GRAYDAR
OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years.
KRIS S. SAINT BALLADO UNBRIDLED’S SONG
2
Dear Breeder,
Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time.
The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring.
Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well.
And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
We are equally as excited about the opportunity to stand 2013 Preakness Stakes (G1) winner Oxbow. From the direct female JEQMP]SJIQIVKMRKWMVISJWMVIW8M^RS[3\FS[IRNS]IHETVSPM½GVEGIGEVIIVWLS[MRKFSXLFVMPPMERGIERHMVSRLSVWI[MPP8LMW son of leading sire Awesome Again won his maiden by 4 3⁄4 lengths at Churchill Downs and made an 11 1⁄2-length statement in the LeComte Stakes at Fair Grounds. Running 13 races in less than a calendar year, Oxbow is a “throwback to another era” according to the Blood-Horse’s Steve Haskin. He is clearly a stallion to be reckoned with in the near future.
2SVXLIVR%¾IIXERH*SVIWXV]FSXLIRNS]IHTVSHYGXMZI]IEVWEKEMRMREWXLI]GSRXMRYIXSTVSZIXSFIX[SSJXLIKVIEXIWX ZEPYIWEXWXYHSRERERRYEPFEWMW2SVXLIVR%¾IIXWLS[IHLMWGSRXMRYIHMRXIVREXMSREPETTIEP[MXLERI[+VEHI[MRRIVMR Baccelo, Sunshine Millions winner Teaks North (G1), and several high-priced progeny through the auction ring. Forestry has now sired over $40,000,000 in lifetime progeny earnings and an impressive yearling average of $157,798. He’s listed as one of Bill Oppenheim’s 14 veteran Value Sires under $15,000 in the Thoroughbred Daily News for 2013, and remains as Storm Cat’s only son to sire an American classic winner.
)WOIRHIVI]EXLIHSQMRERX[MRRIVSJXLI;SSH1IQSVMEP + LEHLMW½VWX]IEVPMRKWWIPPXLMWJEPPERHMX´WRSWXVIXGLXSWE] he’s off to a great start. Leading all freshman sires in Book One at Keeneland September with a $215,833 average, Eskendereya’s yearlings topped out at a $540,000 colt purchased by Stonestreet Stables. His yearling average of $127,755 (45 sold) was good for second highest among freshman sires in 2013. With great books on the way – including the dams of Beholder (G1) and Trinniberg (G1) – for this impeccably bred son of Giant’s Causeway, we have much to look forward to when his first two-year-olds hit the track in 2014.
Old Fashioned also made big headlines this year in the auction ring. With juveniles selling for $500,000 (My Meadowview), $340,000 (Simon Callaghan), and $300,000 (Steve Young), Old Fashioned built on his success from last year as the third leading freshman two-year-old sire in North America with an average of $104,658. His success has not been limited to the sales ring, with top runners like G2-placed Sweet Whiskey and stakes winner Hi Fashioned from his first crop of 2-year-olds in 2013. Old Fashioned presents a tremendous opportunity at an $8,000 stud fee.
Taylor Made Stallions also looks forward to seeing the first foals by 2-year-old graded stakes winner and Classic-placed ]IEVSPH%WXVSPSK][LSFVIHEKVIEXFSSOSJQEVIWMRLMW½VWXWIEWSREXWXYHMR&]XLIKVIEXWMVISJWMVIW%4-RH] Astrology is bred identically to Bernardini and is an exceptionally good-looking stallion.
Our goal is to provide breeders superior customer service and offer you assistance every step of the way. Thank you for your interest in our stallions, and should you ever have any questions, please feel free to give us a call at (859) 885-3345.
We truly appreciate your support.
Sincerely, Ben Taylor
3 100+ Stakes Winners • 47 Graded SWs • 17 Grade 1 Winners • 10 Millionaires
Emcee
Zensational Unrivaled Belle Cross Traffic
Will Take Charge Octave
Midshipman
Songandaprayer Unbridled Elaine
Graydar Magnificent Song 4 THE LEGACY CONTINUES
A sire of sires with such Grade 1-producing sons at stud as:
DUNKIRK 2013 Leading Freshman Sire in North America Sire of Grade 1 winner & top 2yo colt HAVANA
EVEN THE SCORE Sire of three-time Grade 1 winner DULLAHAN
FIRST DEFENCE Sire of 2013 Leading 3yo Filly CLOSE HATCHES Winner of the Mother Goose (G1) & Cotillion (G1)
ROCKPORT HARBOR Sire of 2013 Breeders’ Cup Juvenile Fillies (G1) winner 6-%%2832-%
Splendid Blended Political Force Thorn Song
First Defence Buddha Marylebone 5 Unbridled’s Song – Sweetest Smile, by Dehere 2009, Gray, Height: 16.3 hands
6 TWIN CREEKS RACING TAYLOR MADE Venture 7 Grayde 1 brilliance. After nearly matching Commentator’s record mile at Gulfstream, Graydar exploded to a 3-length win in the Donn H. (G1) in just his fourth lifetime start, posting fractions of 46 4⁄5, 1:10 2⁄5, 1:35 1⁄5 before Grayde 1 class. ½RMWLMRKMR1⁄5 to earn a Graydar defeated 4 Grade 1 109 Beyer. winners in the Donn. He added to that tally in his next start, taking his game on the road and showing his versatility with an off-the-pace victory in the New Orleans H. (G2).
-X´WI\XVIQIP]VEVIJSVELSVWIMRLMWJSYVXLPMJIXMQIWXEVXXS[MRE+VEHI EKEMRWXWIEWSRIHLSVWIW-X´WEVIEPXVMFYXIXSXLILSVWI 8 – Todd Pletcher EXPLOSIVE GRADE 1 WINNER BY UNBRIDLED’S SONG
Undefeated & Dynamic Grade 1 Winner of 2013 by Legendary Sire Unbridled’s Song
Perfect against many of the best older horses in North America in 2013, including wins in the $500,000 Donn H. (G1), $400,000 2I[3VPIERW, + ERH/IPWS-RZ, +
2IEV¾E[PIWWGEVIIVVIGSVH[MXLEREZIVEKI[MRRMRKQEVKMRSJ over 4 lengths, and earnings of $841,560
&VSOILMWQEMHIR½VWXXMQISYXF]1⁄2 lengths in one of the most impressive maiden special weight heats of the Gulfstream Park meet, earning a 100 Beyer
Ran a mile in 1:33.72 winning a Gulfstream allowance race – just 1/100th off multiple G1 winner Commentator’s track record
Bred by William Farish, Eclipse-winning breeder, out of a three-time stakes producer by leading broodmare sire Dehere
Free of all the major sire lines that are proven crosses to 9RFVMHPIH´W7SRKMRGPYHMRK-26)%0-8=(%2>-+4904-8 %4-2(=&097,-2++633178361'%8IXG
8LIGPSWIWXXLMRK-´ZIWIIRXS9RFVMHPIH´W7SRK Grayde 1 His combination of looks, class, and sheer consistency. Graydar was brilliance reminds me of his sire – both on and undefeated in 2013 while racing off the racetrack. exclusively in Graded stakes company, including a gate-to-wire win in the Kelso – Duncan Taylor -RZMXEXMSREP, + EX&IPQSRXMR ¾EX[LMPIGEVV]MRKXST[IMKLX
Grayde 1 physical. Arguably the closest match to top sire Unbridled’s Song by style, presence, and physical stature, Graydar has long turned heads SRERHSJJXLIVEGIXVEGO,MW½VWX four dams are all multiple stakes winners or multiple stakes producers.
