169 Expensive Taste

Total Page:16

File Type:pdf, Size:1020Kb

169 Expensive Taste Barn 5 Hip No. Consigned by Paramount Sales, Agent XIV 169 Expensive Taste Storm Cat . Storm Bird Giant’s Causeway . {Terlingua {Mariah’s Storm . Rahy Expensive Taste . {Immense Chestnut filly; Wild Rush . Wild Again foaled 2014 {Windy . {Rose Park (2003) {Native Wind Dancer . Incinderator {Rich Indian By GIANT’S CAUSEWAY (1997), [G1] $3,078,989, European horse of the year. Leading sire 3 times. Sire of 15 crops, 176 black type winners, 8 champions, $157,326,997, including Shamardal [G1] ($1,931,770), Take Charge Brandi [G1] ($1,692,126) and Eishin Apollon [G1] ($3,532,765), Aragorn (IRE) [G1]-ncr ($1,529,325), Carpe Diem [G1] ($1,519,800). 1st dam WINDY, by Wild Rush. 4 wins, 2 to 4, $224,094. Dam of 5 other foals of racing age, 4 to race, all winners, including-- PASS THE BUCK (c. by Pulpit) 3 wins at 3, $195,269, Zia Park Derby [L] (ZIA, $120,000). Power Nap (g. by Smart Strike). 5 wins, 2 to 5, 2017, $212,462. Cruise Director (g. by Pulpit). 10 wins, 3 to 6, $149,174. 2nd dam NATIVE WIND DANCER, by Incinderator. Winner. Dam of 5 winners, incl.-- SUMMER WIND DANCER (f. by Siberian Summer). 5 wins, $898,762, Delaware H. [G2] (DEL, $450,000), Hawthorne H. [G3] (HOL, $65,160), California Cup Juvenile Fillies S.-R (SA, $75,000), Cover Gal S.-R (SA, $49,185), 2nd California Cup Matron H.-R (SA, $30,000), B. Thoughtful S.-R (HOL, $30,000), Solana Beach H.-R (DMR, $25,000), Fleet Treat S.-R (DMR, $20,000), Santa Lucia H.-R (SA, $20,745), 3rd Hollywood Starlet S. [G1] (HOL, $42,780), Santa Ysabel S. [G3] (SA, $13,308), etc. Dam of Bahama Bound (f. by Empire Maker) $214,700, 2nd Ladies H. (AQU, $15,000), 3rd Top Flight H. [G2] (AQU, $20,000), etc. G’dam of Voting Control (c. by Kitten’s Joy) at 2, 2017, $175,000, 2nd Pilgrim S. [G3], BEL, $40,000, etc.; Bahama Halo (f. by More Than Ready). Indian Jones (g. by Smarty Jones). 6 wins, 3 to 6, $384,460, 2nd Green- wood Cup S. [G3] (PRX, $40,000), Native Dancer S. (LRL, $20,000), etc. 3rd dam RICH INDIAN, by Raise a Native. Unraced. Dam of 8 winners, including-- One Rich Runner. Winner at 3 and 4, $91,417. 4th dam TRILLIONAIRE, by *Vaguely Noble. 5 wins at 3 in England, Princess Royal S.-G3; placed at 4 and 5, $26,460 in N.A./U.S. Half-sister to SOLAR CURRENT (sire). Dam of 8 foals to race, 6 winners, including-- LOCK’S DREAM. Winner at 2 in France; winner at 3 and 4, $87,735 in N.A./U.S., Spring Fiesta Cup H. (FG, $28,450), 3rd Yerba Buena H. [G3], etc. Dam of BIG BROWN BEAR (6 wins, $149,360). G’dam of LACIE GIRL ($314,390, dam of LACIE SLEW, 7 wins, $259,642; PRETTY- PRICEYGIRL, 8 wins, $231,030; Oh So Thirsty, to 3, 2017), AKANTI (IRE) (Total: $227,876), Lock And Key (IRE) [G3]; Hi Mandy. Not in Doubt. 2 wins in England, 2nd Henry II S. [G3]. Total: $51,545. Sire. Race Record: At 2, once 2nd in 1 start; at 3, unplaced in 1 start; at 4, 2018, unraced to January 5 unplaced in 1 start. Earned $13,500 $14,320. Breeders’ Cup nominated. KTDF. Racing/broodmare prospect. 12-17.
