DOCSLIB.ORG

Wildwood's Beauty Seeks Winning Ways in Saturday's Musical Romance

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Wildwood's Beauty Seeks Winning Ways in Saturday's Musical Romance ftboa.com • Saturday & Sunday • May 16 & 17, 2020 FEC/FTBOA PUBLICATION FOR ADVERTISING INFORMATION or to subscribe, please call Antoinette at 352-732-8858 or email: [email protected] In This Issue: Jerkens Gives Homebred ‘Green Light’ Tampa Bay Downs Requests June Dates NYRA Secures Covid Antibody Testing Classy Bellafina Takes On Baffert Pair Social Distancing Shirts Fund Track Pantries Trainers Continue to Make Plans 1/ST Preakness at Home Live Stream Clocker Sees ‘Authentic’ SA Derby Horse Racing Without Spectators Allowed to Return in First Stage Longtime Owner Larry Foggle Dies at 80 Florida-bred Wildwood’s Beauty/RYAN THOMPSON PHOTO Churchill Downs to Air on ‘America’s Day at the Races’ Gulfstream Park Charts Wildwood’s Beauty Seeks Tampa Bay Downs Charts Track Results & Entries Winning Ways in Saturday’s Florida Stallion Progeny List Musical Romance Florida Breeders’ List Florida-Bred Sprint Tops Three Stakes Worth $250,00 Featured Advertisers BY GULFSTREAM PARK The seven-furlong Musical Romance Journeyman Stud PRESS OFFICE ___________________ for Florida-bred fillies and mares, 3-years- Live Oak Stud old and older is the richest of three stakes Stonehedge Farm South HALLANDALE BEACH, FL – William worth $250,000 on an 11-race program, Horse Farms Forever Stiritz’s Wildwood’s Beauty, runner-up in joined by the $75,000 Powder Break for FTBOA females on turf featuring Grade 1-winning three consecutive races including back-to- Florida Department of Agriculture back graded-stakes during the millionaire Got Stormy and $75,000 Roar Championship Meet, hopes to find the for 3-year-olds sprinting six-and-a-half Ocala Breeders’ Feed & Supply cure for her recent second-itis in Saturday’s furlongs. Seminole Feed $100,000 Musical Romance at Gulfstream First race post time is 12:45 p.m. Berrettini Feed Park. Wavertree Stables See GULFSTREAM on page 3 Distorted Humor – Delta Princess, by A.P. Indy ONE CROP OF RACING AGE AND ALREADY FLORIDA’S LEADING SIRE Watch For His Second Crop To Run In 2020 3 Stakes Winners 11 Stakes Horses 31 Winners From 57 Runners (Through May 12) Half-brother to Royal Delta By perennial leading sire Distorted Humor Also standing Fury Kapcori and St Patrick’s Day Brent & Crystal Fernung, Owners SERITA HULT PHOTO HULT SERITA 5571 NW 100th Street, Ocala, FL 34482 | Office: 352.629.1200 | Fax: 352.629.1201 • [email protected] | www.journeymanstallions.com 45756 Back to Top Page 3 Santa Anita Continued from COVER Named for the champion female sprinter of 2011 that was bred in Florida, won 12 of 41 career races and more than $1.6 million in purse earnings from 2009-12, the Musical Romance marks a return to state-bred company for Wildwood’s Beauty. She was beaten a total of five-and-three-quarters lengths by multiple grad- ed-winners Pink Sands and Sally’s Curlin respectively in the Jan. 25 Inside Information (G2) and March 14 Hurricane Bertie (G3) at Gulfstream. &632'3%2()2(96) Unable to hold off either winner while making her own typical late move, Wildwood’s Beauty, who was named the Florida-bred *0=746%=7%0) champion female sprinter and champion 3-year-old filly of 2019, 0$< has pleased trainer Scott Becker with three works over Gulfstream’s main track since the Hurricane Bertie. “Everything’s been right on par, as it has been all year. She has- n’t missed a beat. Everything’s good and she’s doing great,” Becker said. “She ran her race the last couple times and made her nor- mal move, but she just got beat by a couple of very nice horses. Both of those horses came from the back of the pack to win those races, which doesn’t happen all the time there, but she ran big both times.” Such consistency has been Wildwood’s Beauty’s calling card, with five wins and seven seconds from 13 lifetime starts. Six of those run- ner-up finishes have come at Gulfstream, where the 4-year-old Todd Pletcher/COGLIANESE PHOTO Kantharos filly beat older horses in last fall’s seven-furlong Sheer Drama for her lone triumph in eight tries over the surface. “She’s the kind of horse where we’re lucky,” Becker said. “We’re able to find a spot and put her in, and she shows up.” All five of her wins have come against Florida-breds, four in stakes, including the Millions Distaff Preview in November at Gulfstream Park West, her most recent victory. In between that 6DYH and her graded efforts, Wildwood’s Beauty was second in