Unbridled’s Song – Sweetest Smile, by Dehere view full pedigree on pg. 39 9 Awesome Again – Tizamazing, by Cee’s Tizzy 2010, Bay, Height: 16 hands
stallion standing at 10 Taylor Made Stallions 11 This is a serious horse... he has such an efficiency of action... On top of his great pedigree, Oxbow has the most important trait a stallion needs, and that’s his natural speed and ability to carry it. – D. Wayne Lukas Oxbow was the only 3YO of 2013 XS½RMWLWXSVRHMRQYPXMTPI Triple Crown races. He won the Preakness S. (G1) before a valiant runner-up performance in the Belmont S. (G1) just three weeks later. After breaking his maiden at two, Oxbow competed in nine straight graded stakes – including six Grade 1s – at seven different racetracks, in seven different states, and six different distances.
12 AWESOME AGAIN’S ONLY CLASSIC WINNER
-QTVIWWMZI[MRRIVSJXLIQMPPMSR4VIEORIWW7 + ¯ the most formful Triple Crown race won by eleven 3YO Champions since 2000
106 Beyer winning the Preakness S. (G1) wire-to-wire – the highest Beyer of any Triple Crown race in 2013
Millionaire broke his maiden by 4 3⁄4 lengths as a 2yo, won LeComte S. (G3) by 11 ½ lengths in 3yo debut to become a leading KY Derby contender
Runner-up in the Belmont S. (G1) after attending the fastest pace since Secretariat’s race in 1973
Soundly defeated G1 winners Orb, Will Take Charge, Goldencents, etc.
&]7MVISJ7MVIW%;)731)%+%-2SYXSJEJYPPWMWXIVXS IQIVKMRK7MVISJ7MVIW8->23;¯FSXL&VIIHIVW´'YT'PEWWMG winners
Oxbow hails as the only “Oxbow is a throwback American Classic winner to another era, when and most accomplished 3YO of all horses were raced hard time by his emerging sire of sires and often, regardless of Awesome Again. the track, surface, and distance.” – Steve Haskin
Oxbow is a special horse. He has the speed of a sprinter, stamina of a classic winner, and the heart of a champion. – Gary Stevens Awesome Again – Tizamazing, by Cee’s Tizzy view full pedigree on pg. 41 13 14 %4-RH]¯5YMIX)GPMTWIF]5YMIX%QIVMGER 2008, Bay, Height: 16.3 hands
A / Bolton Stallion standing at TAYLOR MADE STALLIONS 15 A family of stars. An attractive son of Horse SJXLI=IEV%4-RH]ERHE half-brother to 3 stakes winners, Proven sire power. including multiple GSW 2yo &]7MVISJ7MVIW%4-RH]SYXSJER LUNARPAL. EGGSQTPMWLIH5YMIX%QIVMGERQEVI ¯-HIRXMGEPGVSWWEWQER]SJ%4-RH]´W top horses including leading sire &)62%6(-2-
8LI%4-RH]QEPIPMRI[SRFSXLGPEWWMGW /](IVF]ERH Oaks) ...the glittering hallmark of quality that has made the %4-RH]QEPIPMRIXLITVIIQMRIRXWSYVGISJGPEWWMGEFMPMX]MR North America. 16 – Frank Mitchell A.P. INDY’S ONLY GSW 2YO & CLASSIC-PLACED 3YO AT STUD
Broke his maiden impressively at Saratoga at two, defeating G1 winners To Honor and Serve and Data Link
Drew off by 2 3⁄4PIRKXLWMRXLI-VSUYSMW7 + ERHVER second by half-length in the KY Jockey Club S. (G2) at two
Runner-up in the Jerome S. (G2) and Sunland Derby (G3) MRLMW½VWXX[SWXEVXWEXXLVIIFIJSVIEWXVSRKSRXLIFSEVH ½RMWLMRXLI4VIEORIWW7 +
Won or placed in 9 of 12 lifetime starts with earnings of $516,977
7XIPPEV½VWX]IEVWYTTSVXF]WYGLXSTFVIIHIVWEW7XSRIWXVIIX Farm, George Bolton, Whisper Hill Farm, Town & Country Farm, Castleton Lyons, Hurricane Hills, Machmer Hall, etc.
Two words came to my mind [LIR-WE[%WXVSPSK]ERHLMW price – no brainer. – Carrie Brogden, Machmer Hall
Classic quality as a 3yo. Beaten just 1 3⁄4 lengths to G1 millionaires Shackleford & Animal Kingdom in the sire- making Preakness S. (G1).
Rare 2yo brilliance for an A.P. Indy. A fast Saratoga maiden special weight winner and open-lengths ZMGXSVSJXLI-VSUYSMW7 + EX Churchill as a 2-year-old.
A.P. Indy – Quiet Eclipse, by Quiet American view full pedigree on pg. 38 17 18 Giant’s Causeway – Aldebaran Light, by Seattle Slew 2007, Ch, Height: 16.2 hands
A Stallion standing at TAYLOR MADE STALLIONS 19 THE MOST DOMINANT 3YO OF HIS GENERATION
Runaway winner of the Wood Memorial (G1) and Fountain of Youth S. (G2) in back-to-back starts to become the decisive early favorite for the Kentucky Derby (G1)
Posted 106 & 109 Beyers back-to-back and 2 ¾ Ragozin numbers back-to-back — No 3-year-old this decade has been faster in consecutive starts around two turns on dirt
The No. 2 Leading Freshman Sire in North America in 2013 by Yearling Average and Median
$129,659 Avg. & $100,000 Median from 47 sold, incl. yearlings of $540,000, $370,000, $340,000, $240,000, etc.
Buyers of first yearlings include such top horsemen as 1EVO'EWWI&IR+PEWW+ISVKI-WEEGW8SQ1G+VIIZ] John Moynihan, Todd Pletcher, Jack Wolf, Steve Young, etc.
Legendary classic bloodlines. By leading sire of sires Giant’s Causeway, Eskendereya possesses four strains of the foundation mare Almahmoud. He Dominant on hails from the family of Halo, and the racetrack. LMW½VWXXLVIIHEQWMVIWEVI Undefeated on dirt, winning Seattle Slew, Alydar, and four starts by a combined 26 3⁄4 lengths Northern Dancer. including a 9 1⁄2-length romp in the Wood Memorial (G1) and 8 1⁄2-length romp in the Fountain of Youth S. (G2).