Recommended publications
  • Gdowth Should Detudn...Some
    INFORMATION AND ANALYSIS FOR THE THOROUGHBRED INVESTOR JUNE 2010 Yearling Sales Preview By Eric Mitchell 2. YEARLING AUCTION REVIEW GROWTH SHOULD RETURN...SOME BY SALE, '05-'07 hat will happen in the Thoroughbred yearling and the overall quality of the horses should improve 4. LEADING Wmarket is particularly hard to predict this year. as sellers become more selective about the yearlings CONSIGNORS OF Many influences of equal importance, both positive and they offer. The ROR should also improve slightly com- YEARLINGS '05-'07 negative, could shape the market, but which of these pared with 2009. The select 2-year-olds sales experi- influences will predominate is the big question. enced an increase in ROR to 70%, up from 30% in 2008. 5. LEADING BUYERS In 2009 the rate of return on pinhooked yearlings hit The average juvenile price improved to $160,732 from OF YEARLINGS a rock-bottom low of -42.2%. It didn’t help sellers that $147,528. Clearly, there is still an appetite for acquiring '05-'07 these horses had been bred on the highest average stud Thoroughbreds, so an increase in the average yearling fee ($31,462) seen in the last 10 years, and the average price between 5% and 10% is not unreasonable, though 6. RACING STATS yearling price also fell 31% as part of the fallout from the such an increase would still produce losing RORs for the FOR SUMMER global financial crisis. pinhook yearling market. The average pinhook yearling SIRES PROGENY Sellers don't get any relief on the cost side this year price would have to grow at least 18% to $57,884 for sell- because North American stud fees were still relatively ers to break even collectively.
    [Show full text]
  • September Yearling Sales
    SPECIAL ADVERTISING SECTION Yearling Section Advertising Index THE ACORN, LLC ALL STAR THOROUGHBREDS September Yearling Sales (www.allstarthoroughbreds.com) ASMUSSEN HORSE CENTER (www.asmussens.com) BARCLAYS COLLAR (www.barclayscollar.com) BETH BAYER, AGENT BARRY BERKELHAMMER BLOODSTOCK (www.abracadabrafarm.com BLACKBURN FARM (www.blackburnfarm.com) BONA TERRA STUD BREEDERS SALES CO. OF LOUISIANA (www.louisianabred.com) MICHAEL C. BYRNE, AGENT CANADIAN THOROUGHBRED HORSE SOCIETY (www.cthsont.com) WEBB CARROLL TRAINING CENTER CASTLE POST (www.thecastlepost.com) CLARKLAND FARM CLEAR CREEK STUD, LLC (www.clearcreekstudllc.com) CRESTWOOD FARM (www.crestwoodfarm.com) DARBY DAN FARM (www.darbydan.com) DOC’S EQUINE PRODUCTS (www.ocdpellets.com) EATON SALES AGENT (www.eatonsales.com) ECHO VALLEY HORSE FARM NTRA (www.supporthorseracing.org) EQUIADE PRODUCTS (www.equiade.com) EQUINETREX (www.equinetrex.com) 4M RANCH (www.4mranch.com) ANNE M. EBERHARDT GLENCREST FARM (www.glencrest.com) SEPTEMBER YEARLING SALES AND DATES GOOD WIN FARMS GREENFIELD FARM Sept. 1, Canadian Thoroughbred Horse Society Alberta summer yearling sale, Agri-Center, Red Deer, H. E. SUTTON FORWARDING CO. Alberta, Canada (www.suttonforwarding.com) Sept. 4-6, Ruidoso select yearling sale, Ruidoso Downs Racetrack, Ruidoso, NM IRON COUNTY FARMS, INC. Sept. 4-5, Baden-Baden yearling sale, Baden-Baden Sales Co., Baden-Baden, Germany KESMARC/Equine Oxygen Therapy Sept. 6, Canadian Thoroughbred Horse Society Manitoba division annual yearling sale, Assiniboia (www.kesmarc.com and Downs, Winnipeg, Manitoba, Canada www.equinehyperbarics.com) Sept. 8, Canadian Thoroughbred Horse Society Ontario division selected yearling sale, Woodbine LEGACY BLOODSTOCK Sales Pavilion, Toronto, Ontario, Canada (www.legacybloodstock.com) Sept. 8, Washington Thoroughbred Breeders Association summer yearling sale, M.J.