the FSS City of Ocala Dec. 14 at Tampa Bay Downs to J P’s Delight, who also returns in the Musical Romance. “We were looking at going to a couple of other graded races 2))48$576 before everything got shut down, but I’m happy to be able to run here again now, at a distance and track where she’s run well 2))*$//216 before,” Becker said. “There’s some good ones in there, and they’re capable of running well in open company, too.” Two-time defending Eclipse Award-winner Irad Ortiz Jr. will get a leg up on Wildwood’s Beauty for the first time from post three in a field of nine. “She’s always had a little bit of ability before she ever run. She was a little quirky filly when she was young so it took her a little longer to run as a 2-year-old,” Becker said. “We didn’t run her REIVFRP until the Gulfstream West meet late in her 2-year-old year, but +LJKZD\ after that everything has come together. She’s trained well and has $LUSRUW5RDG See GULFSTREAM on page 5 Back to Top to trainer Mark Casse on your well-deserved election to the National Museum of Racing and Hall of Fame. You have been such a signicant part of our team, and we thank you for your outstanding work with Live Oak Plantation homebred World Approval, Eclipse Champion Turf Male of 2017 and winner of that year’s Breeders’ Cup Mile (G1), as well as other multiple Graded stakes winners. Wishing you the best for continued success. Your friends at Live Oak Plantation Charlotte Weber, Mark Casse, and World Approval. 9275 SW 9th St Rd, Ocala, FL 34481 (352) 854-2691 | www.LiveOakStud.com Back to Top 3:32 PM Page 5 Gulfstream page 3 Continued from grown up.” Mathis Stable’s Grade 3-winner Bellera has dis- played similar consistency, with four wins and two seconds from seven starts for trainer Todd Pletcher, including a runner-up finish in her debut last May against older horses – her lone previous try at Gulfstream. The seven-furlong sprint was also the last time 4-year-old Bellera has run shorter than a mile-and- one-sixteenth. Her only time off the board came in her stakes debut, the Turnback the Alarm (G3) last fall at Aqueduct, where she lost rider Jose Lezcano after getting squeezed at the start. “She’s a filly that we feel is probably best at two turns, a mile-and-an-eighth, but being a Florida-bred we figured with limited opportunities this was our best option,” Pletcher said. “We fig- ured we’d give it a try and see what she can do.” Bellera has put together a two-race win streak, but hasn’t been out since a three-quarter-length vic- tory in the Jan. 19 Ladies Handicap at Aqueduct. She capped her sophomore season with a length- and-three-quarters triumph over previous undefeat- ed Arrifana in the Nov. 29 Comely (G3). Both races Florida-bred Two Sixty/RYAN THOMPSON PHOTO came at a mile-and-one-eighth. them wins, including six of 11 at Gulfstream. Second behind Luis Saez will ride Bellera from post two. Stormy Embrace in last year’s Musical Romance, her only other “I like the way she’s training. She’s coming into the race in try at the distance, the speedy Lady’s Island owns four lifetime good order, we just hope that seven furlongs isn’t too short for stakes wins topped by the Sugar Swirl (G3) in December. She has her,” Pletcher said. “We shortened up her last couple works and won two straight, both in Tampa, the most recent an April 19 tried to put some kind of sharp half-miles into her and I like the starter optional claimer. way she’s coming into it. She’s certainly training like she’s ready Also entered are 2019 Claiming Crown Glass Slipper winner to go.” Liza Star; 2018 and 2019 Millions Filly & Mare Turf Preview win- Hall of Fame-elect trainer Mark Casse, who entered Got ner Picara; and multiple stakes winner Starship Bonita, making Stormy in the Powder Break, will send out Two Sixty and Oceans just her second start since finishing fifth in last year’s Musical of Love in the Musical Romance. Live Oak Plantation homebred Romance. Oceans of Love has not started in six months but takes a two-race win streak into her season and stakes debut. Gary Barber’s Two Sixty has raced twice this year, both in Tampa, winning the seven-furlong Gasparilla Stakes and finishing fifth in the one-mile, 40-yard Suncoast, the latter Feb. 8. The 3- year-old daughter of Uncaptured is two-for-four at Gulfstream, breaking her maiden at first asking last July and springing a front- running six-and-a-quarter-length upset of the FSS My Dear Girl CLICK HERE for the latest in September before a failed attempt in the Breeders’ Cup Juvenile The Florida Horse ONLINE Fillies (G1).
