DOCSLIB.ORG

September Yearling Sales

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
September Yearling Sales SPECIAL ADVERTISING SECTION Yearling Section Advertising Index THE ACORN, LLC ALL STAR THOROUGHBREDS September Yearling Sales (www.allstarthoroughbreds.com) ASMUSSEN HORSE CENTER (www.asmussens.com) BARCLAYS COLLAR (www.barclayscollar.com) BETH BAYER, AGENT BARRY BERKELHAMMER BLOODSTOCK (www.abracadabrafarm.com BLACKBURN FARM (www.blackburnfarm.com) BONA TERRA STUD BREEDERS SALES CO. OF LOUISIANA (www.louisianabred.com) MICHAEL C. BYRNE, AGENT CANADIAN THOROUGHBRED HORSE SOCIETY (www.cthsont.com) WEBB CARROLL TRAINING CENTER CASTLE POST (www.thecastlepost.com) CLARKLAND FARM CLEAR CREEK STUD, LLC (www.clearcreekstudllc.com) CRESTWOOD FARM (www.crestwoodfarm.com) DARBY DAN FARM (www.darbydan.com) DOC’S EQUINE PRODUCTS (www.ocdpellets.com) EATON SALES AGENT (www.eatonsales.com) ECHO VALLEY HORSE FARM NTRA (www.supporthorseracing.org) EQUIADE PRODUCTS (www.equiade.com) EQUINETREX (www.equinetrex.com) 4M RANCH (www.4mranch.com) ANNE M. EBERHARDT GLENCREST FARM (www.glencrest.com) SEPTEMBER YEARLING SALES AND DATES GOOD WIN FARMS GREENFIELD FARM Sept. 1, Canadian Thoroughbred Horse Society Alberta summer yearling sale, Agri-Center, Red Deer, H. E. SUTTON FORWARDING CO. Alberta, Canada (www.suttonforwarding.com) Sept. 4-6, Ruidoso select yearling sale, Ruidoso Downs Racetrack, Ruidoso, NM IRON COUNTY FARMS, INC. Sept. 4-5, Baden-Baden yearling sale, Baden-Baden Sales Co., Baden-Baden, Germany KESMARC/Equine Oxygen Therapy Sept. 6, Canadian Thoroughbred Horse Society Manitoba division annual yearling sale, Assiniboia (www.kesmarc.com and Downs, Winnipeg, Manitoba, Canada www.equinehyperbarics.com) Sept. 8, Canadian Thoroughbred Horse Society Ontario division selected yearling sale, Woodbine LEGACY BLOODSTOCK Sales Pavilion, Toronto, Ontario, Canada (www.legacybloodstock.com) Sept. 8, Washington Thoroughbred Breeders Association summer yearling sale, M.J. Alhadeff Sales PARAMOUNT SALES (www.paramountsales.net) Pavilion, Auburn, WA NTRA (www.NTRAadvantage.com) Sept. 9-10, Doncaster Bloodstock Sales St. Leger Festival yearling sales, Doncaster Bloodstock Sales, Hawick Roxburghshire, England RICKY J COURVILLE, AGENT Sept. 12, Canadian Thoroughbred Horse Society Ontario division open yearling sale, Woodbine Sales THE PUB (www.tavernrestaurantgroup.com) Pavilion, Toronto, Ontario, Canada THE SANCTUARY Sept. 14-27, Keeneland September yearling sale, Keeneland, Lexington, KY (www.sanctuaryequinerehab.com) Sept. 15, Canadian Thoroughbred Horse Society British Columbia division yearling and mixed sale, SPLINTEX (www.equinesplints.com) Thunderbird Show Park, Langley, British Columbia, Canada JED STEFFEE, AGENT Sept. 19, Societa Gestione Aste SRL September select sale, Societa Gestione Aste SRL, Milan, Italy TURNBOW TRAILERS (www.turnbowtrailers.com) Sept. 22-24, Tattersalls Ireland, September yearling sale, Tattersalls, Ratoath, County Meath, Ireland VESSELS STALLION FARM Sept. 28-Oct 1, Goffs Orby Million yearling sale, Goffs Bloodstock Sales, Goffs, County Kildare, (www.vesselsstallionfarm.com) Ireland VIKING STUD Sept. 28-29, Breeders Sales Co. of Louisiana annual yearling sale, Ike Hamilton Arena, West Monroe, WOODY’S HORSE FEED PRODUCTS LA (www.woodysfeed.com) WAR