coral Gables H., L., placed 2nd Acorn S., Gr.1, Mother Goose S., Gr.1, Gazelle H., Gr.1, Bonnie Miss S., Gr.2, Cotillion H., Gr.2 and 3rd John A Morris H., Gr.1; dam of 10 foals; 5 runners; 2 winners: Ashraaf (USA): 2 wins at 2 and 3 in U.S.A. and £87,072; dam of a winner. Moktabes (USA): 2 wins at 3 and placed. Autumn Spice (USA) 3-y-o filly by Grand Slam (USA): unraced to date. She also has a 2-y-o colt by Fusaichi Pegasus (USA). 3rd dam SUGAR AND SPICE (USA) (by Key To The Mint (USA)): 5 wins in U.S.A. and $257,046 inc. Mother Goose S., Gr.1, Ashland S., Gr.2 and Cotillion S., Gr.2, placed 6 times 2nd Ladies H., Gr.1, Firenze H., Gr.2, Gazelle S., Gr.2, 3rd Acorn S., Gr.1, Alabama S., Gr.1, Delaware Oaks, Gr.1, 4th Coaching Club American Oaks, Gr.1 and Test S., Gr.2; dam of 12 foals; 9 runners; 5 winners inc.: CINNAMON SUGAR (IRE): see above. SURE TURN (USA): 2 wins in U.S.A. and $53,190 inc. Crimson Satan S.; sire. All Things Nice (USA): unraced; dam of winners inc.: STRIKES NO SPARES (USA): won King County H., 2nd Summertime Promise H., L., Angie C S., 3rd Singapore Plate S., Gr.3. Music House (USA): unraced; dam of winners inc.: ALLSPICE (USA): won Sixty Sails H., Gr.3, Eliza S., L.. 4th dam Sweet Tooth (USA): 10 wins in U.S.A. and $86,004 and placed 12 times inc. 2nd Alcibiades S.; dam of 13 foals; 10 runners; 8 winners inc.: ALYDAR (USA): 14 wins at 2 to 4 in U.S.A. and £516,010 inc. Champagne S., Gr.1, Blue Grass S., Gr.1, Flamingo S., Gr.1, Florida Derby, Gr.1, Sapling S., Gr.1, Travers S., Gr.1, Arlington Classic S., Gr.2, Whitney S., Gr.2; sire. OUR MIMS (USA): Champion 3yr old filly in U.S.A. in 1977, 6 wins at 3 and 4 in U.S.A. and $368,034 inc. Alabama S., Gr.1, Coaching Club American Oaks, Gr.1, Delaware H., Gr.1 and Fantasy S., Gr.2; dam of winners. Stabled in Barn C Box 26 .
Recommended publications
  • Graydar Oxbow

    Graydar Oxbow

    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
  • CHESTNUT COLT Barn 31 Hip No

    CHESTNUT COLT Barn 31 Hip No

    Consigned by Claiborne Farm, Agent Barn Hip No. 31 CHESTNUT COLT 845 Foaled April 25, 2006 Storm Bird Storm Cat ......................... Terlingua Forestry ............................ Pleasant Colony Shared Interest.................. Surgery CHESTNUT COLT Mr. Prospector Forty Niner........................ File Tour .................................. (1990) Full Pocket Fun Flight ......................... Fun and Tears By FORESTRY (1996). Stakes winner of $591,225, King's Bishop S. [G1], etc. Sire of 5 crops of racing age, 403 foals, 208 starters, 27 stakes winners, 139 winners of 327 races and earning $11,442,572 & $130,795(CAN) in N.A., including Smokey Glacken ($656,960, Distaff Breeders' Cup H. [G2] (AQU, $94,800), etc.), Diplomat Lady ($552,784, Hollywood Starlet S. [G1] (HOL, $273,600), etc.), Old Forester [G3] ($451,080 & $13,848 (CAN)), Forest Danger ($423,000, Carter H. [G1] (AQU, $210,000), etc.). 1st dam TOUR, by Forty Niner. 5 wins, 2 to 4, $254,939, Curious Clover H. [L] (HOL, $29,100), 2nd Bold Jill H. [L] (SA, $10,000), CERF H. [L] (HOL, $10,000), Very Subtle H.-R (HOL, $11,000), Frosty Shades H. (GG, $6,000), etc. Sister to FLIGHT FORTY NINE. Dam of 8 other registered foals, 8 of rac- ing age, including a 2-year-old of 2007, 6 to race, 4 winners-- TRIP (f. by Lord At War (ARG)). 11 wins, 3 to 5, $888,773, Turfway Breed- ers' Cup S. [G3], Turfway Breeders’ Cup S. [G3] (TP, $125,500), Chi- cago Breeders' Cup H. [G3], Bourbonette Breeders' Cup S. [L] (TP, $93,600), Iowa Oaks [L] (PRM, $90,000), Fairway Fun S. [L] (TP, $31,- 300), 2nd Delaware Oaks [G3], Regret S.
  • ETCHED Chestnut Horse, 2005; 16.3 Hands DIPLOMAT LADY: 4 Wins, $552,784, Hollywood Starlet S-G1, Beaumont­ S-G2, Etc