Load more

Recommended publications
  • Sweet Melania Headlines Friday's Lake George Stakes
    ftboa.com • Thursday • August 27, 2020 FEC/FTBOA PUBLICATION DEADLINE: The Florida-bred registration deadline is Aug 31 postmarked deadline. CLICK HERE FOR LINK. SELECT FORM IN THE RIGHT COLUMN In This Issue: Rainbow 6 Jackpot Pool at $450,000 Victory Kingdom Makes Debut Long Weekend to Stick with Familiar Distance Delgado Trying for Trainer Title Born to Rein Film Headed to Ocala Lies to Call Final Week at Del Mar TOBA to Host National Awards Virtually National Museum of Racing to Reopen Healthy McCarthy Back in the Irons Preakness to Join Breeders’ Cup Series Sweet Melania/JOE LABOZZETTA PHOTO Track Results & Entries Sweet Melania Headlines Florida Stallion Progeny List Florida Breeders’ List Friday’s Lake George Stakes Wire to Wire Business Place Florida-breds Sugar Fix, American Giant, Miss Pepina Also Set Featured Advertisers BY RYAN MARTIN, layoff while registering a career-best 87 NYRA PRESS OFFICE______________ Beyer Speed Figure. Florida Department of Agriculture The American Pharoah chestnut began SARATOGA SPRINGS, NY—Robert and her career on the main track but made her FTBOA Lawana Low's Sweet Melania will attempt third career start a winning one when Ocala Breeders’ Feed & Supply to keep her consistent record intact when debuting on grass over the Spa's inner turf she headlines Friday's 25th running of the last July. Sweet Melania followed up with Seminole Feed $100,000 Lake George Stakes (Grade 3) a runner-up effort in the P.G. Johnson for 3-year-old fillies going one mile over Stakes at Saratoga before a victory in the the inner turf while three Florida-breds Grade 2 Jessamine at Keeneland.
    [Show full text]
  • Thoroughbred Aftercare Alliance Magazine 2020
    THOROUGHBRED AFTERCARE ALLIANCE MAGAZINE 2020 Inside: Get involved in the OTTB community Volunteer: Make a difference for yourself & others PUBLISHED BY Find a TAA-accredited organization Starlight and StarLadies Racing would like to thank New Vocations for turning the following Starlight/StarLadies alumni into wonderful riding horses Caribbean Kid Light Off Salmanazar Coach Vinny Masterofintention Sam P Dark Pool Mo Stealthy Skitz Drunk Logic Monopolist Tierra Verde Harlan’s Station Recur Tilt Lawn Man Rune Vinny White Shoes Starlight Racing’s 2007 Kentucky Derby starter, Sam P. Vinny White Shoes in his new vocation is excelling in his second career with new owner, as a 4H Club horse Laura Vorwerk Skitz Starlight Racing starlightracing.com StarLadies Racing starladiesracing.com Contact: Donna Barton Brothers at [email protected] for more information about the partnerships EXECUTIVE COMMITTEE Mike Meuser, President John Phillips, Past President Craig Bandoroff, Vice President Walter S. Robertson, Secretary Jen Shah, Treasurer Stacie Clark Rogers, Operations Consultant BOARD OF DIRECTORS Craig Bandoroff, Jeff Bloom, Simon Bray, Boyd Browning, Donna Barton Brothers, Case Clay, Dora Delgado, Michael Ernst, Sue Finley, Jim Gagliano, Brian Graves, Susie Hart, John Keitt, CONTENTS Chip McGaughey, Mike Meuser, David O’Farrell, Martin Panza, John Phillips, Walter BARBARA D. LIVINGSTON S. Robertson, Josh Rubinstein, Rick Schosberg, Yvonne Schwabe, Jen Shah, Welcome Tom Ventura, Nicole Walker TAA President Mike Meuser says the organization’s mission is about doing it right. Page 4 TAA MAGAZINE PRODUCTION Get involved with your off-the-track horse Erin Shea There are numerous competitive and non-competitive activities available for adoptees. Page 6 821 Corporate Dr.
