PEDIGREE INSIGHTS: by T.D
Total Page:16
File Type:pdf, Size:1020Kb
Load more
										Recommended publications
									
								- 
												  Yearling Sale Season Concludes with Fasig-TiptonMONDAY, OCTOBER 26, 2020 THE OLD MAN AND THE SPRINT YEARLING SALE SEASON The Week in Review by T.D. Thornton CONCLUDES WITH The final chapters have yet to be penned in Whitmore (Pleasantly Perfect)'s book, but it's safe to say the 7-year-old FASIG-TIPTON OCTOBER sprinter is in the autumn of his career. He's a closer who has excelled in a division where out-and-out front-end speed often dominates, he's run in three consecutive GI Breeders' Cup Sprints that have each drawn as "loaded" affairs won by the eventual Eclipse Award champ, and he'll seek his first Breeders' Cup win in start number four over a host track (Keeneland) whose main-track profile has been tilted toward forwardly placed runners during both of its 2020 meets. Nevertheless, trainer Ron Moquett wouldn't trade horses or places with anyone leading up to the Nov. 7 Sprint. Sunday morning at Churchill, Whitmore went a half mile in :46.80 (1/76) in his final serious breeze before the Breeders' Cup. Cont. p4 IN TDN EUROPE TODAY SUBJECTIVIST LANDS THE G1 PRIX ROYAL OAK Newtown Paddocks | Fasig-Tipton photo Subjectivist (GB) (Teofilo {Ire}) earned his first Group 1 win in the Prix Royal Oak at ParisLongchamp on Sunday. Click or by Jessica Martini tap here to go straight to TDN Europe. LEXINGTON, KY - The curtain comes down on a most unusual yearling sales season with the Fasig-Tipton Kentucky October Sale which begins its four-day run in Lexington Monday at 10 a.m.
- 
												  A Catalogue Page Lovingly Prepared by Weatherbys0327W70.GUI 00Portraitofmylove (IRE)|2019|C|A|2680933 352 Consigned by Trickledown Stud (Agent) 352 With VAT Sadler's Wells Galileo Urban Sea Ulysses (IRE) BAY COLT (GB) Light Shift Kingmambo March 17th, 2019 Lingerie Night Shift Portraitofmylove Azamour Asmara (IRE) Green Desert (2009) Flashing Green Colorsnap E.B.F. Nominated. B.C. Nominated. 1st dam PORTRAITOFMYLOVE (IRE): ran; dam of 5 previous foals; 4 runners; 1 winner: Paramount Love (GB) (15 f. by Pivotal (GB)): winner at 3 and placed 5 times. Locket (GB) (18 f. by Bated Breath (GB)): placed twice at 2, 2020. Miss Dancealot (GB) (17 f. by Sir Prancealot (IRE)): ran at 2 and 3, 2020. 2nd dam FLASHING GREEN (GB): winner at 3 in Germany; dam of 14 foals; 13 runners; 8 winners inc.: THA'IR (IRE) (g. by New Approach (IRE)): 11 wins to 2019 at home, in Turkey and in U.A.E. and £340,322 inc. Chesham S., L., Gala S., L. and Anatolia Trophy, L., 2nd Solario S., Gr.3, Fairway S., L., 3rd Champagne S., Gr.2. FLASHING COLOUR (GER) (f. by Pivotal (GB)): 3 wins in Germany inc. BMW Preis Dusseldorf Wettchance Tages, L., 2nd Preis der Spielbank Hamburg, Gr.3, Grosser Preis der Frankfurter Volksbank, L.; dam of winners. Flash Dance (GER) (c. by Monsun (GER)): 5 wins in France, in Germany and in Switzerland and £61,391, placed 2nd Preis der Ostdeutschen Sparkassen, L. 3rd dam COLORSNAP (by Shirley Heights): unraced; dam of 12 foals; 8 runners; 7 winners inc.: CROESO CARIAD (GB): Champion 2yr old filly in Italy in 1999, 2 wins at 2 at home and in Italy and £49,678 inc.