    [Show full text]
  • NORTHERN CAUSEWAY Ch, 2008
    NORTHERN CAUSEWAY ch, 2008 Dosage (4-1-23-0-0); DI: 1.43; CD: 0.32 See gray pages—Nearctic RACE AND (BLACK TYPE) RECORD Storm Bird, 1978 Northern Dancer, by Nearctic 6s, BTW, $169,181 Age Starts 1st 2nd 3rd Earned Storm Cat, 1983 682 f, 63 BTW, 2.26 AEI South Ocean, by New Providence 2 1 0 0 0 $560 8s, BTW, $570,610 3 11 4(2) 3 0 $211,311 1,414 f, 177 BTW, 2.94 AEI Terlingua, 1976 Secretariat, by Bold Ruler 17s, BTW, $423,896 4 10 1 0 3(1) $39,201 Giant's Causeway, ch, 1997 13s, BTW, $3,078,989 11 f, 9 r, 6 w, 2 BTW Crimson Saint, by Crimson Satan 5 6 0 1 0 $9,990 2,484 f, 193 BTW, 1.79 AEI Rahy, 1985 Blushing Groom, by Red God 6 2 0 0 1 $4,305 8.38 AWD 13s, BTW, $347,767 Totals 30 5(2) 4 4(1) $265,367 Mariah's Storm, 1991 1,133 f, 92 BTW, 2.19 AEI Glorious Song, by Halo 16s, BTW, $724,895 Won At 3 14 f, 11 r, 8 w, 2 BTW Immense, 1979 Roberto, by Hail to Reason British Columbia Derby (G3, $200,660, 9f in 1:50.22, 28s, BTW, $123,324 dftg. Jebrica, Arraignment, Commander, 6 f, 6 r, 5 w, 3 BTW Imsodear, by Chieftain Couldabenthewhisky, Northern Indy, Herbie D, Line Deputy Minister, 1979 Vice Regent, by Northern Dancer Change, Hurricane Lake, Inhisglory, Winter 22s, BTW, $696,964 Warlock, Fransor’s Finest).
    [Show full text]
  • Graydar Oxbow
    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
    [Show full text]
  • TAKE CHARGE BRANDI Barn 12 & 14 Hip No
    Consigned by Hill 'n' Dale Sales Agency, Agent Barn TAKE CHARGE BRANDI Hip No. 12 & 14 Chestnut Filly; foaled 2012 450 Storm Bird Storm Cat .......................... Terlingua Giant's Causeway .............. Rahy Mariah's Storm ................ Immense TAKE CHARGE BRANDI Mr. Prospector Seeking the Gold .............. Con Game Charming .......................... (2005) Dehere Take Charge Lady .............. Felicita By GIANT'S CAUSEWAY (1997). European horse of the year, black-type win - ner of $3,078,989, Esat Digifone Irish Champion S. [G1] , etc. Leading sire 3 times, sire of 12 crops of racing age, 2246 foals, 1670 starters, 155 black-type winners, 1099 winners of 3149 races and earning $134,467,- 480, 8 champions, including Shamardal ($1,931,770, Gainsborough Poule d'Essai des Poulains-French Two Thousand Guineas [G1] , etc.), Take Charge Brandi [G1] ($1,682,126), and of Aragorn (IRE) [G1] ($1,529,325). 1st dam CHARMING, by Seeking the Gold. Winner at 3, $43,155. Dam of 4 registered foals, 3 of racing age, including a 2-year-old of 2015, 2 to race, 2 winners-- TAKE CHARGE BRANDI (f. by Giant's Causeway). Champion, see record. Siete C (c. by Unbridled's Song). 3 wins at 4, $100,110. 2nd dam TAKE CHARGE LADY , by Dehere. 11 wins in 22 starts, 2 to 4, $2,480,377, Ash - land S. [G1] (KEE, $345,805), Overbrook Spinster S. [G1] (KEE, $338,520), Overbrook Spinster S. [G1] (KEE, $310,000), Walmac International Alcibi - ades S. [G2] , Fair Grounds Oaks [G2] (FG, $210,000), Arlington Matron H. [G3] (AP, $90,000), Silverbulletday S. [G3] (FG, $90,000), Dogwood S.