    [Show full text]
  • Del Mar Stakes Schedule
    DEL MAR STAKES SCHEDULE Date Race Grade Purse Restrictions Surface Distance Wednesday, Jul 19 Oceanside Stakes $100,000 3YO Turf 1 Mile Friday, Jul 21 Osunitas Stakes $75,000 F&M, 3&UP Turf 1 1/16 Miles Saturday, Jul 22 San Diego Handicap Gr. II $300,000 3&UP Dirt 1 1/16 Miles Saturday, Jul 22 Eddie Read Stakes Gr. II $250,000 3&UP Turf 1 1/8 Miles Sun. Jul. 23 San Clemente Handicap Gr. II $200,000 F3YO Turf 1 Mile Sun. Jul. 23 Wickerr Stakes $75,000 3&UP Turf 1 Mile Wed. Jul. 26 Cougar II Handicap Gr. III $100,000 3&UP Dirt 1 1/2 Miles Fri. Jul. 28 Real Good Deal Stakes $150,000 3YO Dirt 7 Furlongs Sat. Jul. 29 Bing Crosby Stakes Gr. I $300,000 3&UP Dirt 6 Furlongs Sat. Jul. 29 California Dreamin’ Stakes $150,000 3&UP Turf 1 1/16 Miles Sun. Jul. 30 Clement L. Hirsch Stakes Gr. I $300,000 F&M, 3&UP Dirt 1 1/16 Miles Sun. Jul. 30 Fleet Treat Stakes $150,000 F3YO Dirt 7 Furlongs Wed. Aug. 2 CTBA Stakes $100,000 F2YO Dirt 5 1/2 Furlongs Fri. Aug. 4 Daisycutter Handicap $75,000 F&M, 3&UP Turf 5 Furlongs Sat. Aug. 5 Sorrento Stakes Gr. II $200,000 F2YO Dirt 6 1/2 Furlongs Sat. Aug. 5 Yellow Ribbon Handicap Gr. II $200,000 F&M, 3&UP Turf 1 1/16 Miles Sun. Aug. 6 La Jolla Handicap Gr. III $150,000 3YO Turf 1 1/16 Miles Sunday, Aug 6 Graduation Stakes $100,000 2YO Dirt 5 1/2 Furlongs Friday, Aug 11 Solana Beach Stakes $150,000 F&M, 3&UP Turf 1 1/16 Miles Saturday, Aug 12 Best Pal Stakes Gr.
    [Show full text]
  • 2020 Mixed Sale Thursday, October 15 2:30 P.M
    Ohio Thoroughbred Breeders & Owners 2020 Mixed Sale Thursday, October 15 2:30 p.m. Edge Of Night Photo Credit – JJ Zamaicko Photo Credit – Dustin Livesay Mobil Lady Photo Credit – JJ Zamaicko Happy As You Go Delaware County Fairgrounds Delaware, Ohio 1 2 On the cover – Featured are three stakes winners that were offered through three consecutive years of the Ohio Mixed Sale. Edge of Night (top) captured the $75,000 Emerald Necklace Stakes and $75,000 Glacial Princess as a 2-year-old. This season she finished second by a nose in the $75,000 Cincinnatian Stakes on the turf. She has career earnings of $174,390 Edge of Night is owned by Mast Thoroughbreds LLC and trained by Robert Gorham. A daughter of Added Edge out of Cargo Jet by Discreet Cat bred by Steve DeMaiolo. Happy as You Go captured the recent $75,000 Loyalty Stakes for 2-year- olds. After a troubled debut she has won her last two outings and has current earnings of $61,716. Happy as You Go is owned by Marion Gorham and is trained by Robert Gorham. She is a daughter of Mobil out of Preservation Hall by Dixieland Band bred by Mapleton Thoroughbred Farm. Mobil Lady won the $75,000 Glacial Princess Stakes during her first sea- son of racing. She has since placed in the grassy $75,000 Cincinnatian and the $75,000 Ohio Debutant Stakes. Mobil Lady has career earnings of $137,145. Mobil Lady is owned by Shane Meyers and Lori Acree and is trained by Shane Meyers.