He towers above the others in dominance and speed figures, and his negative 3 1⁄2 on Thoro-Graph puts him well above everyone else. 20 – Steve Haskin The best yearling on my farm was by Eskendereya. That’s [L]-FVIHXLIHEQSJ&ILSPHIVXSLMQXLMW]IEV – Fred Mitchell, Clarkland Farm
First yearlings “ H e w a s showed dominance in probably one of the the marketplace. ½ZIFIWXPSSOMRKLSVWIW The Leading Freshman Sire with that were out there on the a Book One Yearling Average of ½VWXHE])WOIRHIVI]E[EW $215,833 at Keeneland September, one of the best 3-year-olds including a $540,000 colt out there the last 15 years.” purchased by Stonestreet Stables. – Steve Young, buyer of a $370,000 colt on Day1 at KEESEP TDN 9/11/13
Giant’s Causeway – Aldebaran Light, by Seattle Slew view full pedigree on pg. 38 21 22 Unbridled’s Song – Collect Call, by Meadowlake 2006, Gray or Roan, Height: 16.1 hands
FOX HILL TAYLOR MADE Venture 23 Fashioned for TVS½XEFMPMX] -R3PH*EWLMSRIHWMVIH the highest-priced yearling by a ½VWX]IEVWXEPPMSREXERH Fashioned JSPPS[IHYTMR[MXLLMW½VWX for speed. One of the 2-year-olds averaging $104,658, fastest 2yos in recent memory including a $500,000 colt and according to Thor-Graph’s Jerry ½PP] Brown. Old Fashioned sired brilliance MRLMW½VWXGVSTSJ]SW[LMGLMRGPYHIH Sweet Whiskey, impressive debut winner just 3/5ths off Saratoga’s track record.
Clearly, they look and act the part. – Bill Oppenheim 24 SR3PH*EWLMSRIH´W½VWXVYRRIVW8(2 FASHIONED FOR SPEED, PROFITABILITY & SUCCESS
Dominant & Undefeated Grade 2-Winning Juvenile by Unbridled’s Song
;SR ½VWX JSYV WXEVXW F] GSQFMRIH PIRKXLWMRGPYHMRK XLI sire-making Remsen (G2) by 7 1⁄4 lengths to become an Eclipse Finalist
The first freshman to sire a TDN Rising Star when his G2-placed 2yo filly Sweet Whiskey debuted with an eye-catching 5 1⁄4-length maiden special weight win at Saratoga
A Top 3 Freshman Sire in KY by Stakes Horses, led by $100,000 SW Hi Fashioned and $200,000 Matron (G2) runner-up Sweet Whiskey
First 2-year-olds in 2013 sold for $500,000, $340,000, $300,000, $190,000, $160,000, etc.
Top Buyers of his progeny include: Lael Stable, Jay Em Ess, Fox Hill, Sagamore Farm, Steven Young, K.K. Eishindo, Nick de Meric, Ken McPeek, Simon Callaghan, etc.
-R VIGIRX ]IEVW [I LEZI WIIR some fast (two-year-olds), but nothing like this.
- Jerry Brown, Thoro-Graph “He was the total package and had both speed and stamina. He was the real deal.”
Fashioned for -Trainer Larry Jones success. An undefeated G2-winning juvenile, 3PH*EWLMSRIH´W½VWX]SWEPWS IRNS]IHIEVP]WYGGIWWSRXLIXVEGO-R 2013, he achieved 100% maiden special weight winners except for his 2yo GSPX,-*%7,-32)([LSFVSOI his maiden in the $100,000 Barretts Juvenile S. Unbridled’s Song – Collect Call, by Meadowlake view full pedigree on pg. 40 25 26 Afleet – Nuryette, by Nureyev 1993, Bay, Height: 15.3 hands
A Taylor Made / WinStar Venture 27 AMAZOMBIE Breeders’ Cup Winner & Eclipse Champion Sprinter
The model International of consistency. From prowess. Aside a Classic-winning 3yo colt, to from his domestic success, ER3EOW[MRRMRK]S½PP]*VSQE 2SVXLIVR%¾IIXLEWQEHIEREQI multiple G1-winning marathoner on internationally by siring such top turf, to multiple Sprint champions on performers as Canadian Champion HMVX2SVXLIVR%¾IIXLEWGSRWMWXIRXP] =IEV3PH*MPP]2)+0-+)) + TVSHYGIHXST¾MKLXVEGILSVWIWSJ and UAE Champion Sprinter all surfaces and distances. &-+'-8=1%2 + -RLI added his 10th G1 winner with BACCELO (Brz) in Brazil.
Champion caliber horses. 2SVXLIVR%¾IIX has routinely had horses in the GLEQTMSRWGSRZIVWEXMSR-RXLIPEWX ½ZI]IEVWLI´WWMVIHXLVIIGLEQTMSRW PIHF])GPMTWI7TVMRXIV%1%>31&-) (G1), and he’s sired a total of six GLEQTMSR½REPMWXWMRXLITEWX eight years.
28 PROVEN VALUE 2013 on the track: 24 Stakes Horses worldwide, incl. new G1 SW BACCELO (Brz), Sunshine Millions victor TEAKS NORTH 7EVEXSKE7;:-836-%30-14-'% &V^
2013 in the sales ring: Yearlings included $400,000 filly at Keeneland September purchased by Mandy Pope, $195,000 colt at F-T SAR purchased by Stonestreet Stables. 2YOs in Training MRGPYHIHWEPIXSTTMRK½PP]EX)%71%=
Lifetime: 62 Stakes Winners, 120 Stakes Horses, $48,700,000 in Progeny Earnings, and 10 G1 Winners worldwide, including QYPXMTPI+[MRRMRKQMPPMSREMVI):)2-2+.);)0 +
8ST0MJIXMQI7EPIW,SVWIWMRGPYHI2)+0-+)) + [LSWSPH for $1,250,000 and $625,000 in recent years
One of Bill Oppenheim’s 14 veteran Value Sires of 2013 under $15,000
F]'SQTEVEFPI-RHI\ '- MRERHJVSQEPPWXEPPMSRW standing for under $25,000
Exceptional career numbers. One of the rare stallions to sire a Breeders’ Cup winner and have a son sire a Breeders’ Cup winner, Northern %¾IIXLEW+[MRRIVWGLEQTMSRW and 5 millionaires to date, including 2013 Sunshine Millions “He’s a beautiful winner & multiple G1 winner colt, and Northern TEAKS NORTH. %¾IIXLEWTVSZIRXLI ability to get a racehorse at the highest level.”
- John Moynihan on a $195,000 colt he purchased for Stonestreet Stables '- MRGVIEWI [EW XLI XL LMKLIWX SJ EPP stallions... All indicators show the pipeline is loaded and we are already seeing the results in the sales ring. %¾IIX¯2YV]IXXIF]2YVI]IZ view full pedigree on pg. 40 - TBH MarketWatch 29 7XSVQ'EX¯7LEVIH-RXIVIWXF]4PIEWERX'SPSR] 1996, Bay, Height: 16.1 hands
30 Owners: Aaron and Marie Jones 31 S t o r m C a t ’s O n l y S o n t o S i re an American Classic Winner
Sire of 46 SWs & 15 Graded SWs lifetime, incl. the brilliant QYPXMTPI)GPMTWI½REPMWX7,%'/0)*36( [MRRIV of the Preakness S. (G1), Met Mile (G1), Clark H. (G1), etc.