HORSE PLACE (www.warhorseplace.com) From GTinyro Acornsw Selling at Keeneland Early Wednesday, September 16 - Barn 31 A Filly From a Well-Known Half-Brother to “Filly Family” THREE Stakes Winners! HIP 431 Bay Filly HIP 442 Dark Bay or Brown Colt LEMON DROP KID – REACH THE TOP, DEHERE – ROMANTIC SUMMER, by COZZENE by ON TO GLORY Half-sister to G3 SW CHANGING WORLD Half-brother to multiple G2 SW DIAMOND ($394,749) and SP Our Exploit ($111,930). STRIPES ($1,475,645, Godolphin Mile-G2, Out of a G3-winning full sister to record- etc.), G2 SW SUMMER NOTE ($156,300), setting, multiple G3 SW GRAB THE GREEN and multiple G3-performing SW SUMMER ($454,023). By a sire who among his many BOOK ($530,458). Two-year-old Champion stakes winners (21 in ‘08 and 15 to date in ‘09) DEHERE, a proven leading sire of Grade I has the fine female G1 SW’s LEMONS winners with 4 millionaires, is a current FOREVER ($648,940, 1st Kentucky leading sire of 2-year-olds headed by G3 SW Oaks-G1 [CD]), CITRONNADE ($864,205, DECELERATOR from his first crop of 1st Gamely S.-G1 [HOL]), CHRISTMAS KID 2-year-olds since returning to the U.S.A. ($596,877, 1st Ashland S.-G1 [KEE]), and SANTA TERESITA ($503,666, 1st Santa Maria H.-G1 [SA]), etc. (Mr. and Mrs. Samuel H. Rogers, Jr.) Contact: Bill and Lyn Rainbow [email protected] P.O. Box 2794 3560 N.W. 63rd St. Ocala, FL 34478 AT THE LOUSIANA YEARLING SALE Selling September 28 & 29, 2009 BREEDERS SALES COMPANY OF LOUISIANA Ike Hamilton Expo Center • West Monroe, Louisiana Sire of 2009 Winners BRASS BAY, SHUG, Sire of Winners PEACE OF GOLD CALL nine one one, JeMAru & it’s i Me & GOLDEN SHELL RAINMAKER Yearlings GOLDEN SLEW Yearlings Hip 11 RAINMAKER/Seattle Prospector Colt Hip 34 GOLDEN SLEW/Sound Buster Colt 3rd foal o/o producing SPW Seattle Prospector, family O/o an undefeated Allowance-winning daughter of Champion 2YO MARIa’S MON of Champion HOUSEBUSTER Hip 20 RAINMAKER/She’s a Lady Filly Hip 253 GOLDEN SLEW/Golden Dance Colt O/o a young daughter of 2YO SPW Zuppardo’s Lady Family of 2YO SWs BOLD SUMMIT (G2) and Hip 133 RAINMAKER/Barbara Cadabra Filly SUNNY PROSPECTOR Filly from the immediate family of GULLS GRY Also Selling & GAY SERENADE Hip 261 ELUSIVE JAZZ/Grazie Papa Filly Hip 177 RAINMAKER/Change of Venue Filly 1st crop by GSW ELUSIVE JAZZ. Family of Champion Family of female Champions INSIDE INFORMATION, 2YO DIGRESSION, etc. SMUGGLER, etc. Hip 377 LEESTOWN/Old Timey Girl Colt Hip 201 RAINMAKER/Courtins Clash Filly LEESTOWN full brother to “Louisiana Premier Night” Family of Aug. 1, 2009 Louisiana Cup Filly & Mare performers OLD LEE & CEASERS MARCH Sprint SW MASTER LINK ($170,760) Hip 238 RAINMAKER/Flight Check Colt Family of Champions LADY PITT, HEAVENLY PRIZE, etc. Special Services Year-Round Boarding Hip 252 RAINMAKER/Glaring Senorita Colt Family of NORTHERN DANCER’s G1pl G2SW Breeders Program Participant • Lay-Ups GLOW ($344,392) Breeding/Stallion Services (all in Louisiana Breeders program) Hip 361 RAINMAKER/Mon Spirit Colt 2nd foal o/o a MARIa’S MON half-sister to Sales Prep & Representation SW MYSTICAL HIGH LA-breds for sale at all times on farm The Best of Care at the Best Rates! Jack Hebert, Owner • 376 N. Hwy 27, Sulphur, LA 70663 (337) 527-4617 Farm • (337) 496-5976 Cell • (337) 527-8223 Fax Alisha Shields, Manager • (337) 309-8979 • www.AllStarThoroughbreds.com All selling on the same day, Sunday, September 27 Presents opportunities to purchase outstanding Pennsylvania-bred yearlings Hip 4558 THUNDERELLO/ Stylish Aristocrat (Groovy) Filly ~ Pennsylvania Bred Half-sister to 7 winners, including SP Ritzy Dame ($93,248). Stakes-placed dam is a half-sister to G3SW TRIARIUS and G3-pl. SW SHARP NOBLE. 