    [Show full text]
  • Table of Contents Meet-At-A-Glance
    Santa Anita Park 2017 Spring Media Guide Table of Contents Meet-At-A-Glance . 2 The Gold Cup at Santa Anita . 28-29 Information Resources . 3 Honeymoon Stakes . 30-31 Santa Anita Spring Attendance and Handle . 4 Kona Gold Stakes . 31 Santa Anita Spring Opening Day Statistics . 4 Landaluce Stakes . 32-33 Michael Wrona Biography . 4 Lazaro Barrera Stakes . 33 Santa Anita Spring Meet Attendance . 5 Lennyfrommalibu Stakes . 33 Santa Anita Spring 2016 Meet Handle, Payoffs & Top Five Days . 5 Los Angeles Stakes . 34-35 Santa Anita Spring Meet Annual Media Poll . 6 Melair Stakes . 36 Santa Anita Track Records . 7 Monrovia Stakes . 36 Leaders at Previous Santa Anita Spring Meets . 8 Precisionist Stakes . 37-38 Santa Anita 2016 Spring Meet Standings . 9 San Carlos Stakes . 38-39 Roster of Santa Anita Jockeys . 10 San Juan Capistrano Stakes . 40-41 Roster of Santa Anita Trainers . 11 Santa Anita Juvenile . 42-43 2016 Santa Anita Spring Meet Stakes Winners . 12 Santa Barbara Stakes . 44-45 2016 Santa Anita Spring Meet Longest Priced Stakes Winners . 12 Senorita Stakes . 46 Stakes Histories . 13 Shoemaker Mile . 47-48 Adoration Stakes . 14-15 Snow Chief Stakes . 49 Affirmed Stakes . 15 Summertime Oaks . 50-51 American Stakes . 16-17 Thor's Echo Stakes . 51 Beholder Mile . 18-19 Thunder Road Stakes . 51 Californian Stakes . 20-21 Wilshire Stakes . 52 Charles Whittingham Stakes . 22 Satellite Wagering Directory . 53 Crystal Water Stakes . 23 Los Angeles Turf Inc . Club Officers/Administration . 54-55 Daytona Stakes . 23 Visitors Guide/Map of Los Angeles Freeways . 56 Desert Stormer Stakes . 24 Local Hotels and Restaurants .
    [Show full text]
  • Graydar Oxbow
    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
    [Show full text]
  • 2019 Media Guide July 17 - Sept 2 & Nov 8 - Dec 1
    2019 MEDIA GUIDE JULY 17 - SEPT 2 & NOV 8 - DEC 1 2019 Media Guide 1 Del Mar Stakes Schedule – 80th Summer Season – 2019 Date Event Conditions Distance Purse Wed. Jul 17 OCEANSIDE STAKES Three-year-olds, N/W S/S of $50,000 at 1 M o/o 1 Mile (Turf) $100,000 A in 2019 Thu. Jul 18 FLEET TREAT STAKES Fillies, Three-year-olds, Cal-Bred 7 Furlongs $150,000 G Fri. Jul 19 Osunitas Stakes Fillies & Mares, Three-year-olds & up, N/W S/S 1 1/16 Miles (Turf) $85,000 A $50,000 at 1 M o/o since September 1 Sat. Jul 20 SAN DIEGO HANDICAP (Gr. II) Three-year-olds & up 1 1/16 Miles $200,000 G Sat. Jul 20 SAN CLEMENTE STAKES (Gr. II) Fillies, Three-year-olds 1 Mile (Turf) $200,000 G Sat. Jul 20 Daisycutter Handicap Fillies & Mares, Three-year-olds & up 5 Furlongs (Turf) $85,000 A Sun. Jul 21 EDDIE READ STAKES (Gr. II) Three-year-olds & up 1 1/8 Miles (Turf) $250,000 G Sun. Jul 21 Wickerr Stakes Three-year-olds & up, N/W S/S $50,000 at 1 M 1 Mile (Turf) $85,000 A o/o since September 1 Wed. Jul 24 COUGAR II HANDICAP (Gr. III) Three-year-olds & up 1 1/2 Miles $100,000 G Fri. Jul 26 CALIFORNIA DREAMIN' STAKES Three-year-olds & up, Cal-Bred 1 1/16 Miles (Turf) $150,000 G Sat. Jul 27 REAL GOOD DEAL STAKES Three-year-olds, Cal-Bred 7 Furlongs $150,000 G Sat.