    ETCHED Chestnut Horse, 2005; 16.3 Hands DIPLOMAT LADY: 4 Wins, $552,784, Hollywood Starlet S-G1, Beaumont­ S-G2, Etc

    ETCHED Chestnut Horse, 2005; 16.3 Hands DIPLOMAT LADY: 4 wins, $552,784, Hollywood Starlet S-G1, Beaumont S-G2, etc. Storm Bird Northern Dancer FOREST DANGER: 5 wins, $423,000 in 8 starts, Carter H-G1, etc. Sire. South Ocean Storm Cat QUIZ KID: 6 wins, $200,701 to 5, 2016 in Argentina, Gran Premio Estrellas Clas- Terlingua Secretariat sic-G1, Premio Pr Progreso-G3 twice, etc. Forestry Crimson Saint FANTASTIC FOUR: 5 wins, $168,289 to 4, 2016 in Argentina, Gran Premio Joaquin Bay, 1996 His Majesty V. Gonzalez-G1, Premio 25 De Mayo De 1810-G2, etc. Pleasant Colony Sun Colony Shared Interest SMOKEY GLACKEN: 10 wins, $656,960, Distaff Breeders’ Cup H-G2, etc. Dr. Fager Surgery Bold Sequence HOMERUN BERTI: 22 wins, $496,397 to 10, 2016, Lea County Sprint S, etc. OLD FORESTER: 6 wins, $462,632, Cliff Hanger S-G3, Canadian Turf H, Santa Unbridled Fappiano Claus S, etc. Set ncr at Gulfstream Park. Sire. Unbridled’s Song Gana Facil Trolley Song Caro (Ire) Unbridled Elaine Lucky Spell FEMALE LINE Gray or Roan, 1998 In Reality UNBRIDLED ELAINE. 6 wins at 2 and 3, $1,770,740, Breeders’ Cup Distaff Taylor’s Falls Nilene Wonder Carols Folly S-G1, Monmouth Breeders’ Cup Oaks-G2, Iowa Oaks, Pocahontas S, No Trespassing Bob’s Dusty Private Parking 2nd Pennsylvania Derby-G3, etc. Dam of 8 foals, 4 to race, 3 winners— ETCHED (Forestry). Stakes winner. Dosage Profile: 4 11 7 0 0 OUT OF BOUNDS (Discreet Cat). 3 wins, 2 to 4, $177,673 in U.S., U.A.E.
  • Top Beyer Speed Figures • 1993-2018

    Top Beyer Speed Figures • 1993-2018

    TOP BEYER SPEED FIGURES • 1993-2018 2-year-olds, 1993 2-year-olds, 1996 Beyer Beyer No. Horse Track Dist Date No. Horse Track Dist Date 106 VALIANT NATURE HOL 8.5 12/19/1993 108 THISNEARLYWASMINE SA 6 10/23/1996 105 BROCCO HOL 8.5 12/19/1993 107 KELLY KIP SAR 6 07/26/1996 105 POLAR EXPEDITION AP 6 08/14/1993 106 IN EXCESSIVE BULL SA 6 10/23/1996 103 HOLY BULL BEL 7 09/18/1993 104 HOLZMEISTER HAW 8.5 11/17/1996 102 DEHERE BEL 7 09/18/1993 104 KELLY KIP BEL 5 06/21/1996 101 HOLY BULL MTH 5.5 08/14/1993 103 IN C C’S HONOR LRL 6 12/21/1996 100 FLYING SENSATION HOL 8.5 12/19/1993 102 DIXIE FLAG (F) AQU 6 11/24/1996 100 SARDULA (F) DMR 7 09/04/1993 101 CAPTAIN BODGIT LRL 9 11/02/1996 99 BLUMIN AFFAIR HOL 8.5 12/19/1993 101 GOLD CASE FG 6 12/30/1996 99 INDIVIDUAL STYLE HOL 7 11/26/1993 101 IN EXCESSIVE BULL HOL 7 11/10/1996 99 YOU AND I AQU 7 10/20/1993 101 IN EXCESSIVE BULL SA 6 10/05/1996 Champion 2-year-old male Dehere had one of the highest Beyer Speed 101 MUD ROUTE HOL 6.5 12/15/1996 Figures of the season, but Valiant Nature earned the highest when beating 101 ORDWAY BEL 8.5 10/05/1996 Breeders’ Cup Juvenile winner Brocco in the Hollywood Futurity.
  • LEADERS Oppenheim: Constitution, American Pharoah Top Second-Crop Sires See Page 4