84 Stakes Horses lifetime – an excellent 10% Stakes Horses from Foals
Over $41 million in Progeny Earnings – At least $4 million in Earnings 6 times in the past 7 years
Three new Stakes Winners in 2013, including Del Mar SW 7-63''3786-/) &IPQSRX7;;,-7/)=631)3
A superior Two-Year-Old Sire: 13 juvenile Stakes Winners & 31 juvenile Stakes Horses
His elite pedigree is also coming through as an important Broodmare Sire, with his daughters producing such recent G1 TIVJSVQIVW EW896&90)28 ()7')281%+-'%0 *))0-2+ etc.
Tremendous Storm Cat’s classic lifetime averages. sire. Forestry became the Forestry’s value is clear through his only son of legendary sire excellent career averages, both on the Storm Cat to sire an American track and in the sales ring. His runners Classic winner when the boast a $64,490 Avg. Earnings/Starter brilliant Shackleford defeated on the racetrack – more than eight Animal Kingdom in the times his current fee. Preakness S. (G1).
Emerging as a sire of sires. His young sons at stud include Discreet Cat, exciting sire of two G1 Winners in 2013, and Old Forester, Canada’s back-to-back leading Juvenile Sire and a former PIEHMRK½VWXGVSTWIGSRHGVST and third-crop sire.
32 SHACKLEFORD Brilliant Classic Winner at 3, Met Mile (G1) Winner at 4
Unmatched in the sales ring. The expert choice. -XMWYRJSYRHIHJSVEWXEPPMSRYRHIV Acclaimed by breeding $10,000 to perform like Forestry guru Bill Oppenheim as the has in the marketplace. His lifetime No. 1 value at stud, Forestry was sales numbers are impressive across again recognized by Oppenheim in 2013 the board, incl. a $247,468 2YO Avg, in the Thoroughbred Daily News as $154,442 Yearling Avg, & $116,203 Weanling Avg. one of the 14 veteran Value Sires under $15,000.
The #1 value at stud. &MPP3TTIRLIMQ8(2 Storm Cat – Shared Interest, by Pleasant Colony view full pedigree on pg. 39 33 THE HOTTEST SIRE IN TOWN
A leading General Sire again in 2013 – 22 SWs, 33 Stakes Wins, 4 G1 SWs, $10.9M worldwide
54 SWs, 21 GSWs, $44,900,000 from first 6 crops – more than any horse that’s come to stud in North America since 2005, incl. Tapit and Medaglia d’Oro
%GXMZI7MVI[SVPH[MHIF]%6YRRIV-RHI\JSV the past two years
A leading General Sire with 4 G1 winners in 2013, incl. $2 million Dubai Shaheen (G1) winner 6)=2%0(38,);->%6(ERH Saratoga G1 Winners (%2')83&6-7830 0-+,8,397)&%=
Sire of 49 Black Type Winners lifetime, ahead of Tapit (39) and Medaglia d’Oro (47) from his own sire crop, and more than any other stallion that’s entered stud in North America since 2005.
34 A Taylor Made / WinStar Venture THE BIG HORSE SIRE
Twelve Group/Grade 1 winners, including 2013 leading 2yo colt & Hopeful (G1) winner STRONG MANDATE
8[S WIZIR½KYVI ]IEVPMRKW EX /))7)4 ¯ $1,750,000 (1⁄2 to Speightstown), $1,700,000 (1⁄2 to Havre de Grace)
$400,172 Keeneland September Average
46 SWs, 26 Graded SWs, 86 stakes horses, 6 millionaires
Sire of a $1.75 million ½PP]MR– the 3rd highest yearling at Keeneland September. The half-sister to leading sire Speightstown was purchased by Siring “Big Horses” on Stud TNT’s Borges Torrealba. an annual basis, including top 2yo colt STRONG MANDATE in 2013. After breaking his maiden at Saratoga, he romped by 9 3⁄4 lengths in the Hopeful S. (G1).
A Taylor Made / WinStar Venture 35 ------TAYLOR MADE
------
“Taylor Made, in my opinion, are the best horse marketers in the industry. They leave no stone unturned to do the best job possible with even the most modest of stock. My dealings with Taylor Made have been easy and honest. They’ve absolutely earned their good reputation.” - Rick Porter, Fox Hill Farm
“We’ve been customers of Taylor Made for many years. Not only do they help us get the highest returns on our investments, but they also understand the importance of creating an enjoyable experience.” - John and Elizabeth Fort, Peachtree Stable
“Taylor Made utilizes all of their resources to market all our horses to truly maximize our investment.” - Fred Hertrich, Watercress Farm
36 ------World’s #1 Consignor 9 of the past 10 years! ------
Experience. Honesty. Results. Discover what Taylor Made can do for you!