4X4 to BUCKPASSER. Hip 4603 HECKLE/ Warm Thoughts (Rahy) Colt ~ Pennsylvania Bred Half-brother to 3 winners. Out of a 100% producing half-sister to 2009 2yo SW MAJESTIC VINTAGE and SP Musical Chairs ($158,264). Champion female family of DANCING BRAVE and JOLYPHA. Hip 4626 INVISIBLE INK/ Avenue of Gold (Avenue of Flags) Filly ~ Pennsylvania Bred Half-sister to 3 winners, including Oaklawn allowance winner Wildwood Pegasus ($86,730) and Del Mar maiden winner Golden Souvenir ($74,595). Out of MSW AVENUE OF GOLD (11 wins, $519,500). Hip 4648 PEACE RULES/ Cats Rule (Sir Cat) Colt ~ Pennsylvania Bred Full brother to current 2yo winner Cats Liz Rules who broke her maiden in her Calder debut. Dam is a half-sister to SWs MS ZENNA ($302,396) and ZENNAMATIC ($294,840). Hip 4688 INTIMIDATOR/ Famous Lady Ann (Salt Lake) Colt ~ Pennsylvania Bred Out of half-sister to G3SP Powerful Nation ($176,245, dam of SP Star Celebrity, $196,700) and SP Buffalo Bird Woman ($162,013, dam of 2009 G3-pl. MSW MOTOVATO, $132,769). Hip 4754 PRIMAL STORM/ Kitten Jones (Seneca Jones) Filly ~ Pennsylvania Bred From the first crop of a Graded SW grandson of STORM CAT. Female family of Count Fleet Sprint H.-G3 winner APPROACH ($427,247) and SW LEVEE NIGHT ($111,804). Hip 4770 EUROSILVER/ Listed (Houstbuster) Colt ~ Pennsylvania Bred Half-brother to 5 winners, including SP Dutch Girl ($121,705) and Clara’s Song ($102,385). Female family of leading sires PULPIT, TALE OF THE CAT, and JOHANNESBURG. Keith and Marilyn Asmussen P.O. Box 1861, Laredo, TX 78044 (956) 723-5436, Fax (956) 723-5845 Email: [email protected] Website: asmussens.com Aus $137.00 all inclusive TRACK DOWN Your Next Stakes Winner At Beth Bayer’s Consignment Selling at Keeneland September Saturday, September 19 • Barn 9 Friday, September 25 • Barn 42 Hip 1225 LEMON DROP KID Colt Hip 3716 PLEASANT TAP Colt O/o Rivery, by Riverman ~ Dam is a half-sister to record-setting O/o Scalene, by Dehere ~ Dam is a half-sister to G1SW SABONA ($855,450). Second dam is a full sister multiple GSW HOUSTON ($240,632). Second dam to Champion TRILLION. LEMON DROP KID has 14 SWs in is Champion SMART ANGLE. 2009, 5 Graded, incl. G1SW SANTA TERESITA. Hip 3912 BANDINI Filly O/o Dream Storm, by Storm Bird ~ Dam is a half-sister to record-setting SW CHRIS’S THUNDER ($309,401). Stakes-winning second dam. Hip 3986 CLOSING ARGUMENT Colt O/o Iron Red, by Brief Ruckus Out of a half-sister to G3SW SI SI SEZYOU ($197,970, dam of G3-pl. SW SCOOTER GIRL). Hip 4030 EXCHANGE RATE Colt O/o Make Me Know It, by Vicar Second foal out of a winning granddaughter of MG2SW LOVE YOU BY HEART ($612,630). Sunday, September 27 • Barn 15 Hip 4653 EXCHANGE RATE Colt O/o Che Sara Sara, by Golden Act Half-brother to SP Red Leader. Family of 2008 Champion Sprinter BENNY THE BULL ($2,353,430). Hip 4833 IN EXCESS (IRE) Colt O/o Ploesti Flight, by Lucky North First foal out of a half-sister to 3 SHs, including SW CHATTER CHATTER ($393,940).