    [Show full text]
  • FED BIZ Bay Horse; Foaled 2009 Storm Bird Storm Cat
    FED BIZ Bay Horse; foaled 2009 Storm Bird Storm Cat .......................... Terlingua Giant's Causeway .............. Rahy Mariah's Storm ................ Immense FED BIZ Icecapade Wild Again ........................ Bushel-n-Peck Spunoutacontrol .............. (1996) Mr. Prospector Yarn .................................. Narrate By GIANT'S CAUSEWAY (1997). European horse of the year, black-type win - ner of $3,078,989, Esat Digifone Irish Champion S. [G1] , etc. Leading sire 3 times, sire of 13 crops of racing age, 2342 foals, 1788 starters, 165 black- type winners, 1171 winners of 3444 races and earning $145,243,033, 8 champions, including Shamardal ($1,931,770, Gainsborough Poule d'Essai des Poulains-French Two Thousand Guineas [G1] , etc.), Take Charge Brandi [G1] ($1,692,126), and of Aragorn (IRE) [G1] , Carpe Diem [G1] . 1st dam SPUNOUTACONTROL , by Wild Again. 4 wins in 5 starts to 4, $86,405, Singing Beauty S.-R (LRL, $26,145). Dam of 8 foals, 5 to race, all winners, incl.-- FED BIZ (c. by Giant's Causeway). Black-type winner, below. SPUN SILK (f. by A.P. Indy). 2 wins at 3, $65,750, Ride Sally S.-R (AQU, $40,050). Dam of 3 foals to race, including-- JOKING (g. by Distorted Humor). 9 wins, 3 to 7, 2016, $636,138, True North S. [G2] (BEL, $137,500), Diablo S. [L] (BEL, $60,000). Whichwaydidshego (f. by Storm Cat). Winner at 2, $32,420. Dam of-- MARK MY WAY (g. by Noonmark). 7 wins, 2 to 5, 2016, $235,594, New York Stallion S.-R (BEL, $60,000), New York Stallion Series S.-R (SAR, $60,000).