TaylorMadeAdvantage.com 37 ASTROLOGY ESKENDEREYA Bay Horse; foaled 2008 Chestnut Horse; foaled 2007 Bold Reasoning Storm Bird Seattle Slew ...... Storm Cat ...... My Charmer Terlingua A.P. Indy...... Giant's Causeway...... Secretariat Rahy Weekend Surprise...... Mariah's Storm...... Lassie Dear Immense ASTROLOGY ESKENDEREYA Fappiano Bold Reasoning Quiet American ...... Seattle Slew ...... Demure My Charmer Quiet Eclipse...... Aldebaran Light ...... (1996) Hold Your Peace (1996) Alydar June Gift ...... Altair...... Lady Ridanilustros Stellar Odyssey By A.P. INDY (1989). Horse of the year, classic winner of $2,979,815, Belmont By GIANT'S CAUSEWAY (1997). European Horse of the year, black-type win- S. [G1], etc. Leading sire twice, sire of 18 crops of racing age, 1224 foals, ner of $3,078,989, Esat Digifone Irish Champion S. [G1], etc. Leading sire 921 starters, 142 black-type winners, 662 winners of 2097 races and 3 times, sire of 10 crops of racing age, 1961 foals, 1390 starters, 135 earning $123,664,548, 11 champions, including Mineshaft ($2,283,402, black-type winners, 877 winners of 2438 races and earning $107,542,- Jockey Club Gold Cup [G1] (BEL, $600,000), etc.), Rags to Riches ($1,- 929, 6 champions, including Shamardal [G1] (6 wins, $1,931,770), and of 342,528, Belmont S. [G1] (BEL, $600,000), etc.), Bernardini ($3,060,480, Aragorn (IRE) [G1] (6 wins, $1,529,325), Giant Oak [G1] ($1,484,829), Preakness S. [G1] (PIM, $600,000), etc.), Tempera [G1] (3 wins, $770,240). First Samurai [G1] ($915,075), Ghanaati [G1] ($720,406), Our Giant [G1]. 1st dam 1st dam QUIET ECLIPSE, by Quiet American. Winner at 4, $42,405. Dam of 5 winners-- ALDEBARAN LIGHT, by Seattle Slew. 3 wins in 5 starts at 3, $18,660. Dam of LUNARPAL (c. by Successful Appeal). 4 wins in 6 starts at 2, $284,677, 10 foals, 5 to race, 4 winners, including-- Bashford Manor S. [G3] (CD, $101,184), Kentucky Breeders' Cup S. ESKENDEREYA (c. by Giant's Causeway). Black-type winner, see record. [G3] (CD, $86,025), Three Chimneys Juvenile S. [L] (CD, $71,548). Sire. BALMONT (c. by Stravinsky). 4 wins at 2, £268,922, in England, Shadwell ASTROLOGY (c. by A.P. Indy). Black-type winner, see record. Stud Middle Park S. [G1], Scottish Equitable Gimcrack S. [G2],3rd LUNARLADY (f. by Yes It's True). 4 wins, 2 to 4, $93,069, Prairie Meadows Golden Jubilee S. [G1], Darley July Cup [G1], Betfair.com Temple S. Debutante S. (PRM, $24,000), 2nd Ada S. (RP, $10,000), 3rd Houston [G2]; placed in 1 start at 4, ¼14,250, in Ireland, 2nd Patrick P. O'Leary Chronicle S. (HOU, $4,950), Lakeway S. (RET, $4,950). Producer. Memorial Phoenix Sprint S. [G3]. (Total: $472,607). Sire. LUNARGAL (f. by Yes It's True). 2 wins at 2, $63,570, Serena's Song S. Godly (c. by Henny Hughes). Winner at 3, 2013, ¥11,400,000, in Japan. (ZIA, $25,200). Producer. (Total: $118,186). Lunarpeal (c. by Successful Appeal). 6 wins, 3 to 5, $103,566. 2nd dam 2nd dam ALTAIR, by Alydar. Unraced. Dam of 4 other foals to race, 3 winners, incl.-- JUNE GIFT, by Hold Your Peace. 5 wins at 2 and 3, $45,190. Dam of-- BLAZONRY (c. by Hennessy). Winner at 2, £5,616, in England; winner at Great Respect. 4 wins, 2 to 6, $105,576. Producer. 3, $96,720, in N.A./U.S., Lazaro Barrera Memorial S. [G2] (HOL, $90,- 3rd dam 000). (Total: $105,454). Sire. Lady Ridanilustros, by Illustrious. 4 wins, $50,420, 2nd Constitution S. Dam of-- Hippocrates (c. by Hennessy). Winner at 3, $50,038, 3rd Oceanside S.-R Ridan Prospector. 6 wins, 3 to 5, $73,135, 3rd First Lady H. [O]. Dam of-- (DMR, $10,314). SNOWBERG. 6 wins, $455,728, Fantastic Girl S.-R (DMR, $42,780), 2nd Lady Lyra. Dam of 2 foals to race, both winners, including-- Santa Maria H. [G1], A Gleam H. [G2], Bayakoa H. [G2], Rancho Ber- Enduring Star (g. by Sir Shackleton). Winner at 3, $77,493, in Canada, nardo H. [G3], Cascapedia S.-R (SA, $13,160), 3rd Santa Margarita 3rd Coronation Futurity-R (WO, $27,500); winner at 5, 2013, $46,876, Invitational H. [G1], Hollywood Starlet S. [G1], Santa Lucia H.-R (SA, in N.A./U.S. (Total: $126,206). $9,432), etc. Dam of BURG BERG (4 wins, $266,052, Swingtime S.-R 3rd dam (OTH, $34,920), 2nd Royal Heroine Mile S. [G2] (HOL, $30,000), etc.). STELLAR ODYSSEY, by Northern Dancer. Unraced. Sister to WASSL TOUCH BRILLIANT PROSPECT. 6 wins, 2 to 4, $85,975, Wide Country S. (LRL, (sire), Tridessus (sire), half-sister to CANNONADE ($501,164, Ken- $19,485). Dam of Get Down (3 wins, Total: $117,812, 3rd Plate Trial tucky Derby-G1, etc., sire), CIRCLE HOME ($122,984, Heritage S.-G3, S.-R (WO, $17,985)). etc., sire), DEL SARTO (sire). Sent to Japan. Dam of 2 winners, incl.-- Ride North. 6 wins at 3 and 4, $24,625, 3rd Arch Rival S. (CT, $1,643). Erimo Amethyst. 2 wins, ¥25,968,000, in Japan. (Total: $260,298). Dam of-- RACE RECORD: At 2, two wins (Iroquois S. [G3] (CD, $73,553)), once 2nd ERIMO MAXIM. 10 wins, 2 to 10, ¥274,344,000, in Japan, Cassiopeia (Kentucky Jockey Club S. [G2] (CD, $32,340)), twice 3rd (Garden State S. (Total: $2,543,482). S. [L] (MTH, $12,000)); at 3, twice 2nd (Jerome S. [G2] (AQU, $30,000), RACE RECORD: At 2, one win (Pilgrim S. [L] (BEL, $93,300)), once 2nd; at Sunland Derby [G3] (SUN, $176,000)), once 3rd (Preakness S. [G1] (PIM, 3, three wins (Wood Memorial S. [G1] (AQU, $450,000), Fasig-Tipton $110,000)); at 4, one win in 2 starts. Totals: 3 wins, 3 times 2nd, 3 times Fountain of Youth S. [G2] (GP, $150,000)) in 3 starts. Totals: 4 wins, once 3rd. Earned $516,977. 2nd in 6 starts. Earned $725,700.