Load more

Recommended publications
  • Gdowth Should Detudn...Some
    INFORMATION AND ANALYSIS FOR THE THOROUGHBRED INVESTOR JUNE 2010 Yearling Sales Preview By Eric Mitchell 2. YEARLING AUCTION REVIEW GROWTH SHOULD RETURN...SOME BY SALE, '05-'07 hat will happen in the Thoroughbred yearling and the overall quality of the horses should improve 4. LEADING Wmarket is particularly hard to predict this year. as sellers become more selective about the yearlings CONSIGNORS OF Many influences of equal importance, both positive and they offer. The ROR should also improve slightly com- YEARLINGS '05-'07 negative, could shape the market, but which of these pared with 2009. The select 2-year-olds sales experi- influences will predominate is the big question. enced an increase in ROR to 70%, up from 30% in 2008. 5. LEADING BUYERS In 2009 the rate of return on pinhooked yearlings hit The average juvenile price improved to $160,732 from OF YEARLINGS a rock-bottom low of -42.2%. It didn’t help sellers that $147,528. Clearly, there is still an appetite for acquiring '05-'07 these horses had been bred on the highest average stud Thoroughbreds, so an increase in the average yearling fee ($31,462) seen in the last 10 years, and the average price between 5% and 10% is not unreasonable, though 6. RACING STATS yearling price also fell 31% as part of the fallout from the such an increase would still produce losing RORs for the FOR SUMMER global financial crisis. pinhook yearling market. The average pinhook yearling SIRES PROGENY Sellers don't get any relief on the cost side this year price would have to grow at least 18% to $57,884 for sell- because North American stud fees were still relatively ers to break even collectively.
    [Show full text]
  • NORTHERN CAUSEWAY Ch, 2008
    NORTHERN CAUSEWAY ch, 2008 Dosage (4-1-23-0-0); DI: 1.43; CD: 0.32 See gray pages—Nearctic RACE AND (BLACK TYPE) RECORD Storm Bird, 1978 Northern Dancer, by Nearctic 6s, BTW, $169,181 Age Starts 1st 2nd 3rd Earned Storm Cat, 1983 682 f, 63 BTW, 2.26 AEI South Ocean, by New Providence 2 1 0 0 0 $560 8s, BTW, $570,610 3 11 4(2) 3 0 $211,311 1,414 f, 177 BTW, 2.94 AEI Terlingua, 1976 Secretariat, by Bold Ruler 17s, BTW, $423,896 4 10 1 0 3(1) $39,201 Giant's Causeway, ch, 1997 13s, BTW, $3,078,989 11 f, 9 r, 6 w, 2 BTW Crimson Saint, by Crimson Satan 5 6 0 1 0 $9,990 2,484 f, 193 BTW, 1.79 AEI Rahy, 1985 Blushing Groom, by Red God 6 2 0 0 1 $4,305 8.38 AWD 13s, BTW, $347,767 Totals 30 5(2) 4 4(1) $265,367 Mariah's Storm, 1991 1,133 f, 92 BTW, 2.19 AEI Glorious Song, by Halo 16s, BTW, $724,895 Won At 3 14 f, 11 r, 8 w, 2 BTW Immense, 1979 Roberto, by Hail to Reason British Columbia Derby (G3, $200,660, 9f in 1:50.22, 28s, BTW, $123,324 dftg. Jebrica, Arraignment, Commander, 6 f, 6 r, 5 w, 3 BTW Imsodear, by Chieftain Couldabenthewhisky, Northern Indy, Herbie D, Line Deputy Minister, 1979 Vice Regent, by Northern Dancer Change, Hurricane Lake, Inhisglory, Winter 22s, BTW, $696,964 Warlock, Fransor’s Finest).