    LEADERS Oppenheim: Constitution, American Pharoah Top Second-Crop Sires See Page 4

    MONDAY, JUNE 1, 2020 BLOODHORSE.COM/DAILY ANNE M. EBERHARDT ANNE M. LEADERS Oppenheim: Constitution, American Pharoah Top Second-Crop Sires See page 4 IN THIS ISSUE 11 Quality Road, Blame Colts Shine at OBS Under Tack Show 13 Ward Hones Stable Roster for Royal Ascot Bid 17 Grade 1-Winning Sprinter Imperial Hint Retired BLOODHORSE DAILY Download the FREE smartphone app PAGE 1 OF 30 CONTENTS 4 Oppenheim: Constitution, American Pharoah Top Second-Crop Sires 10 Leading KY Sires by % Black-Type Performers 11 Quality Road, Blame Colts Shine at OBS Under Tack Show 13 Ward Hones Stable Roster for Royal Ascot Bid 15 Fighting Mad Makes It Look Easy in Santa Maria Stakes 16 Dynasty of Her Own Makes All in California Oaks 17 Grade 1-Winning Sprinter Imperial Hint Retired 21 NYRA Making Safety a Priority at Belmont Park 23 Authentic Has Final Work Ahead of Santa Anita Derby 23 Mr Havercamp Retired With Pelvis Injury 24 Contrail Remains Undefeated With Japanese Derby Romp 25 Victor Ludorum Heads Fabre Trio in French Guineas 26 Tropbeau Headlines French One Thousand Guineas 27 Relieved Trainers Prepare to Resume Racing in Britain 28 Results & Entries ANNE M. EBERHARDT ANNE M. 2020 PENNSYLVANIA Still searching for the perfect match for your mare? STALLION Click to view our 2020 Stallion Directory & BOARDING FARM DIRECTORY pabred.com A publication of The Jockey Club Information Systems, Inc. and TOBA Media Properties, Inc. ON THE COVER Editorial Director General Manager WinStar Farm’s Constitution is almost on even terms Evan Hammonds Scott Carling with leading second-crop sire American Pharoah Visuals Director Managing Editor Anne M.
  • MANY RIVERS Ch, 2005

    MANY RIVERS Ch, 2005

    MANY RIVERS ch, 2005 Dosage (7-4-8-1-0); DI: 3.00; CD: 0.85 See gray pages—Nearctic RACE AND (BLACK TYPE) RECORD Northern Dancer, 1961 Nearctic, by Nearco Age Starts 1st 2nd 3rd Earned 18s, BTW, $580,647 Storm Bird, 1978 636 f, 147 BTW, 4.11 AEI Natalma, by Native Dancer 2 8 1 2 1(1) $45,180 6s, BTW, $169,181 3 8 1 0 1 $26,526 682 f, 63 BTW, 2.26 AEI South Ocean, 1967 New Providence, by Bull Page 22s, BTW, $70,147 4 0 0 0 0 — Storm Cat, dkb/br, 1983 8s, BTW, $570,610 12 f, 9 r, 9 w, 4 BTW Shining Sun, by Chop Chop 5 2 0 0 0 $800 1,414 f, 177 BTW, 2.94 AEI Totals 18 2 2 2(1) $72,506 Secretariat, 1970 Bold Ruler, by Nasrullah 7.08 AWD 21s, BTW, $1,316,808 Won At 2 Terlingua, 1976 653 f, 54 BTW, 2.98 AEI Somethingroyal, by Princequillo 17s, BTW, $423,896 A maiden special weight race at BM ($40,200, 5.5f in 11 f, 9 r, 6 w, 2 BTW Crimson Saint, 1969 Crimson Satan, by Spy Song 1:04.47, dftg. Kentucky Twostep, Autism 11s, BTW, $91,770 Awareness, Vadheim, Forearlthepearl, Strong 11 f, 8 r, 7 w, 4 BTW Bolero Rose, by Bolero Suggestion, Sweetville, Searchforthetruth, Exclusive Native, 1965 Raise a Native, by Native Dancer Hurricane Deputy). 13s, BTW, $169,013 3rd Gold Rush S (8f, AW, to El Gato Malo, Bert’s Law, Affrmed, 1975 507 f, 69 BTW, 3.72 AEI Exclusive, by Shut Out 29s, BTW, $2,393,818 dftg.
  • The Green Monkey Bay Horse; Feb 04, 2004 View Complete Auction History 3 Starts, Placed Click Here for Interactive Nicking