    [Show full text]
  • CARPE DIEM Chestnut Horse; Foaled 2012 Storm Bird Storm Cat
    CARPE DIEM Chestnut Horse; foaled 2012 Storm Bird Storm Cat .......................... Terlingua Giant's Causeway .............. Rahy Mariah's Storm ................ Immense CARPE DIEM Unbridled Unbridled's Song .............. Trolley Song Rebridled Dreams ............ (2000) Corridor Key Key Cents .......................... Centimeter By GIANT'S CAUSEWAY (1997). European horse of the year, black-type winner of $3,078,989, Esat Digifone Irish Champion S. [G1] , etc. Leading sire 3 times, sire of 15 crops of racing age, 2435 foals, 1831 starters, 168 black- type winners, 1210 winners of 3563 races and earning $149,977,145, 8 champions, including Shamardal ($1,931,770, Gainsborough Poule d'Essai des Poulains-French Two Thousand Guineas [G1] , etc.), Take Charge Brandi [G1] ($1,692,126), and of Aragorn (IRE) [G1] ($1,529,325), Giant Oak [G1] . 1st dam REBRIDLED DREAMS , by Unbridled's Song. 4 wins at 2 and 3, $134,663, Money Penny S. (HAW, $25,920), 3rd Silverbulletday S. [G2] (FG, $16,500). Dam of 9 foals, 8 to race, 7 winners, including-- CARPE DIEM (c. by Giant's Causeway). Black-type winner, below. J. B.'S THUNDER (c. by Thunder Gulch). 2 wins at 2, $280,130, Dixiana Breeders' Futurity [G1] (KEE, $240,000). FARRELL (f. by Malibu Moon). 4 wins in 6 starts at 2 and 3, 2017, $361,357, Rachel Alexandra S. [G2] (FG, $120,000), Golden Rod S. [G2] (CD, $115,320), Silverbulletday S. [L] (FG, $90,000), 3rd Rags to Riches S. (CD, $8,087). DONCASTER ROVER (c. by War Chant). 5 wins, 2 to 5, £198,107, in Eng - land, Debenhams City of York S., Flight Centre Chester Queensferry S., Novae Bloodstock Insurance Hopeful S., 2nd Timeform Jury John of Gaunt S.
    [Show full text]
  • NORTHERN CAUSEWAY Ch, 2008
    Enters Stud in 2015 NORTHERN CAUSEWAY ch, 2008 Dosage (4-1-23-0-0); DI: 1.43; CD: 0.32 See gray pages—Nearctic RACE AND (STAKES) RECORD Storm Bird, 1978 Northern Dancer, by Nearctic 6s, SW, $169,181 Age Starts 1st 2nd 3rd Earned Storm Cat, 1983 681 f, 64 SW, 2.27 AEI South Ocean, by New Providence 2 1 0 0 0 $560 8s, SW, $570,610 3 11 4(2) 3 0 $211,311 1,414 f, 181 SW, 2.96 AEI Terlingua, 1976 Secretariat, by Bold Ruler 17s, SW, $423,896 4 10 1 0 3(1) $39,201 Giant's Causeway, ch, 1997 13s, SW, $3,078,989 11 f, 9 r, 6 w, 2 SW Crimson Saint, by Crimson Satan 5 6 0 1 0 $9,990 2,030 f, 156 SW, 1.84 AEI Rahy, 1985 Blushing Groom, by Red God 6 2 0 0 1 $4,305 8.51 AWD 13s, SW, $347,767 Totals 30 5(2) 4 4(1) $265,367 Mariah's Storm, 1991 1,131 f, 96 SW, 2.22 AEI Glorious Song, by Halo 16s, SW, $724,895 Won At 3 12 f, 10 r, 7 w, 2 SW Immense, 1979 Roberto, by Hail to Reason British Columbia Derby (Can-III, $200,660, 9f in 28s, SW, $123,324 1:50.22, dftg. Jebrica, Arraignment, Commander, 6 f, 6 r, 5 w, 3 SW Imsodear, by Chieftain Couldabenthewhisky, Northern Indy, Herbie D, Line Deputy Minister, 1979 Vice Regent, by Northern Dancer Change, Hurricane Lake, Inhisglory, Winter 22s, SW, $696,964 Warlock, Fransor’s Finest).