- 
												  Testimony of Marty Irby Executive Director Animal Wellness Action Before the U.STestimony of Marty Irby Executive Director Animal Wellness Action before the U.S. House Subcommittee on Commerce and Consumer Protection H.R. 1754, "The Horseracing Integrity Act" January 28, 2020 On behalf of Animal Wellness Action, one of the nation's leading animal protection organizations on Capitol Hill, I submit this testimony in support of H.R. 1754, the Horseracing Integrity Act. I express my sincere thanks to Chair Jan Schakowsky and Ranking Member Cathy McMorris Rodgers for conducting this hearing and offer special thanks to Representatives Paul Tonko, and, Andy Barr for introducing this reform effort. I also express thanks to Energy and Commerce Committee Chair Frank Pallone and Ranking Member Greg Walden for their participation in this process. This hearing builds on the testimony and other information gathered during the 2018 hearing conducted before the Subcommittee on H.R. 2651 in the 115th Congress. I first want to underscore that Animal Wellness Action does not oppose horseracing. We join with many horse owners, breeders, trainers, and racing enthusiasts in speaking out on the broader topic of the protection of horses within the American horseracing industry and across the greater equine world. We seek to promote the proper stewardship of horses at every stage of their lives, including during their racing careers. We are deeply concerned about on- and off- track risks to the horses, including catastrophic injuries sustained during racing. America was built on the backs of horses, and they have always played a central role in the economy and culture of the United States. We owe them a debt of gratitude, and the very least we must do is ensure their safety, welfare, and protection.
- 
												  Graydar OxbowGRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
- 
												  Ulysses Late Dash for Glory in Saturday's King George VI & QueenAscot Racecourse Media Release for immediate release, Tuesday, July 25, 2017 Ulysses late dash for glory in Saturday's King George VI & Queen Elizabeth Stakes (Sponsored by QIPCO) Ulysses, who re-opposes his G1 Prince of Wales's Stakes conqueror Highland Reel in the King George VI & Queen Elizabeth Stakes (Sponsored by QIPCO), will be held up as long as possible in a bid to reverse the placings at Ascot on Saturday, July 29. Alan Cooper, racing manager to the Niarchos Family which owns Ulysses, said today: "In the Prince Of Wales's Stakes, maybe Ulysses thought job done when he hit the front, and we had to hold him up a bit more. "Jim Crowley did that when Ulysses won the Eclipse but even then he said to me 'I would have liked to have been more patient'. "As a horse matures, you learn more about him and what tactics he is comfortable with. A daring ride is the way it looks like." This was revealed today when QIPCO and Ascot Racecourse hosted a media event this afternoon ahead of the 2017 King George VI & Queen Elizabeth Stakes (Sponsored by QIPCO), which is Britain's premier all-aged middle-distance contest and boasts a prize fund of £1.15-million. Ulysses is out to give trainer Sir Michael Stoute an unprecedented sixth win in the Ascot race, with his previous success coming with runaway winner Harbinger in 2010. It was Ulysses who provided Stoute with his sixth G1 Eclipse Stakes earlier this month when beating Barney Roy by a nose.
- 
												  Fayeq Hopes to Follow in Sister=S HoofprintsTHURSDAY, AUGUST 24, 2017 FAYEQ HOPES TO FOLLOW MICHELE BOYCE DEFIES DIABETES AMID CAREER YEAR by Lynne Snierson IN SISTER=S HOOFPRINTS Every morning, Michele Boyce arrives at her Arlington Park barn, digs into a trusty bucket and heads down the shedrow to give each of the 32 horses entrusted to her care personalized attention. ARight after I put the coffee on, I have my peppermints in hand and off we go,@ said Boyce, a graded stakes winning-trainer and multiple award-winning Illinois owner and breeder, who is well on her way to a career year. AIt gives me an opportunity to have each one come right up to the stall door and then I can go over them. I examine legs and anything else as need be. If one of my eager eaters refuses a mint I know right away something is wrong, like if one is coming down with a virus or is pre-colic, or anything else.@ Cont. p4 (Click here) IN TDN EUROPE TODAY Rachel Alexandra winning the 2009 GI Woodward S. | Sarah Andrew ULYSSES STORMS TO JUDDMONTE WIN Flaxman Stables’s 4-year-old Ulysses (Ire) (Galileo {Ire}) upstaged Churchill and Barney Roy to win Wednesday’s by Christie DeBernardis G1 Juddmonte International at York. SARATOGA SPRINGS, N.Y.--Hall of Famer Rachel Alexandra Click or tap here to go straight to TDN Europe. (Medaglia d=Oro) achieved one of her career highlights at Saratoga when defeating older males in the 2009 GI Woodward S., after which she was named both Horse of the Year and champion 3-year-old filly.