    The Green Monkey Bay Horse; Feb 04, 2004 View Complete Auction History 3 Starts, Placed Click Here for Interactive Nicking

    equineline.com Product 10N 11/30/16 15:12:38 EST The Green Monkey Bay Horse; Feb 04, 2004 View Complete Auction History 3 Starts, Placed Click here for Interactive Nicking Nearctic, 54 br Northern Dancer, 61 b Natalma, 57 b Storm Bird, 78 b New Providence, 56 b South Ocean, 67 b Shining Sun, 62 b Storm Cat, 83 dk b/ Bold Ruler, 54 dk b Secretariat, 70 ch Somethingroyal, 52 b Terlingua, 76 ch Crimson Satan, 59 ch Crimson Saint, 69 ch Bolero Rose, 58 ch Forestry, 96 b *Ribot, 52 b His Majesty, 68 b Flower Bowl, 52 b Pleasant Colony, 78 dk b/ Sunrise Flight, 59 dk b Sun Colony, 68 b *Colonia, 59 b Shared Interest, 88 b Rough'n Tumble, 48 b Dr. Fager, 64 b Aspidistra, 54 b Surgery, 76 b Bold Ruler, 54 dk b Bold Sequence, 61 br Sequence, 46 dk b The Green Monkey Bay Horse Raise a Native, 61 ch Foaled Feb 04, 2004 Mr. Prospector, 70 b in Florida Gold Digger, 62 b Fappiano, 77 b 3 Starts Dr. Fager, 64 b Placed Killaloe, 70 b Grand Splendor, 62 b Unbridled, 87 b =Wild Risk (FR), 40 b *Le Fabuleux, 61 ch =Anguar (FR), 50 b Gana Facil, 81 ch In Reality, 64 b Charedi, 76 dk b/ Magic, 69 dk b/ Magical Masquerade, 98 ch Intentionally, 56 blk In Reality, 64 b My Dear Girl, 57 ch Valid Appeal, 72 b Moslem Chief, 57 b Desert Trial, 63 ch Scotch Verdict, 60 ch Nannerl, 87 ch Proud Clarion, 64 b Proud Birdie, 73 b Bernie Bird, 65 dk b/ Allouette, 80 b Bayou Bourg, 59 ch Madame Defage, 67 ro Let's Misbehave, 55 gr Breeder: Padua Stables (FL) Inbreeding: Dr.
  • Shackleford D Based on the Cross of Forestry/Unbridled and His Sons and Grandsons Variant = 0.73 Breeder: Mike Lauffer & Bill Cubbedge (KY)

    Shackleford D Based on the Cross of Forestry/Unbridled and His Sons and Grandsons Variant = 0.73 Breeder: Mike Lauffer & Bill Cubbedge (KY)