    [Show full text]
  • CHESTNUT COLT Barn 31 Hip No
    Consigned by Claiborne Farm, Agent Barn Hip No. 31 CHESTNUT COLT 845 Foaled April 25, 2006 Storm Bird Storm Cat ......................... Terlingua Forestry ............................ Pleasant Colony Shared Interest.................. Surgery CHESTNUT COLT Mr. Prospector Forty Niner........................ File Tour .................................. (1990) Full Pocket Fun Flight ......................... Fun and Tears By FORESTRY (1996). Stakes winner of $591,225, King's Bishop S. [G1], etc. Sire of 5 crops of racing age, 403 foals, 208 starters, 27 stakes winners, 139 winners of 327 races and earning $11,442,572 & $130,795(CAN) in N.A., including Smokey Glacken ($656,960, Distaff Breeders' Cup H. [G2] (AQU, $94,800), etc.), Diplomat Lady ($552,784, Hollywood Starlet S. [G1] (HOL, $273,600), etc.), Old Forester [G3] ($451,080 & $13,848 (CAN)), Forest Danger ($423,000, Carter H. [G1] (AQU, $210,000), etc.). 1st dam TOUR, by Forty Niner. 5 wins, 2 to 4, $254,939, Curious Clover H. [L] (HOL, $29,100), 2nd Bold Jill H. [L] (SA, $10,000), CERF H. [L] (HOL, $10,000), Very Subtle H.-R (HOL, $11,000), Frosty Shades H. (GG, $6,000), etc. Sister to FLIGHT FORTY NINE. Dam of 8 other registered foals, 8 of rac- ing age, including a 2-year-old of 2007, 6 to race, 4 winners-- TRIP (f. by Lord At War (ARG)). 11 wins, 3 to 5, $888,773, Turfway Breed- ers' Cup S. [G3], Turfway Breeders’ Cup S. [G3] (TP, $125,500), Chi- cago Breeders' Cup H. [G3], Bourbonette Breeders' Cup S. [L] (TP, $93,600), Iowa Oaks [L] (PRM, $90,000), Fairway Fun S. [L] (TP, $31,- 300), 2nd Delaware Oaks [G3], Regret S.
    [Show full text]
  • ETCHED Chestnut Horse, 2005; 16.3 Hands DIPLOMAT LADY: 4 Wins, $552,784, Hollywood Starlet S-G1, Beaumont­ S-G2, Etc
    ETCHED Chestnut Horse, 2005; 16.3 Hands DIPLOMAT LADY: 4 wins, $552,784, Hollywood Starlet S-G1, Beaumont S-G2, etc. Storm Bird Northern Dancer FOREST DANGER: 5 wins, $423,000 in 8 starts, Carter H-G1, etc. Sire. South Ocean Storm Cat QUIZ KID: 6 wins, $200,701 to 5, 2016 in Argentina, Gran Premio Estrellas Clas- Terlingua Secretariat sic-G1, Premio Pr Progreso-G3 twice, etc. Forestry Crimson Saint FANTASTIC FOUR: 5 wins, $168,289 to 4, 2016 in Argentina, Gran Premio Joaquin Bay, 1996 His Majesty V. Gonzalez-G1, Premio 25 De Mayo De 1810-G2, etc. Pleasant Colony Sun Colony Shared Interest SMOKEY GLACKEN: 10 wins, $656,960, Distaff Breeders’ Cup H-G2, etc. Dr. Fager Surgery Bold Sequence HOMERUN BERTI: 22 wins, $496,397 to 10, 2016, Lea County Sprint S, etc. OLD FORESTER: 6 wins, $462,632, Cliff Hanger S-G3, Canadian Turf H, Santa Unbridled Fappiano Claus S, etc. Set ncr at Gulfstream Park. Sire. Unbridled’s Song Gana Facil Trolley Song Caro (Ire) Unbridled Elaine Lucky Spell FEMALE LINE Gray or Roan, 1998 In Reality UNBRIDLED ELAINE. 6 wins at 2 and 3, $1,770,740, Breeders’ Cup Distaff Taylor’s Falls Nilene Wonder Carols Folly S-G1, Monmouth Breeders’ Cup Oaks-G2, Iowa Oaks, Pocahontas S, No Trespassing Bob’s Dusty Private Parking 2nd Pennsylvania Derby-G3, etc. Dam of 8 foals, 4 to race, 3 winners— ETCHED (Forestry). Stakes winner. Dosage Profile: 4 11 7 0 0 OUT OF BOUNDS (Discreet Cat). 3 wins, 2 to 4, $177,673 in U.S., U.A.E.