    [Show full text]
  • Full Program
    Mark Bet Slips South Track $1 Exacta / $1 Trifecta $2 Rolling Double/ $1 Rolling Pick Three (Races 1-2-3) $0.50 Pick 5 (Races 1-2-3-4-5) / $1 Superfecta (.10 Min.) Win Place Show 1st Approx. Post 1:00PM Monterey Park Library Foundation MAIDEN CLAIMING $40,000-$35,000. PURSE $25,000. FOR MAIDENS, FILLIES TWO YEARS OLD.Weight, 120 Lbs Claiming Price $40,000, For Each $2,500 To $35,000 1 lb. Six Furlongs. Track Record: The Factor 118 lbs. 2 y.o. 12-26-10 1:06.98 Tamesis Stable Kristin Mulhall 6 Navy blue, white star on back, navy blue cap Martin 1 Ratera L 120 Pedroza Red 2y.o. (May) Dk B/ Br. f (KY) by War Chant - Love Appeal (IRE) (Singspiel (IRE)) $40,000 Bred in Kentucky by Dr. Melinda Blue Petrick or Tannenbaum Tim Yakteen(Applegarth, J.) 6 Royal blue, gold horseshoe "BE" on back, white sleeves, blue and white cap Fernando 2 Old Fashion Halo L 120 Perez White 2y.o. (Mar) Gr/ro. f (KY) by Old Fashioned - Strawberry Halo (Southern Halo) $40,000 Bred in Kentucky by Dr. O. M. Patrick & Dick Lossen Gorman or Schwindt or Sterling Stables Philip D' Amato 9/5 Chartreuse, white "SS" on purple diamond, purple diamond stripe on sleeves, chartreuse cap Tyler 3 Straight N Strong L 120 Baze Blue 2y.o. (Apr) B. f (KY) by Quality Road - Blinky's Girl (Silver Deputy) $40,000 Bred in Kentucky by Tony Holmes & W. S. Farish DP Racing James M. Cassidy(M.
    [Show full text]
  • Fashionably Late
    drf.com/breeding DAILY RACING FORM Sunday, February 9, 2014 PAGE 11 fashionably late JOHN P. SPARKMAN As the stud career of the late, great Storm Cat began to wind down in the early 2000s, the Kentucky breeding indus- try needed a successor as the designated young sire of sires. The obvious choice seemed to be Unbridled’s Song, who had begun his stud career brilliantly, with Breeders’ Cup Distaff winner Unbridled Elaine, Grade 1 winner Songandaprayer, and multiple Grade 2 winner Even the Score in his first crop and Grade 1 winner Buddha in his second. As recently as the middle of last year, however, the investment the breeding industry made in sons of Unbridled’s Song looked like an expensive wager gone very wrong, since Even the Score, the sire of Dullahan and Take the Points, was his only son to have sired a Grade 1 winner. That lackluster record began to improve dramatically in the last half of the year, as Unbridled’s Song’s sons First Defence, Benoit & AssociAtes Dunkirk, and Rockport Harbor all added Fashion Plate wins the Las Virgenes Stakes on Feb. 1, becoming the first Grade 1 Grade 1 winners to their stud records. winner for Unbridled’s Song’s son Old Fashioned. After last Saturday’s Grade 1 Las Virgenes Stakes at Santa Anita, another Honest Man, both by Unbridled’s Song, with similar disdain in the 1 1/8-mile, name can be added to that list, a name that were only a few months away from their Grade 2 Remsen Stakes at Aqueduct a could turn out to be the most promising maiden victories.
    [Show full text]
  • Graydar Oxbow
    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
    [Show full text]
  • 138904 09 Juvenilefilliesturf.Pdf
    breeders’ cup JUVENILE FILLIES TURF BREEDERs’ Cup JUVENILE FILLIES TURF (GR. I) 6th Running Santa Anita Park $1,000,000 Guaranteed FOR FILLIES, TWO-YEARS-OLD ONE MILE ON THE TURF Weight, 122 lbs. Guaranteed $1 million purse including travel awards, of which 55% of all monies to the owner of the winner, 18% to second, 10% to third, 6% to fourth and 3% to fifth; plus travel awards to starters not based in California. The maximum number of starters for the Breeders’ Cup Juvenile Fillies Turf will be limited to fourteen (14). If more than fourteen (14) horses pre-enter, selection will be determined by a combination of Breeders’ Cup Challenge winners, Graded Stakes points and the Breeders’ Cup Racing Secretaries and Directors panel. Please refer to the 2013 Breeders’ Cup World Championships Horsemen’s Information Guide (available upon request) for more information. Nominated Horses Breeders’ Cup Racing Office Pre-Entry Fee: 1% of purse Santa Anita Park Entry Fee: 1% of purse 285 W. Huntington Dr. Arcadia, CA 91007 Phone: (859) 514-9422 To Be Run Friday, November 1, 2013 Fax: (859) 514-9432 Pre-Entries Close Monday, October 21, 2013 E-mail: [email protected] Pre-entries for the Breeders' Cup Juvenile Fillies Turf (G1) Horse Owner Trainer Al Thakhira (GB) Sheikh Joaan Bin Hamad Al Thani Marco Botti B.f.2 Dubawi (IRE) - Dahama (GB) by Green Desert - Bred in Great Britain by Qatar Bloodstock Ltd Chriselliam (IRE) Willie Carson, Miss E. Asprey & Christopher Wright Charles Hills B.f.2 Iffraaj (GB) - Danielli (IRE) by Danehill - Bred in Ireland by Ballylinch Stud Clenor (IRE) Great Friends Stable, Robert Cseplo & Steven Keh Doug O'Neill B.f.2 Oratorio (IRE) - Chantarella (IRE) by Royal Academy - Bred in Ireland by Mrs Lucy Stack Colonel Joan Kathy Harty & Mark DeDomenico, LLC Eoin G.