    11/01/11 11:44:17 EDT Shackleford D Based on the cross of Forestry/Unbridled and his sons and grandsons Variant = 0.73 Breeder: Mike Lauffer & Bill Cubbedge (KY) Nearctic, 54 br Northern Dancer, 61 b Natalma, 57 b Storm Bird, 78 b New Providence, 56 b South Ocean, 67 b Shining Sun, 62 b Storm Cat, 83 dk b/ Bold Ruler, 54 dk b Secretariat, 70 ch Somethingroyal, 52 b Terlingua, 76 ch Crimson Satan, 59 ch Crimson Saint, 69 ch Bolero Rose, 58 ch Forestry, 96 b *Ribot, 52 b His Majesty, 68 b Flower Bowl, 52 b Pleasant Colony, 78 dk b/ Sunrise Flight, 59 dk b Sun Colony, 68 b *Colonia, 59 b Shared Interest, 88 b Rough'n Tumble, 48 b Dr. Fager, 64 b Aspidistra, 54 b Surgery, 76 b Bold Ruler, 54 dk b Bold Sequence, 61 br Sequence, 46 dk b Shackleford Chestnut Colt Raise a Native, 61 ch Foaled Feb 25, 2008 Mr. Prospector, 70 b in Kentucky Gold Digger, 62 b Fappiano, 77 b Dr. Fager, 64 b Killaloe, 70 b Grand Splendor, 62 b Unbridled, 87 b =Wild Risk (FR), 40 b *Le Fabuleux, 61 ch =Anguar (FR), 50 b Gana Facil, 81 ch In Reality, 64 b Charedi, 76 dk b/ Magic, 69 dk b/ Oatsee, 97 ch Hail to Reason, 58 br Roberto, 69 b Bramalea, 59 dk b/ Lear Fan, 81 b Lt. Stevens, 61 b Wac, 69 b Belthazar, 60 br With Every Wish, 91 b Speak John, 58 b Hold Your Peace, 69 b Blue Moon, 48 b Amo, 85 ch In Reality, 64 b Taminette, 73 ch Tamerett, 62 dk b/ Note on terminology in this report: Direct Cross refers to Dosage Profile: 6 13 9 0 2 Inbreeding: Dr.
  • PEDIGREE INSIGHTS: by T.D

    PEDIGREE INSIGHTS: by T.D

    TUESDAY, MARCH 6, 2018 THE TDN DERBY TOP 12 PEDIGREE INSIGHTS: by T.D. Thornton PROMISES FULFILLED We have a new No. 1 in the TDN Top 12 rankings, but for how long? The two previous early-season leaders couldn=t quite live up to their advance billings when returning off layoffs, and we=ve seen a steady progression of sophomores advancing through the ranks more or less by default without witnessing one powerfully dominant AWow!@ performance yet this season. But the cadence will quicken and the plot will thicken this coming weekend, with a trifecta of coast-to-coast preps spanning California, Florida and New York. Cont. p5 (click here) Promises Fulfilled | Lauren King IN TDN EUROPE TODAY by Andrew Caulfield PETER STANLEY: LET’S MAKE IT PAY TO STAY Only a week ago, when discussing the long-term prospects for Chris McGrath sits down with Peter Stanley to get his views on the survival of Storm Cat=s male line, I wasn=t sure whether to the breeding industry. Click or tap here to go straight to TDN mention the Forestry branch alongside those of Harlan, Europe. Hennessy and Giant=s Causeway. In the end I decided not to, but perhaps I should have--it was Forestry=s son Shackleford who supplied Promises Fulfilled, the unexpected winner of Saturday=s GII Fountain of Youth S. Promises Fulfilled comes from only the second crop of 3-year-olds by the 2011 GI Preakness S. winner, and the first also produced a winner of a Grade II carrying 50 Kentucky Derby points to the winner.
  • CAPRI's SON Barn 9 & 10 Hip No. 3176

    CAPRI's SON Barn 9 & 10 Hip No. 3176

    Consigned by Paramount Sales, Agent XXXII Barn CAPRI'S SON Hip No. 9 & 10 Gray or Roan Colt; foaled January 31, 2018 3176 Storm Cat Forestry ................................ Shared Interest Shackleford .......................... Unbridled Oatsee .................................... With Every Wish CAPRI'S SON Southern Halo More Than Ready .................. Woodman's Girl Capri Song ............................ (2014) Unbridled's Song Grey Song ............................ Dispute By SHACKLEFORD (2008). Classic winner of $3,090,101, Preakness S. [G1] (PIM, $1,100,000), etc. Sire of 3 crops of racing age, 321 foals, 184 start- ers, 113 winners of 230 races and earning $7,698,301, including black- type winners Malagacy ($627,920, Rebel S. [G2] (OP, $540,000)), Promis- es Fulfilled ($495,280, Xpressbet Fountain of Youth S. [G2] (GP, $238,080), etc.), Wellabled ($224,856, Arlington-Washington Futurity [G3] (AP, $57,- 000), etc.), Dream It Is [G3] (3 wins, $175,544), Salmanazar ($116,880). 1st dam CAPRI SONG, by More Than Ready. Unraced. Dam of 1 registered foal, above. 2nd dam GREY SONG, by Unbridled's Song. Unraced. Dam of 4 winners, including-- Nobadeer. 8 wins, 3 to 7, 2018, $144,830. 3rd dam DISPUTE , by Danzig. 9 wins, 2 to 4, $1,106,907, Spinster S. [G1] , Kentucky Oaks [G1] , Beldame S. [G1] , Gazelle H. [G1] , etc. Sister to ADJUDICATING [G1] , half-sister to TIME FOR A CHANGE -G1 , TAX COLLECTION . Dam of-- Plaintiff. Winner at 3, $42,600. Sent to Argentina. Dam of 5 winners, incl.-- PLAINSWOMAN . 4 wins, 2 to 4, 1,111,245 pesos, in Argentina, Manuel J. Guiraldes [G3] , 2nd Bayakoa, Luis Monteverde, etc. (Total: $71,652).
  • FORESTRY Among ALL Sires, the Record-Setting Grade 1 Winner by Storm Cat Was The