38 FORESTRY GRAYDAR Bay Horse; foaled 1996 Gray or Roan Colt; foaled 2009 Northern Dancer Fappiano Storm Bird ...... Unbridled...... South Ocean Gana Facil Storm Cat ...... Unbridled's Song...... Secretariat Caro (IRE) Terlingua...... Trolley Song...... Crimson Saint Lucky Spell FORESTRY GRAYDAR His Majesty Deputy Minister Pleasant Colony...... Dehere ...... Sun Colony Sister Dot Shared Interest...... Sweetest Smile ...... (1988) Dr. Fager (1998) Conquistador Cielo Surgery...... Cielo Otono ...... Bold Sequence Moment's Prayer By STORM CAT (1983). Black-type winner of $570,610, Young America S. By UNBRIDLED'S SONG (1993). Black-type winner of $1,311,800, Breeders' [G1], etc. Leading sire twice, sire of 21 crops of racing age, 1452 foals, Cup Juvenile [G1], etc. Sire of 98 black-type winners, including champi- 1110 starters, 176 black-type winners, 809 winners of 2353 races and ons Midshipman ($1,584,600, Breeders' Cup Juvenile [G1] (OSA, $1,150,- earning $127,452,857, 8 champions, including Giant's Causeway ($3,- 200), etc.), Embur's Song ($616,926, Hendrie S. [G3] (WO, $120,000 078,989, Esat Digifone Irish Champion S. [G1], etc.), Storm Flag Flying (CAN)), etc.), and of Unrivaled Belle [G1] ($1,854,706), Will Take Charge ($1,951,828, Breeders' Cup Juvenile Fillies [G1] (AP, $520,000), etc.), [G1] ($1,827,371), Unbridled Elaine [G1] ($1,770,740), Zensational [G1]. Sweet Catomine [G1] (5 wins, $1,059,600), Aljabr [G1] (5 wins, $593,796). 1st dam 1st dam SWEETEST SMILE, by Dehere. Winner at 3, $13,370. Dam of 6 winners, incl.-- SHARED INTEREST, by Pleasant Colony. 10 wins, 3 to 5, $667,610, Ruffian GRAYDAR (c. by Unbridled's Song). Black-type winner, see record. H. [G1], First Flight H. [G2], Burlington County S. (MED, $24,000), 2nd Union Course (g. by Dixie Union). Winner at 2, 3, and 4, $124,314, 2nd Flash Beldame S. [G1], Shuvee H. [G1], Monmouth Oaks [G2], Chicago Bud- S. [G3] (BEL, $21,420), 3rd Saratoga Special S. [G2] (SAR, $15,000). weiser Breeders' Cup H. [G3], 3rd John A. Morris H. [G1], Top Flight H. Star of David (c. by Bernstein). 3 wins, 2 to 5, $67,879, in N.A./U.S., 3rd [G1], First Flight H. [G2]. Dam of 7 foals, 4 to race, all winners, incl.-- Iroquois S. [G3] (CD, $10,776); placed at 2, $42,589, in Canada, 3rd CASH RUN (f. by Seeking the Gold). 5 wins at 2 and 3, $924,201, Breeders' Summer S. [G3] (WO, $33,000). (Total: $107,377). Cup Juvenile Fillies [G1], Bonnie Miss S. [G2], Davona Dale S. [G2], 2nd dam 2nd Golden Rod S. [G3], 3rd Walmac International Alcibiades S. [G2], CIELO OTONO, by Conquistador Cielo. 3 wins at 2, $75,106, Debutante Princess S. [G2], Floral Park H. [L] (BEL, $11,847). Dam of-- Breeders' Cup S. [L] (BM, $36,550), etc. Dam of 4 other winners, incl.-- GREAT WAR EAGLE (c. by Storm Cat). Winner at 2, ¼80,050, in Ireland, Cielator (f. by Delineator). 5 wins in 10 starts at 4 and 5, 2013, $82,369, Irish Stallion Farms E.B.F. Star Appeal S., 2nd Aussie Rules E.B.F. Te- 2nd Pegasus Training Center S.-R (EMD, $9,460). trarch S. [G3], Ballycorus S. [G3]. (Total: $125,123). Cielo Dulce. 3 wins at 5, $80,335. Dam of 1 foals to race-- Step In Time. Winner at 2 and 3, £12,681, in England; 12 wins, 4 to 6, 2013 SWEET SAGA (f. by Slew's Saga). Winner at 2, placed at 4, 2013, $46,- in Saudi Arabia, horse of the year, champion miler, champion older horse. 491, Barbara Shinpoch S. (EMD, $24,750). Move Your Vision. 3 wins in Czech Republic; winner at 2 and 3 in Slovak 3rd dam Republic, champion imported 2-year-old colt; winner at 2 in Austria. MOMENT'S PRAYER, by For The Moment. 3 wins at 3 and 4, $39,564. Half- FORESTRY (c. by Storm Cat). Black-type winner, see record. sister to PRAYER LEADER, ZONIC, SILENT PRAYER. Dam of-- A. P. Interest (f. by A.P. Indy). Winner at 3, $29,970. Dam of 2 winners-- MIAMI SLICK. 7 wins to 4, $224,480, Broward H. [L] (CRC, $49,890), etc. GOLDEN SPIKES (c. by Seeking the Gold). 4 wins at 2 and 3, $390,750, CIELO OTONO. Black-type winner, above. Carry Back S. [G2] (CRC, $150,350), Unbridled S. [L] (CRC, $60,000), Another Moment. 4 wins at 3 and 4, $89,678, 3rd Skipat H. (RKM, $2,900). 2nd Illinois Derby [G2] (HAW, $98,000), Radar Love S. (CRC, $10,000). Bubbles Darlene. 2 wins at 3, $13,487. Dam of 5 winners, including-- AL MUHTASIB (c. by Distorted Humor). 6 wins at 3 and 4, $251,412, ELRAFA AH. 3 wins at 2 and 3, £53,863, in England, Bedford Lodge Buddy Diliberto Memorial H. (FG, $45,000). Hotel Bentinck S., Wharf Dragon S., etc. (Total: $82,936). Dam of-- 2nd dam MUJAHID. 3 wins at 2, $317,177, hwt. in Europe and England, Saudi SURGERY, by Dr. Fager. Winner at 4, $18,958. Half-sister to BORN TO LEAD Arabian Airlines Dewhurst S. [G1], 2nd James Seymour S., 3rd Sagitta (Scotch Foursome Fall Laddie S., etc., sire). Dam of 5 winners, incl.-- Two Thousand Guineas S. [G1], Weatherbys Earle of Sefton S. [G3]. Sire. SEWICKLEY (c. by Star de Naskra). 11 wins, 2 to 5, $1,017,517, Vosburgh Flambeau. Unraced. Dam of 9 foals, 8 winners, including-- S. [G1] twice, Fall Highweight H. [G2], Tom Fool S. [G2], etc. Sire. Fortuesque. 5 wins to 3, $116,915, 3rd Florida Stallion S.-R. Dam of-- Other black-type winners: SHARED INTEREST (f. by Pleasant Colony, MUSKET MAN. 6 wins, $1,236,820, Illinois Derby [G2], Tampa Bay above), LEFT COURT (f. by Valdez, 6 wins, $160,352). Derby [G3], Pasco S. (TAM, $30,000), Super S.(TAM, $30,000, etc. RACE RECORD: At 2, unraced; at 3, seven wins (King's Bishop S. [G1], Dwy- Flambe’. Winner at 2 and 3, 458,195. Dam of 4 winners, including-- er S. [G2], San Pedro S. [L] (SA, $49,140)), once 2nd, twice 3rd (Haskell RON THE GREEK. 9 wins to 6, 2013, $2,104,691, Santa Anita H. [G1] Invitational H. [G1]) in 11 starts. Earned $591,225. (SA, $450,000), etc.), Jockey Club Gold Cup [G1] (BEL, $600,000), etc. RACE RECORD: At 2, unraced; at 3, two wins, once 3rd in 3 starts; at 4, 2013, three wins (Donn H. [G1] (GP, $300,000), Kelso H. [G2] (BEL, $240,000), New Orleans H. [G2] (FG, $240,000)) in 3 starts. Totals: 5 wins, once 3rd in 6 starts. Earned $841,560. 