    [Show full text]
  • WORK of ART Thoroughbreds a Lifelong Love for Artist Macpherson See Page 4
    FRIDAY, NOVEMBER 20, 2020 BLOODHORSE.COM/DAILY BENOIT PHOTO WORK OF ART Thoroughbreds a Lifelong Love for Artist MacPherson See page 4 IN THIS ISSUE 11 Woodbine Jockey Tests Positive for COVID-19 12 Casse Records 3,000th Victory 15 Churchill Downs Halts Turf Racing, Scraps Two Stakes BLOODHORSE DAILY Download the FREE smartphone app PAGE 1 OF 28 CONTENTS 4 Thoroughbreds a Lifelong Love for Artist MacPherson 8 Leading Sires of Weanlings by Average 9 Los Alamitos to Submit Joint Injection Plan to CHRB 11 Woodbine Jockey Tests Positive for COVID-19 12 Casse Records 3,000th Victory 14 Laurel Park to Close to Fans; Horsemen Still Welcome 15 Churchill Downs Halts Turf Racing, Scraps Two Stakes 16 Drafted Eyes Stateside Return After Dubai Success 20 British Government Pledges Aid to Racing Amid COVID-19 21 Group 1 Winner Sands of Mali to Stand at Ballyhane 22 O’Brien Brothers Join Racing League 23 Results & Entries RICK SAMUELS #PABred MSW Someday Jones PENNSYLVANIA The only place to breed & race! Up to 50% BREEDER AWARDS pabred.com #PABred A publication of The Jockey Club Information Systems, Inc. and TOBA Media Properties, Inc. ON THE COVER Editorial Director General Manager Red Flag wins the Bob Hope Stakes at Del Mar Evan Hammonds Scott Carling Visuals Director Managing Editor Anne M. Eberhardt Claire Crosby Bloodstock Editor Digital Designer Eric Mitchell Erin Morgan Assistant Editors Senior Web Producer Meredith Daugherty Christine Wittmer Molly Rollins Digital Content Coordinator Associate Editors Michelle Benson Byron King Copy Editor
    [Show full text]
  • The Triple Crown (1867-2019)
    The Triple Crown (1867-2019) Kentucky Derby Winner Preakness Stakes Winner Belmont Stakes Winner Horse of the Year Jockey Jockey Jockey Champion 3yo Trainer Trainer Trainer Year Owner Owner Owner 2019 Country House War of Will Sir Winston Bricks and Mortar Flavien Prat Tyler Gaffalione Joel Rosario Maximum Security Bill Mott Mark Casse Mark Casse Mrs. J.V. Shields Jr., E.J.M. McFadden Jr. & LNJ Foxwoods Gary Barber Tracy Farmer 2018 Justify Justify Justify Justify Mike Smith Mike Smith Mike Smith Justify Bob Baffert Bob Baffert Bob Baffert WinStar Farm LLC, China Horse Club, Starlight Racing & Head of Plains Partners LLC WinStar Farm LLC, China Horse Club, Starlight Racing & Head of Plains Partners LLC WinStar Farm LLC, China Horse Club, Starlight Racing & Head of Plains Partners LLC 2017 Always Dreaming Cloud Computing Tapwrit Gun Runner John Velazquez Javier Castellano Joel Ortiz West Coast Todd Pletcher Chad Brown Todd Pletcher MeB Racing, Brooklyn Boyz, Teresa Viola, St. Elias, Siena