    FORESTRY Among ALL Sires, the Record-Setting Grade 1 Winner by Storm Cat Was The

    Wednesday, Thoroughbred Daily News March 13, 2002 TDN For information, call (732) 747-8060. HEADLINE NEWS CIGAR LEADS HALL OF FAME NOMINEES T R I P L E T H R E A T S Two-time Horse of the Year Cigar has been named P P a finalist in the contemporary male category for nomination REPENT SLIGHT DERBY FAVORITE into the National Museum of Churchill oddsmaker Mike Battaglia has made GII Racing’s Hall of Fame. Others Louisiana Derby winner Repent (Louis Quatorze) the 4-1 nominated in that category favorite for Pool 2 of the Kentucky Derby Future include Ancient Title and Wager. The mutuel field is listed as the 5-1 second Precisionist. Cigar raced into choice in the pool, which opens Thursday at noon and fame when he reeled off a continues through Sunday at 5:30 p.m. Just behind the remarkable 16 straight victo- top two choices in the 24-interest field are a trio of ries, including the inaugural horses at 6-1: champion two-year-old Johannesburg Dubai World Cup in 1996. (Hennessy), GII San Rafael winner Came Home (Gone Ancient Title and Precisionist West) and GI Hollywood Futurity winner Siphonic (Si- are among only five horses to phon {Brz}). Pool 2 includes eight horses who were not sweep Santa Anita’s Strub included in the first pool: Blue Burner (French Deputy), Series: the Malibu, San Easy Grades (Honor Grades), Essence of Dubai (Pulpit), Fernando and Strub S. Cigar Horsephotos Mayakovsky (Matty G), Perfect Drift (Dynaformer), Showmeitall (All Gone), Sunday Break (Jpn) (Forty Niner) Precisionist won the 1985 GI and Yougottawanna (Candi’s Gold).
  • Fighting Mad Caps Another Big Weekend for Baffert

    Fighting Mad Caps Another Big Weekend for Baffert

    MONDAY, AUGUST 3, 2020 FIGHTING MAD CAPS FAVES FAIL TO SHOW ON SATURDAY, BUT EXCUSES ABOUND ANOTHER BIG WEEKEND The Week in Review, by T.D. Thornton This past Saturday wasn=t a great day to be a favorite in an FOR BAFFERT open stakes race at the nation=s premier race meets. Chalk horses went a collective one-for-seven at Saratoga and Del Mar, and the list of excuses included stutter-step starts, bumps leaving the gate, stretch-run roughhousing, getting disqualified, and being dueled into defeat in internal pace battles. Tight finishes in several stakes elevated the interest level, although the results in general did not lend clarity to the nationwide divisional races with the GI Kentucky Derby inside the five-week mark and the Breeders= Cup Championships now three months out. At the Spa, faves went zero-for-five, with the GI Personal Ensign S. setting the tone early in the day. Cont. p5 Fighting Mad | Horsephotos IN TDN EUROPE TODAY Lightly raced Fighting Mad (New Year=s Day) zipped away early WATCH ME WINS THE ROTHSCHILD and held sway late to take Sunday evening=s GI Clement L. Hirsch Watch Me (Fr) (Olympic Glory {Ire}) saluted in the G1 Prix de S. at Del Mar and stamp her ticket to the GI Breeders= Cup Rothschild at Deauville on Sunday. Click or tap here to go Distaff. Looking to add to another productive weekend for Hall straight to TDN Europe. of Fame trainer Bob Baffert that included Saturday scores in the GI Whitney S. and Shared Belief S., the Gary and Mary West homebred was backed down to 9-5 favoritism from a 4-1 morning line quote and wasted little time seizing command.