39 NORTHERN AFLEET OLD FASHIONED Bay Horse; foaled 1993 Gray or Roan Horse; foaled 2006 Raise a Native Fappiano Mr. Prospector...... Unbridled...... Gold Digger Gana Facil Afleet...... Unbridled's Song...... Venetian Jester Caro (IRE) Polite Lady...... Trolley Song...... Friendly Ways Lucky Spell NORTHERN AFLEET OLD FASHIONED Northern Dancer Hold Your Peace Nureyev...... Meadowlake...... Special Suspicious Native Nuryette ...... Collect Call...... (1986) Tentam (1998) Alleged Stellarette...... Negative Pledge...... Square Angel Laredo Lass By AFLEET (1984). Horse of the year in Canada, black-type winner of $995,- By UNBRIDLED'S SONG (1993). Black-type winner of $1,311,800, Breeders' 235, Jerome H. [G1], etc. Among the leading sires, sire of 21 crops of rac- Cup Juvenile [G1], etc. Sire of 14 crops of racing age, 1456 foals, 1068 ing age, 1431 foals, 1280 starters, 66 black-type winners, 987 winners of starters, 98 black-type winners, 738 winners of 2135 races and earning 4203 races and earning $219,852,706, including champion A Fleets $89,084,186, including champions Midshipman ($1,584,600, Breeders' Dancer ($1,036,649, Durham Cup H. [G3], etc.), and of Blu Tusmani [G2] Cup Juvenile [G1] (OSA, $1,150,200), etc.), Embur's Song ($616,926, (hwt. in Italy), Twist Afleet ($659,240, Test S. [G1], etc.), Flat Fleet Feet Hendrie S. [G3] (WO, $120,000(CAN)), etc.), and of Zensational (5 wins, ($727,041, Delta Air Lines Top Flight H. [G1], etc.), Northern Afleet [G2]. $669,300, Bing Crosby S. [G1] (DMR, $180,000), etc.), Octave [G1]. 1st dam 1st dam NURYETTE, by Nureyev. Unraced. Dam of 9 foals, 8 to race, 7 winners, incl.-- COLLECT CALL, by Meadowlake. 3 wins at 2 and 3, $434,000, Santa Ysabel TAP TO MUSIC (f. by Pleasant Tap). 6 wins, 3 to 5, $1,052,526, Gazelle H. S. [G3], British Columbia Breeders' Cup Oaks [L] (HST, $105,000 [G1], Barbara Fritchie H. [G2], Delaware H. [G3], 2nd Delaware H. (CAN)), Lassie S. (HST, $18,000(CAN)), 2nd Fantasy S. [G2], Hollywood [G3], Sixty Sails H. [G3], Turnback the Alarm H. [G3], 3rd Molly Pitch- Oaks [G2], 3rd Kentucky Oaks [G1], Milady Breeders' Cup H. [G1] er Breeders' Cup [G2], Distaff Breeders' Cup H. [G2], Shuvee H. (HOL, $25,368), Vanity H. [G1] (HOL, $22,500), WTBA Lassies S. (EMD, [G2], Gardenia H. [G3]. Dam of 3 foals to race, all winners, incl.-- $8,235). Dam of 6 foals, 4 to race, 2 winners, including-- BEAR'S KID (c. by Lemon Drop Kid). 3 wins at 2 and 3, $285,623, in OLD FASHIONED (c. by Unbridled's Song). Black-type winner, see record. Canada, Summer S. [G2] (WO, $170,100), 3rd Labeeb S. [L] (WO, 2nd dam $11,000). (Total: $249,599). Sire. NEGATIVE PLEDGE, by Alleged. Unplaced in 2 starts in England. Dam of-- NORTHERN AFLEET (c. by Afleet). Black-type winner, see record. COLLECT CALL (f. by Meadowlake). Black-type winner, above. BOSS SOSS (c. by Sauce Boat). 6 wins, 2 to 5, $186,258, San Mateo 3rd dam Juvenile S. [L] (BM, $30,950), De Anza S. [L] (DMR, $30,637), etc. LAREDO LASS, by Bold Ruler. 4 wins at 2 and 3, $25,590. Sister to Island Cravatte Noire (f. by Black Tie Affair (IRE)). Winner at 2, ¼13,110, in France. Leader (sire), half-sister to PADLIN MADLIN [OR] ($72,203), Son Ex- (Total: $16,253). Dam of 7 foals, 6 to race, 5 winners, including-- cellence ($30,555, sire), Isle of Fortune. Dam of 5 winners, incl.-- HAMRIYA (c. by Alzao). 4 wins at 2 and 3, ¼79,050, in France, Prix Police- MITTERAND. 6 wins, $446,830, La Canada S. [G1], Railbird S.-G3, El Encino man, etc.; placed at 7 in Qatar, horse of the year. (Total: $96,926). S. [G3], La Brea S. [G3], 2nd Hollywood Oaks-G1, San-ta Margarita Invi- 2nd dam tational H. [G1], Molly Pitcher H. [G2], Hawthorne H. [G2], Princess S.- STELLARETTE, by Tentam. 7 wins, 3 to 5, $187,257, Barbara Fritchie H.-G3, G3, Terlingua S., [Q], 3rd Milady H. [G2], 4th Vanity H. [G1]. Dam of-- etc. Half-sister to KAMAR ($140,747, champion 3-year-old filly in Cana- FRENCH DEPUTY. 4 wins in 6 starts to 3, $195,200, Jerome H. [G2]. Sire. da), LOVE SMITTEN ($450,505, Apple Blossom H. [G1], etc.), DANC- PRINCESS MITTERAND. 3 wins to 3, $155,800, Santa Ysabel S.-R (SA, ING ON A CLOUD [L] ($208,542), Square Letters ($124,431). Dam of-- $44,925), 2nd Hollywood Starlet S. [G1], etc. Dam of OVER UNDER CUDDLES (f. by Mr. Prospector). 7 wins to 4, $582,996, Hollywood Starlet (3 wins, $122,824), French Envoy ($112,234, 3rd Jaipur H. [G3], sire). S. [G1], etc. Dam of KATZ ME IF YOU CAN [G2] (f. by Storm Cat, Mme. Mitterand. Unraced. Dam of French Madam (3 wins, $102,857, $410,947), COUNTRY ROMANCE [L] (f. by Saint Ballado, $157,230). 2nd Spirit of Fighter S. (CRC, $6,246), dam of Ginger Pop, $172,740, Augusta Springs (f. by Nijinsky II). 3 wins in 5 starts at 3, $55,600, 3rd Val- 2nd La Brea S. [G1] (SA, $50,000), Flawlessly S. [L] (HOL, $22,820)). ley View S. (KEE, $4,900). Dam of BUFFYTHECENTERFOLD (f. by Ca- Devil's Lass. Winner at 3, $9,800. Producer. Granddam of STORMIN' pote, 5 wins, $527,685, Sorrento S. [G2] (DMR, $90,000), etc.). LYON [L] (5 wins, $176,858, sire), QUICK FLIP (3 wins, $97,300). RACE RECORD: At 2, one win, once 2nd (Balboa S. [G3]); at 3, one win, twice Nella. Unraced. Dam of 6 foals, 5 to race, all winners, including-- 2nd (Jim Neuman S.-R (HOL, $13,000)), twice 3rd (Malibu S. [G1]); at 4, Attesa. 9 wins, 3 to 7, $224,352, 3rd CHBPA Starter H.-R (SA, $8,250). three wins (San Fernando Breeders' Cup S. [G2], San Carlos H. [G2], San RACE RECORD: At 2, three wins (Remsen S. [G2] (AQU, $120,000)) in 3 Diego H. [G3]), 3 times 3rd (Metropolitan H. [G1], Del Mar Breeders' Cup starts; at 3, one win (Southwest S. [G3] (OP, $150,000)), twice 2nd (Arkan- H. [G2], Potrero Grande Breeders' Cup H. [G2]); at 5, unplaced in 2 starts. sas Derby [G2] (OP, $200,000), Rebel S. [G2] (OP, $60,000)). Totals: 4 Totals: 5 wins, 3 times 2nd, 5 times 3rd. Earned $626,671. wins, twice 2nd in 6 starts. Earned $583,280.