- 
												  Index to Consignors Hip Color & NoIndex to Consignors Hip Color & No. Sex Name, Year Foaled Sire Dam Barn 12 Consigned by Anderson Farms, Agent Broodmare prospect 684 b. m. Elegant Effort, 2002 Alydeed Every Effort Barn 2 Property of Ashleigh Stud Yearling 329 dk. b./br. c. unnamed, 2006 Fusaichi Pegasus Dixie Talking Barn 8 Property of F. Gill Aulick (Cedar Point Farm) Yearling 97 gr/ro. c. unnamed, 2006 Whywhywhy Onesta Barn 8 Consigned by F. Gill Aulick (Cedar Point Farm), Agent Yearlings 174 dk. b./br. f. unnamed, 2006 Johannesburg Spankin 'n Fannin 257 b. c. unnamed, 2006 Chapel Royal Anna's Angel 349 gr/ro. c. unnamed, 2006 Hennessy Formal Process Barn 8 Consigned by F. Gill Aulick (Cedar Point Farm), Agent for J. Phillip Mote Yearling 163 dk. b./br. f. unnamed, 2006 Stormy Atlantic Silvery Pet Barn 7 Consigned by Belvedere Farm, Inc. (Marty Takacs), Agent IV Yearling 1 b. c. unnamed, 2006 Zavata Halo My Baby Barn 7 Consigned by Belvedere Farm, Inc. (Marty Takacs), Agent V Yearling 326 dk. b./br. c. unnamed, 2006 Orientate Desireux Barn 10 Property of Blake Agency Yearlings 130 ch. c. unnamed, 2006 Whywhywhy Residential 144 dk. b./br. f. unnamed, 2006 Officer Sarah's Approval Barn 12 Consigned by Blandford Stud (Padraig Campion), Agent Broodmare 576 b. m. Vacacionada (ARG), 1995 Southern Halo Valery Toss Yearling 672 ch. c. unnamed, 2006 Lion Heart Danube Barn 24 Consigned by Bluegrass Thor. Services, Inc. (J. Stuart), Agent I Broodmare 656 ch. m. Cherie Baby, 1994 Ogygian My Cherie Amour Yearling 657 dk. b./br.
- 
												  CHESTNUT COLT Barn 31 Hip NoConsigned by Claiborne Farm, Agent Barn Hip No. 31 CHESTNUT COLT 845 Foaled April 25, 2006 Storm Bird Storm Cat ......................... Terlingua Forestry ............................ Pleasant Colony Shared Interest.................. Surgery CHESTNUT COLT Mr. Prospector Forty Niner........................ File Tour .................................. (1990) Full Pocket Fun Flight ......................... Fun and Tears By FORESTRY (1996). Stakes winner of $591,225, King's Bishop S. [G1], etc. Sire of 5 crops of racing age, 403 foals, 208 starters, 27 stakes winners, 139 winners of 327 races and earning $11,442,572 & $130,795(CAN) in N.A., including Smokey Glacken ($656,960, Distaff Breeders' Cup H. [G2] (AQU, $94,800), etc.), Diplomat Lady ($552,784, Hollywood Starlet S. [G1] (HOL, $273,600), etc.), Old Forester [G3] ($451,080 & $13,848 (CAN)), Forest Danger ($423,000, Carter H. [G1] (AQU, $210,000), etc.). 1st dam TOUR, by Forty Niner. 5 wins, 2 to 4, $254,939, Curious Clover H. [L] (HOL, $29,100), 2nd Bold Jill H. [L] (SA, $10,000), CERF H. [L] (HOL, $10,000), Very Subtle H.-R (HOL, $11,000), Frosty Shades H. (GG, $6,000), etc. Sister to FLIGHT FORTY NINE. Dam of 8 other registered foals, 8 of rac- ing age, including a 2-year-old of 2007, 6 to race, 4 winners-- TRIP (f. by Lord At War (ARG)). 11 wins, 3 to 5, $888,773, Turfway Breed- ers' Cup S. [G3], Turfway Breeders’ Cup S. [G3] (TP, $125,500), Chi- cago Breeders' Cup H. [G3], Bourbonette Breeders' Cup S. [L] (TP, $93,600), Iowa Oaks [L] (PRM, $90,000), Fairway Fun S. [L] (TP, $31,- 300), 2nd Delaware Oaks [G3], Regret S.