Farm & West Point Thoroughbreds Bridlewood Farm, Eclipse Thoroughbred Partners & Robert V. LaPenta Klaravich Stables Inc. & William H. Lawrence 2016 Nyquist Exaggerator Creator California Chrome Mario Gutierrez Kent Desormeaux Irad Ortiz Jr. Arrogate Doug O’Neill Keith Desormeaux Steve Asmussen Big Chief Racing, Head of Plains Partners, Rocker O Ranch, Keith Desormeaux Reddam Racing LLC (J. Paul Reddam) WinStar Farm LLC & Bobby Flay 2015 American Pharoah American Pharoah American Pharoah American Pharoah Victor Espinoza Victor Espinoza Victor Espinoza American Pharoah Bob Baffert Bob Baffert Bob Baffert Zayat Stables LLC (Ahmed Zayat) Zayat Stables LLC (Ahmed Zayat) Zayat Stables LLC (Ahmed Zayat) 2014 California Chrome California Chrome Tonalist California Chrome Victor Espinoza Victor Espinoza Joel Rosario California Chrome Art Sherman Art Sherman Christophe Clement Steve Coburn & Perry Martin Steve Coburn & Perry Martin Robert S.
    [Show full text]
  • Santa Anita Park Samstag, 13
    Santa Anita Park Samstag, 13. Februar 2021 Race 1 1 21:30 1200 m 61.000 Race 2 2 22:03 1300 m 63.000 Race 3 3 22:36 1600 m 35.000 Race 4 4 23:08 1200 m 22.000 Race 5 5 23:42 1300 m 84.500 Race 6 6 00:14 1100 m 39.000 Race 7 7 00:46 1800 m 63.000 Santa Monica Stakes 8 01:20 1400 m 200.000 Race 9 9 01:52 1600 m 84.500 13.02.2021 - Santa Anita Park ©2021 by Wettstar / LiveSports.at KG / Meeting ID: 225357 / ExtID: 201634 Seite 1 13.02.2021 - Santa Anita Park Rennen # 9 Seite 2 WANN STARTET IHR PFERD... Admirably 2 Burnin Turf 7 Goalie 9 Merneith 8 Rickey B 4 Alot Of Magic 1 Capper 3 Golden Image 6 Mind The Gap 9 Royal Seeker 4 Amuse 8 Captain Scotty 6 Golden Principal 8 Miss Stormy D 8 Satchel De Ritches 6 Annie Graham 1 Carmelita's Man 7 Hapi Hapi 7 Mount Pelliar 3 Scarto 9 Another Eddie 1 Chaos Theory 5 Hard Not To Love 8 Mr. Brownstone 7 Secret Keeper 8 Autumn Day 2 Clayton Delaney 7 Hematite 1 My Summer Dream 3 See Through It 6 Award Winner 9 Compellus 3 Heywoods Beach 9 Mystery Messenger 5 Single Me Out 6 Baby Gronk 4 Contagion 4 Highly Distorted 5 Oil Can Knight 6 Sparky Ville 5 Belleo's Music 1 Curry 2 Howbeit 6 One Fast Bro 7 Street Image 4 Biddy Duke 8 D K's Crown 4 I Will Not 2 Pharoah's Heart 8 Sugar Kisses 1 Big Clare 1 Encoder 9 Indian Peak 9 Premiumonsaturday 1 Sunshine Babe 1 Big Summer 1 Fair Maiden 8 Italiano 6 Promise Nothing 6 Supersonic Flyer 1 Black Storm 4 Fivestar Lynch 9 Kakistocracy 7 Proud Emma 8 Taishan 9 Bohemian Bourbon 8 Fratelli 6 King Theo 9 Qahira 8 The Black Album 5 Brace For Impact 2 Galarina 1 Labor Union 3 Restiany 9 Tizhotndusty 7 Broken Finger 3 Ghoul 5 Lincoln City 5 Restoring Dreams 4 Tropical Terror 7 WANN STARTET IHR JOCKEY / FAHRER..
    [Show full text]