    [Show full text]
  • ANGLIANAANGLIANA 2002 Chestnut - Dosage Profile: 7-1-25-1-0; DI: 1.52; CD: +0.41
    ANGLIANAANGLIANA 2002 Chestnut - Dosage Profile: 7-1-25-1-0; DI: 1.52; CD: +0.41 Nearctic RACE AND (STAKES) RECORD Northern Dancer Natalma Age Starts 1st 2nd 3rd Earnings Storm Bird New Providence 2 2 1 0 0 $27,450 South Ocean Shining Sun 3 8 1 1(1) 2 58,765 Storm Cat Bold Ruler 4 7 2 3(2) 0 112,447 Secretariat Somethingroyal 5 2 0 1(1) 1(1) 29,220 Terlingua Crimson Satan 6 9 1(1) 4(1) 3(3) 161,880 Crimson Saint Bolero Rose Giant's Causeway (1997) 7 2 0 0 0 170 Red God Blushing Groom (FR) 8 1 0 0 0 1,200 Runaway Bride (GB) Rahy 31 5(1) 9(5) 6(4) $391,132 Halo Glorious Song Ballade Mariah's Storm At 2, WON a maiden special weight race at Aqueduct (1 Hail to Reason Roberto Bramalea 1/16 mi., defeating Curlew Road, King’s Choice, Cap- Immense Chieftain tain Slew, etc.). Imsodear Ironically At 3, WON an allowance race at Belmont Park (1 3/8 mi., Angliana Native Dancer Raise a Native turf, defeating Prep School, Swordsman (GER), Victory Raise You Mr. Prospector Circle, etc.), 2nd Lawrence Realization S.-L at Nashua Gold Digger Sequence Belmont Park (1 1/8 mi., to Taming the Tiger, defeating Jade Hunter Lyphard Crown Point, Swordsman (GER), etc.). Pharly Comely (FR) At 4, WON an allowance race at Delaware Park (1 1/16 mi., top Jadana (IRE) *Match II Janina weight of 123 lbs., defeating Golden Rainbow, Belongs to Jennifer Pratella (1995) Joe, Letterman’s Humor, etc.), an allowance race at Del- Hail to Reason Halo Cosmah aware Park (1 1/16 mi., by 4 3/4 lengths, defeating Pay the Devil's Bag *Herbager Preacher, Orlop, Baby League, etc.), 2nd Red Smith H.- Ballade Miss Swapsco G3 at Aqueduct (1 1/4 mi., to Naughty New Yorker, de- Dancing Devlette Northern Dancer Nijinsky II feating Crown Point, Chilly Rooster, etc.), Gallant Fox Flaming Page Terpsichorist H.
    [Show full text]
  • Ami's Holiday
    AMI’S HOLIDAY 2011 Bay - Dosage Profile: 2-1-5-0-0; DI: 2.20; CD: +0.63 RACE AND (BLACK-TYPE) RECORD Northern Dancer Storm Bird South Ocean Age Starts 1st 2nd 3rd Earnings Storm Cat Secretariat 2 4 2(1) 0 1(1) $183,460 Terlingua Crimson Saint 3 6 1(1) 1(1) 3(3) 601,800 Harlan Hail to Reason 4 6 0 0 2(2) 36,860 Halo Cosmah 5 6 1 0 1 (1) 52,440 Country Romance Gun Bow 22 4(2) 1(1) 7(7) $874,560 Sweet Romance *Suiti Harlan’s Holiday (1999) Raise a Native Exclusive Native At 2, WON Grey S. [G3] at Woodbine (1 1/16 mi., defeating Exclusive Affirmed Big Bazinga, Go Greeley, Give No Quarter), a maiden spe- Crafty Admiral Won’t Tell You cial weight race at Woodbine (6 fur., by 3 1/4 lengths, Scarlet Ribbon Christmas in Aiken What a Pleasure defeating Bear’s Cowboy, Divine Sonet, Tower of Texas, Honest Pleasure *Tularia etc.), 3rd Display S. [L] at Woodbine (1 1/16 mi., to Jose Dowager *Princequillo Princessnesian Sea View, Coltimus Prime, defeating Danzig Storm, etc.). Alanesian Ami’s Holiday At 3, WON Breeders’ S. at Woodbine (1 1/2 mi., turf, Mr. Prospector Fappiano equal top weight of 126 lbs., defeating Interpol, Squeeze Killaloe Cryptoclearance Hoist the Flag the King, Bangkok, etc.), 2nd Queen’s Plate at Naval Orange Mock Orange Woodbine (1 1/4 mi., to Lexie Lou, defeating Asserting Victory Gallop Northern Dancer Vice Regent Bear, We Miss Artie, etc.), 3rd Prince of Wales S.