- 
												  ETCHED Chestnut Horse, 2005; 16.3 Hands DIPLOMAT LADY: 4 Wins, $552,784, Hollywood Starlet S-G1, Beaumont S-G2, EtcETCHED Chestnut Horse, 2005; 16.3 Hands DIPLOMAT LADY: 4 wins, $552,784, Hollywood Starlet S-G1, Beaumont S-G2, etc. Storm Bird Northern Dancer FOREST DANGER: 5 wins, $423,000 in 8 starts, Carter H-G1, etc. Sire. South Ocean Storm Cat QUIZ KID: 6 wins, $200,701 to 5, 2016 in Argentina, Gran Premio Estrellas Clas- Terlingua Secretariat sic-G1, Premio Pr Progreso-G3 twice, etc. Forestry Crimson Saint FANTASTIC FOUR: 5 wins, $168,289 to 4, 2016 in Argentina, Gran Premio Joaquin Bay, 1996 His Majesty V. Gonzalez-G1, Premio 25 De Mayo De 1810-G2, etc. Pleasant Colony Sun Colony Shared Interest SMOKEY GLACKEN: 10 wins, $656,960, Distaff Breeders’ Cup H-G2, etc. Dr. Fager Surgery Bold Sequence HOMERUN BERTI: 22 wins, $496,397 to 10, 2016, Lea County Sprint S, etc. OLD FORESTER: 6 wins, $462,632, Cliff Hanger S-G3, Canadian Turf H, Santa Unbridled Fappiano Claus S, etc. Set ncr at Gulfstream Park. Sire. Unbridled’s Song Gana Facil Trolley Song Caro (Ire) Unbridled Elaine Lucky Spell FEMALE LINE Gray or Roan, 1998 In Reality UNBRIDLED ELAINE. 6 wins at 2 and 3, $1,770,740, Breeders’ Cup Distaff Taylor’s Falls Nilene Wonder Carols Folly S-G1, Monmouth Breeders’ Cup Oaks-G2, Iowa Oaks, Pocahontas S, No Trespassing Bob’s Dusty Private Parking 2nd Pennsylvania Derby-G3, etc. Dam of 8 foals, 4 to race, 3 winners— ETCHED (Forestry). Stakes winner. Dosage Profile: 4 11 7 0 0 OUT OF BOUNDS (Discreet Cat). 3 wins, 2 to 4, $177,673 in U.S., U.A.E.
- 
												  Top Beyer Speed Figures • 1993-2018TOP BEYER SPEED FIGURES • 1993-2018 2-year-olds, 1993 2-year-olds, 1996 Beyer Beyer No. Horse Track Dist Date No. Horse Track Dist Date 106 VALIANT NATURE HOL 8.5 12/19/1993 108 THISNEARLYWASMINE SA 6 10/23/1996 105 BROCCO HOL 8.5 12/19/1993 107 KELLY KIP SAR 6 07/26/1996 105 POLAR EXPEDITION AP 6 08/14/1993 106 IN EXCESSIVE BULL SA 6 10/23/1996 103 HOLY BULL BEL 7 09/18/1993 104 HOLZMEISTER HAW 8.5 11/17/1996 102 DEHERE BEL 7 09/18/1993 104 KELLY KIP BEL 5 06/21/1996 101 HOLY BULL MTH 5.5 08/14/1993 103 IN C C’S HONOR LRL 6 12/21/1996 100 FLYING SENSATION HOL 8.5 12/19/1993 102 DIXIE FLAG (F) AQU 6 11/24/1996 100 SARDULA (F) DMR 7 09/04/1993 101 CAPTAIN BODGIT LRL 9 11/02/1996 99 BLUMIN AFFAIR HOL 8.5 12/19/1993 101 GOLD CASE FG 6 12/30/1996 99 INDIVIDUAL STYLE HOL 7 11/26/1993 101 IN EXCESSIVE BULL HOL 7 11/10/1996 99 YOU AND I AQU 7 10/20/1993 101 IN EXCESSIVE BULL SA 6 10/05/1996 Champion 2-year-old male Dehere had one of the highest Beyer Speed 101 MUD ROUTE HOL 6.5 12/15/1996 Figures of the season, but Valiant Nature earned the highest when beating 101 ORDWAY BEL 8.5 10/05/1996 Breeders’ Cup Juvenile winner Brocco in the Hollywood Futurity.