    [Show full text]
  • A Better Mousetrap
    A BETTER MOUSETRAP My idea is to give first priority for Derby eligibility (Tier One) to the winner of the previous year's Breeders' Cup Juvenile plus the top three finishers in the big five preps: Florida Derby, Santa Anita Derby, Blue Grass, Arkansas Derby and Wood Memorial. All are Grade I stakes except the Arkansas Derby, a separate fiasco we can tackle at a later date. by randy moss Tier Two includes the winners of the Grade II Fountain of Youth, Louisiana Derby, San Felipe, Rebel, Lane=s End, UAE Derby, Illinois Derby and Lexington A BETTER MOUSETRAP Stakes, ranked in order of graded earnings. Pondering the possibility that Mafaaz could make the Tier Three is the winners of the Grade III Lecomte, San Rafael, Holy Bull, Risen Star, Sam F. Davis, El Kentucky Derby while Dunkirk is left in the cold, I have Camino Real, Southwest, Sham, Gotham and Tampa dusted off columns previously published elsewhere in Bay Derby, also ranked within the tier by graded May 2005, May 2007 and June 2008. earnings. Needless to say, the Derby's graded earnings rule has Then you have the All Others category. Graded been one of my pet peeves for some time. earnings would be used to determine the remainder of Churchill Downs first instituted an earnings provision the 20-horse field if any additional spots are open due in 1975 and updated it a decade later to its current to duplicate qualifiers. form, which has been mostly adequate with a few Every graded non-turf three-year-old prep at a mile or longer is included in this approach.
    [Show full text]
  • TAKE CHARGE BRANDI Barn 12 & 14 Hip No
    Consigned by Hill 'n' Dale Sales Agency, Agent Barn TAKE CHARGE BRANDI Hip No. 12 & 14 Chestnut Filly; foaled 2012 450 Storm Bird Storm Cat .......................... Terlingua Giant's Causeway .............. Rahy Mariah's Storm ................ Immense TAKE CHARGE BRANDI Mr. Prospector Seeking the Gold .............. Con Game Charming .......................... (2005) Dehere Take Charge Lady .............. Felicita By GIANT'S CAUSEWAY (1997). European horse of the year, black-type win - ner of $3,078,989, Esat Digifone Irish Champion S. [G1] , etc. Leading sire 3 times, sire of 12 crops of racing age, 2246 foals, 1670 starters, 155 black-type winners, 1099 winners of 3149 races and earning $134,467,- 480, 8 champions, including Shamardal ($1,931,770, Gainsborough Poule d'Essai des Poulains-French Two Thousand Guineas [G1] , etc.), Take Charge Brandi [G1] ($1,682,126), and of Aragorn (IRE) [G1] ($1,529,325). 1st dam CHARMING, by Seeking the Gold. Winner at 3, $43,155. Dam of 4 registered foals, 3 of racing age, including a 2-year-old of 2015, 2 to race, 2 winners-- TAKE CHARGE BRANDI (f. by Giant's Causeway). Champion, see record. Siete C (c. by Unbridled's Song). 3 wins at 4, $100,110. 2nd dam TAKE CHARGE LADY , by Dehere. 11 wins in 22 starts, 2 to 4, $2,480,377, Ash - land S. [G1] (KEE, $345,805), Overbrook Spinster S. [G1] (KEE, $338,520), Overbrook Spinster S. [G1] (KEE, $310,000), Walmac International Alcibi - ades S. [G2] , Fair Grounds Oaks [G2] (FG, $210,000), Arlington Matron H. [G3] (AP, $90,000), Silverbulletday S. [G3] (FG, $90,000), Dogwood S.