40 Taylor Made Stallions
BEN TAYLOR Vice President of Taylor Made Stallions [email protected]
86%:-7;,-8) OXBOW Stallion Nominations Manager Bay Colt; foaled 2010 Vice Regent [email protected] Deputy Minister ...... Mint Copy Awesome Again ...... Blushing Groom (FR) Primal Force ...... Prime Prospect OXBOW Relaunch Cee's Tizzy...... Tizly Tizamazing...... (2002) Seattle Song Cee's Song ...... +-0&)6838)66%>%7 Lonely Dancer Stallion Division Manager By AWESOME AGAIN (1994). Black-type winner of $4,374,590, Breeders' Cup Classic [G1], etc. Sire of 12 crops of racing age, 902 foals, 620 starters, 52 [email protected] black-type winners, 452 winners of 1633 races and earning $69,257,880, including champions Ginger Punch ($3,065,603, Breeders' Cup Distaff [G1] (MTH, $1,220,400), etc.), Ghostzapper ($3,446,120, Breeders' Cup Classic [G1] (LS, $2,080,000)-ntr, etc.), and of Game On Dude [G1] ($4,- 702,158), Round Pond [G1] ($1,998,700), Awesome Gem [G1], Wilko [G1]. 1st dam TIZAMAZING, by Cee's Tizzy. Unraced. Sister to TIZNOW, BUDROYALE, TIZDUBAI, TIZBUD. Dam of 4 foals, 3 to race, all winners, including-- BROOKS TAYLOR OXBOW (c. by Awesome Again). Black-type winner, below. AWESOME PATRIOT (c. by Awesome Again). 3 wins at 2 and 3, $114,600, Stallion Sales Assistant Alydar S. (HOL, $43,020), 3rd Hollywood Prevue S. [G3] (HOL, $12,000). 2nd dam [email protected] CEE'S SONG, by Seattle Song. Winner at 4, $82,225. Half-sister to CEETOIT ($139,508), LEERY BABA ($84,539). Dam of 9 winners, including-- TIZNOW (c. by Cee's Tizzy). 8 wins in 15 starts at 3 and 4, $6,427,830, horse of the year, champion 3-year-old colt, champion older horse, Breeders' Cup Classic [G1] twice, Santa Anita H. [G1], Super Derby [G1]-ntr, 1 1/4 mi. in 1:59 4/5, Goodwood Breeders' Cup H. [G2], etc. Sire. BUDROYALE (g. by Cee's Tizzy). 17 wins, $2,840,810, Goodwood Breeders' Cup H. [G2], San Antonio H. [G2], San Bernardino H. [G2], Mervyn LeRoy H. 8-2%1-00)6 [G2], Longacres Mile H. [G3], California Cup Classic H.-R (SA, $150,000), etc. Executive Asst. to the V. P. Taylor Made Stallions TIZDUBAI (f. by Cee's Tizzy). 2 wins at 2, $116,400, in N.A./U.S., Sorrento S. [G2] (DMR, $90,000). (Total: $117,780). Producer. [email protected] TIZBUD (c. by Cee's Tizzy). 2 wins, $230,266, California Cup Classic H.-R (SA, $150,000), 3rd San Fernando Breeders’ Cup S. (SA, $26,352). [G3] Sire. C'Mon Tiger (c. by Storm Cat). 3 wins at 3 and 4, $136,096, in N.A./U.S., 2nd Santana Mile H. [L] (SA, $15,730). (Total: $137,050). Sire. Tizso. Unplaced in 2 starts. Dam of 11 foals, 8 to race, 6 winners, incl.-- PAYNTER (c. by Awesome Again). 4 wins at 3 and 4, 2013, $1,101,924, Haskell Invitational S. [G1] (MTH, $600,000), 2nd Belmont S. [G1] (BEL, $200,000), Awesome Again S. [G1] (SA, $50,000), San Diego H. [G2] WENDY UPTON (DMR, $40,000), The Cliff's Edge Derby Trial S. [G3] (CD, $45,124). TIZ WEST (c. by Gone West). 3 wins at 3, $263,761, Cinema H. [G3] Stallion Bookings (HOL, $93,720), La Puente S. [L] (SA, $65,940), 3rd Harry F. Bru- baker S.-R (DMR, $10,793). [email protected] TIZAKITTY (f. by Distinctive Cat). 4 wins at 3 and 4, $158,644, Kalookan Queen H. [L] (SA, $47,250). Producer. RACE RECORD: At 2, one win, once 3rd; at 3, 2013, two wins (Preakness S. [G1] (PIM, $600,000), LeComte S. [G3] (FG, $120,000)), twice 2nd (Belmont S. [G1] (BEL, $200,000), Rebel S. [G2] (OP, $120,000)). Totals: 3 wins, twice 2nd, once 3rd. Earned $1,243,500. 41 Taylor Made Sales Agency, Inc.
DUNCAN TAYLOR BEN TAYLOR President and CEO V.P. of Stallions [email protected] [email protected]
FRANK TAYLOR MARK TAYLOR V. P. of Boarding Operations V. P. of Marketing & Public Sales Operations [email protected] [email protected]
PAT PAYNE .)66=*)0-< V. P. of Sales :4SJ%HQMRMWXVEXMSR 'LMIJ*MRERGMEP3J½GIV [email protected] [email protected]
42 Taylor Made Account Managers
JEFF HAYSLETT STUART ANGUS Sr. Account Manager Account Manager [email protected] [email protected]
SHANNON POTTER 0)-*%%632 Account Manager Stakes Filly Recruiter [email protected] [email protected]
JACOB WEST ,928)6,390-,%2 Buyer Account Manager Account Manager [email protected] [email protected]
43 2765 Union Mill Road, Nicholasville, KY 40356 (859) 885-3345 • Fax: (859) 885-1533 www.taylormadestallions.com
@TMStallions astrollogy • ESSKENDEREYYA • GGrayddar • FORRESTRY • NORTTHEERN AFFLEEET • OLD FFASHHIOONED • Oxboow