- 
												  LEADERS Oppenheim: Constitution, American Pharoah Top Second-Crop Sires See Page 4MONDAY, JUNE 1, 2020 BLOODHORSE.COM/DAILY ANNE M. EBERHARDT ANNE M. LEADERS Oppenheim: Constitution, American Pharoah Top Second-Crop Sires See page 4 IN THIS ISSUE 11 Quality Road, Blame Colts Shine at OBS Under Tack Show 13 Ward Hones Stable Roster for Royal Ascot Bid 17 Grade 1-Winning Sprinter Imperial Hint Retired BLOODHORSE DAILY Download the FREE smartphone app PAGE 1 OF 30 CONTENTS 4 Oppenheim: Constitution, American Pharoah Top Second-Crop Sires 10 Leading KY Sires by % Black-Type Performers 11 Quality Road, Blame Colts Shine at OBS Under Tack Show 13 Ward Hones Stable Roster for Royal Ascot Bid 15 Fighting Mad Makes It Look Easy in Santa Maria Stakes 16 Dynasty of Her Own Makes All in California Oaks 17 Grade 1-Winning Sprinter Imperial Hint Retired 21 NYRA Making Safety a Priority at Belmont Park 23 Authentic Has Final Work Ahead of Santa Anita Derby 23 Mr Havercamp Retired With Pelvis Injury 24 Contrail Remains Undefeated With Japanese Derby Romp 25 Victor Ludorum Heads Fabre Trio in French Guineas 26 Tropbeau Headlines French One Thousand Guineas 27 Relieved Trainers Prepare to Resume Racing in Britain 28 Results & Entries ANNE M. EBERHARDT ANNE M. 2020 PENNSYLVANIA Still searching for the perfect match for your mare? STALLION Click to view our 2020 Stallion Directory & BOARDING FARM DIRECTORY pabred.com A publication of The Jockey Club Information Systems, Inc. and TOBA Media Properties, Inc. ON THE COVER Editorial Director General Manager WinStar Farm’s Constitution is almost on even terms Evan Hammonds Scott Carling with leading second-crop sire American Pharoah Visuals Director Managing Editor Anne M.
- 
												  Breeze-Up Evolution Continues with Classy Arqana OfferingFRIDAY, 28 MAY 2021 BREEZE-UP EVOLUTION EUCHEN GLEN SPRINGS A SURPRISE IN THE BRIGADIER GERARD CONTINUES WITH CLASSY Thursday=s G3 Coral Brigadier Gerard S. in memory of Joe Mercer saw an upset, as the 20-1 shot Euchen Glen (GB) ARQANA OFFERING (Authorized {Ire}) coming out firmly on top of the younger brigade with the soft ground in his favour. Off the track for nearly two years following his win in York=s John Smith=s Cup in 2018, the bay had hit a rich vein of form in October when registering career-best successes in that track=s G3 Cumberland Lodge S. and the G3 St Simon S. at Newbury. Looking to have gone over the hill when eighth in the G3 John Porter S. at Newbury Apr. 18 and a distant seventh in the G3 Ormonde S. at Chester May 6, he found things falling in his favour here to return to winning ways in style despite his penalty. Cont. p3 IN TDN AMERICA TODAY Classic winner Jet Setting is the dam of lot 22 from Star Bloodstock BERGER SHEPHERDS DUO INTO THE BELMONT FOLD De Burgh Productions Chris McGrath speaks with Woodstock Farm owner Ben Berger, where Hot Rod Charlie (Oxbow) and Rombauer (Twirling Candy) were raised. Click or tap here to go straight to TDN America. By Emma Berry DONCASTER, UKBBOn paper, there has been clear evidence over a number of years that the breeze-up sector has collectively raised its game when it comes to the quality of product on offer. Many of the 2-year-olds who will pass through the ring in Doncaster on Friday for the relocated and slightly delayed Arqana Breeze-Up Sale would not have looked out of place in an elite yearling sale.