    [Show full text]
  • FED BIZ Bay Horse; Foaled 2009 Storm Bird Storm Cat
    FED BIZ Bay Horse; foaled 2009 Storm Bird Storm Cat .......................... Terlingua Giant's Causeway .............. Rahy Mariah's Storm ................ Immense FED BIZ Icecapade Wild Again ........................ Bushel-n-Peck Spunoutacontrol .............. (1996) Mr. Prospector Yarn .................................. Narrate By GIANT'S CAUSEWAY (1997). European horse of the year, black-type win - ner of $3,078,989, Esat Digifone Irish Champion S. [G1] , etc. Leading sire 3 times, sire of 13 crops of racing age, 2342 foals, 1788 starters, 165 black- type winners, 1171 winners of 3444 races and earning $145,243,033, 8 champions, including Shamardal ($1,931,770, Gainsborough Poule d'Essai des Poulains-French Two Thousand Guineas [G1] , etc.), Take Charge Brandi [G1] ($1,692,126), and of Aragorn (IRE) [G1] , Carpe Diem [G1] . 1st dam SPUNOUTACONTROL , by Wild Again. 4 wins in 5 starts to 4, $86,405, Singing Beauty S.-R (LRL, $26,145). Dam of 8 foals, 5 to race, all winners, incl.-- FED BIZ (c. by Giant's Causeway). Black-type winner, below. SPUN SILK (f. by A.P. Indy). 2 wins at 3, $65,750, Ride Sally S.-R (AQU, $40,050). Dam of 3 foals to race, including-- JOKING (g. by Distorted Humor). 9 wins, 3 to 7, 2016, $636,138, True North S. [G2] (BEL, $137,500), Diablo S. [L] (BEL, $60,000). Whichwaydidshego (f. by Storm Cat). Winner at 2, $32,420. Dam of-- MARK MY WAY (g. by Noonmark). 7 wins, 2 to 5, 2016, $235,594, New York Stallion S.-R (BEL, $60,000), New York Stallion Series S.-R (SAR, $60,000).
    [Show full text]
  • CARPE DIEM Chestnut Horse; Foaled 2012 Storm Bird Storm Cat
    CARPE DIEM Chestnut Horse; foaled 2012 Storm Bird Storm Cat .......................... Terlingua Giant's Causeway .............. Rahy Mariah's Storm ................ Immense CARPE DIEM Unbridled Unbridled's Song .............. Trolley Song Rebridled Dreams ............ (2000) Corridor Key Key Cents .......................... Centimeter By GIANT'S CAUSEWAY (1997). European horse of the year, black-type winner of $3,078,989, Esat Digifone Irish Champion S. [G1] , etc. Leading sire 3 times, sire of 15 crops of racing age, 2435 foals, 1831 starters, 168 black- type winners, 1210 winners of 3563 races and earning $149,977,145, 8 champions, including Shamardal ($1,931,770, Gainsborough Poule d'Essai des Poulains-French Two Thousand Guineas [G1] , etc.), Take Charge Brandi [G1] ($1,692,126), and of Aragorn (IRE) [G1] ($1,529,325), Giant Oak [G1] . 1st dam REBRIDLED DREAMS , by Unbridled's Song. 4 wins at 2 and 3, $134,663, Money Penny S. (HAW, $25,920), 3rd Silverbulletday S. [G2] (FG, $16,500). Dam of 9 foals, 8 to race, 7 winners, including-- CARPE DIEM (c. by Giant's Causeway). Black-type winner, below. J. B.'S THUNDER (c. by Thunder Gulch). 2 wins at 2, $280,130, Dixiana Breeders' Futurity [G1] (KEE, $240,000). FARRELL (f. by Malibu Moon). 4 wins in 6 starts at 2 and 3, 2017, $361,357, Rachel Alexandra S. [G2] (FG, $120,000), Golden Rod S. [G2] (CD, $115,320), Silverbulletday S. [L] (FG, $90,000), 3rd Rags to Riches S. (CD, $8,087). DONCASTER ROVER (c. by War Chant). 5 wins, 2 to 5, £198,107, in Eng - land, Debenhams City of York S., Flight Centre Chester Queensferry S., Novae Bloodstock Insurance Hopeful S., 2nd Timeform Jury John of Gaunt S.