    [Show full text]
  • CHESTNUT FILLY Barn 20 & 21 Hip No
    Consigned by Eaton Sales, Agent Hip No. CHESTNUT FILLY Barn 176 Foaled April 1, 2015 20 & 21 Storm Bird Storm Cat .......................... Terlingua Giant's Causeway .............. Rahy Mariah's Storm ................ Immense CHESTNUT FILLY In the Wings Singspiel .......................... Glorious Song Andina (IRE) ...................... (2007) Rahy Fragrant Oasis .................. Raahia By GIANT'S CAUSEWAY (1997). European horse of the year, black-type win - ner of $3,078,989, Esat Digifone Irish Champion S. [G1] , etc. Leading sire 3 times, sire of 13 crops of racing age, 2342 foals, 1774 starters, 164 black-type winners, 1161 winners of 3401 races and earning $143,815,- 971, 8 champions, including Shamardal ($1,931,770, Gainsborough Poule d'Essai des Poulains-French Two Thousand Guineas [G1] , etc.), Take Charge Brandi [G1] ($1,692,126) and of Aragorn [G1] ($1,529,325). 1st dam ANDINA (IRE) , by Singspiel. 4 wins, 2 to 4, $282,047, in N.A./U.S., Osunitas S.- R (DMR, $54,984), 2nd Providencia S. [G2] (SA, $30,000), Senorita S. [G3] (HOL, $20,000), Redondo Beach S.-R (HOL, $14,860), 3rd Royal Heroine Mile S. [G2] (HOL, $18,000), China Doll S. (SA, $7,758); placed in 1 start at 2 in England. (Total: $282,982). Dam of 1 other registered foal-- Spiritous (c. by Invincible Spirit). Winner at 2, 2016, £6,506, in England. (Total: $9,318). 2nd dam FRAGRANT OASIS , by Rahy. Winner at 2 and 3, £36,326, in England, Milcars King Charles II S., 2nd Oh So Sharp S., 3rd Oak Tree S., Stanley Racing Summer S. (Total: $59,758).
    [Show full text]
  • BAY FILLY Barn 5 Hip No. 41
    Property of Woodford Thoroughbreds LLC Barn Hip No. 5 BAY FILLY 41 Foaled February 21, 2010 Storm Bird Storm Cat ......................... Terlingua Giant's Causeway.............. Rahy Mariah's Storm................. Immense BAY FILLY Raise a Native Mr. Prospector.................. Gold Digger Bless................................. (1999) Danzig Angel Fever....................... Rowdy Angel By GIANT'S CAUSEWAY (1997). European horse of the year, black-type win- ner of $3,078,989, Esat Digifone Irish Champion S. [G1], etc. Leading sire twice, sire of 8 crops of racing age, 1458 foals, 998 starters, 96 black-type winners, 638 winners of 1698 races and earning $76,282,687, including champion Shamardal ($1,931,770, Prix du Jockey Club-French Derby [G1], etc.), and of Primary [G3] (hwt. in Italy), Man of Iron [L] (hwt. at 3 in Ireland), Aragorn (IRE) [G1] ($1,529,325), Giant Oak [G1] ($1,322,829). 1st dam BLESS, by Mr. Prospector. Unraced. Sister to FUSAICHI PEGASUS. Dam of 5 other registered foals, 5 of racing age, including a 2-year-old of 2011, 3 to race, 2 winners-- BRAVE TIN SOLDIER (r. by Storm Cat). Winner at 2, €35,805, in Ireland, Laing O'Rourke Blenheim S.; placed at 2, £11,848, in England; winner at 5, 531,212 dirhams, in U.A.E.; 2 wins at 5, $123,697, in N.A./U.S., Cliff Hanger S. [G3] (MED, $75,000), 3rd Knickerbocker S. [G3] (BEL, $10,- 650). (Total: $335,935). Fusaichi Giga Dia (c. by Storm Cat). 7 wins, 3 to 6, ¥68,919,000, in Japan. (Total: $632,973). 2nd dam Angel Fever, by Danzig.
    [Show full text]