    [Show full text]
  • NORTHERN CAUSEWAY Ch, 2008
    Enters Stud in 2015 NORTHERN CAUSEWAY ch, 2008 Dosage (4-1-23-0-0); DI: 1.43; CD: 0.32 See gray pages—Nearctic RACE AND (STAKES) RECORD Storm Bird, 1978 Northern Dancer, by Nearctic 6s, SW, $169,181 Age Starts 1st 2nd 3rd Earned Storm Cat, 1983 681 f, 64 SW, 2.27 AEI South Ocean, by New Providence 2 1 0 0 0 $560 8s, SW, $570,610 3 11 4(2) 3 0 $211,311 1,414 f, 181 SW, 2.96 AEI Terlingua, 1976 Secretariat, by Bold Ruler 17s, SW, $423,896 4 10 1 0 3(1) $39,201 Giant's Causeway, ch, 1997 13s, SW, $3,078,989 11 f, 9 r, 6 w, 2 SW Crimson Saint, by Crimson Satan 5 6 0 1 0 $9,990 2,030 f, 156 SW, 1.84 AEI Rahy, 1985 Blushing Groom, by Red God 6 2 0 0 1 $4,305 8.51 AWD 13s, SW, $347,767 Totals 30 5(2) 4 4(1) $265,367 Mariah's Storm, 1991 1,131 f, 96 SW, 2.22 AEI Glorious Song, by Halo 16s, SW, $724,895 Won At 3 12 f, 10 r, 7 w, 2 SW Immense, 1979 Roberto, by Hail to Reason British Columbia Derby (Can-III, $200,660, 9f in 28s, SW, $123,324 1:50.22, dftg. Jebrica, Arraignment, Commander, 6 f, 6 r, 5 w, 3 SW Imsodear, by Chieftain Couldabenthewhisky, Northern Indy, Herbie D, Line Deputy Minister, 1979 Vice Regent, by Northern Dancer Change, Hurricane Lake, Inhisglory, Winter 22s, SW, $696,964 Warlock, Fransor’s Finest).
    [Show full text]
  • ANGLIANAANGLIANA 2002 Chestnut - Dosage Profile: 7-1-25-1-0; DI: 1.52; CD: +0.41
    ANGLIANAANGLIANA 2002 Chestnut - Dosage Profile: 7-1-25-1-0; DI: 1.52; CD: +0.41 Nearctic RACE AND (STAKES) RECORD Northern Dancer Natalma Age Starts 1st 2nd 3rd Earnings Storm Bird New Providence 2 2 1 0 0 $27,450 South Ocean Shining Sun 3 8 1 1(1) 2 58,765 Storm Cat Bold Ruler 4 7 2 3(2) 0 112,447 Secretariat Somethingroyal 5 2 0 1(1) 1(1) 29,220 Terlingua Crimson Satan 6 9 1(1) 4(1) 3(3) 161,880 Crimson Saint Bolero Rose Giant's Causeway (1997) 7 2 0 0 0 170 Red God Blushing Groom (FR) 8 1 0 0 0 1,200 Runaway Bride (GB) Rahy 31 5(1) 9(5) 6(4) $391,132 Halo Glorious Song Ballade Mariah's Storm At 2, WON a maiden special weight race at Aqueduct (1 Hail to Reason Roberto Bramalea 1/16 mi., defeating Curlew Road, King’s Choice, Cap- Immense Chieftain tain Slew, etc.). Imsodear Ironically At 3, WON an allowance race at Belmont Park (1 3/8 mi., Angliana Native Dancer Raise a Native turf, defeating Prep School, Swordsman (GER), Victory Raise You Mr. Prospector Circle, etc.), 2nd Lawrence Realization S.-L at Nashua Gold Digger Sequence Belmont Park (1 1/8 mi., to Taming the Tiger, defeating Jade Hunter Lyphard Crown Point, Swordsman (GER), etc.). Pharly Comely (FR) At 4, WON an allowance race at Delaware Park (1 1/16 mi., top Jadana (IRE) *Match II Janina weight of 123 lbs., defeating Golden Rainbow, Belongs to Jennifer Pratella (1995) Joe, Letterman’s Humor, etc.), an allowance race at Del- Hail to Reason Halo Cosmah aware Park (1 1/16 mi., by 4 3/4 lengths, defeating Pay the Devil's Bag *Herbager Preacher, Orlop, Baby League, etc.), 2nd Red Smith H.- Ballade Miss Swapsco G3 at Aqueduct (1 1/4 mi., to Naughty New Yorker, de- Dancing Devlette Northern Dancer Nijinsky II feating Crown Point, Chilly Rooster, etc.), Gallant Fox Flaming Page Terpsichorist H.
    [Show full text]