DOCSLIB.ORG

The Green Monkey Bay Horse; Feb 04, 2004 View Complete Auction History 3 Starts, Placed Click Here for Interactive Nicking

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
The Green Monkey Bay Horse; Feb 04, 2004 View Complete Auction History 3 Starts, Placed Click Here for Interactive Nicking equineline.com Product 10N 11/30/16 15:12:38 EST The Green Monkey Bay Horse; Feb 04, 2004 View Complete Auction History 3 Starts, Placed Click here for Interactive Nicking Nearctic, 54 br Northern Dancer, 61 b Natalma, 57 b Storm Bird, 78 b New Providence, 56 b South Ocean, 67 b Shining Sun, 62 b Storm Cat, 83 dk b/ Bold Ruler, 54 dk b Secretariat, 70 ch Somethingroyal, 52 b Terlingua, 76 ch Crimson Satan, 59 ch Crimson Saint, 69 ch Bolero Rose, 58 ch Forestry, 96 b *Ribot, 52 b His Majesty, 68 b Flower Bowl, 52 b Pleasant Colony, 78 dk b/ Sunrise Flight, 59 dk b Sun Colony, 68 b *Colonia, 59 b Shared Interest, 88 b Rough'n Tumble, 48 b Dr. Fager, 64 b Aspidistra, 54 b Surgery, 76 b Bold Ruler, 54 dk b Bold Sequence, 61 br Sequence, 46 dk b The Green Monkey Bay Horse Raise a Native, 61 ch Foaled Feb 04, 2004 Mr. Prospector, 70 b in Florida Gold Digger, 62 b Fappiano, 77 b 3 Starts Dr. Fager, 64 b Placed Killaloe, 70 b Grand Splendor, 62 b Unbridled, 87 b =Wild Risk (FR), 40 b *Le Fabuleux, 61 ch =Anguar (FR), 50 b Gana Facil, 81 ch In Reality, 64 b Charedi, 76 dk b/ Magic, 69 dk b/ Magical Masquerade, 98 ch Intentionally, 56 blk In Reality, 64 b My Dear Girl, 57 ch Valid Appeal, 72 b Moslem Chief, 57 b Desert Trial, 63 ch Scotch Verdict, 60 ch Nannerl, 87 ch Proud Clarion, 64 b Proud Birdie, 73 b Bernie Bird, 65 dk b/ Allouette, 80 b Bayou Bourg, 59 ch Madame Defage, 67 ro Let's Misbehave, 55 gr Breeder: Padua Stables (FL) Inbreeding: Dr. Fager: 4S X 5D Dosage Profile: 7 13 8 0 2 Bold Ruler: 5S X 5S Dosage Index: 4.00 In Reality: 4D X 5D Center of Distribution: +0.77 Most Recent Auction Result: Sale Price: $16,000,000 Sale: Fasig-Tipton Florida Select 2-Year-Olds in Training 2006 Consignor: Hartley/De Renzo Thoroughbreds, agent Buyer: Demi O'Byrne View Complete Auction History Please Note: Nicking Stats and Interactive Nicking are on the following page Copyright © 2016 The Jockey Club Information Systems, Inc. Page 1 of 2 equineline.com Product 10N 11/30/16 15:12:38 EST The Green Monkey Bay Horse; Feb 04, 2004 Nicking Stats for Sire and Broodmare Sire SIRE of The Green Monkey: Forestry TOTALS FOR foals* starters (%) winners (%) BW (%) earnings ($) aei Forestry 1235 905 (73 ) 655 (53 ) 59 (5 ) $52,002,833 1.41 BROODMARE SIRE of The Green Monkey: Unbridled TOTALS FOR mares foals* starters (%) winners (%) BW (%) earnings ($) aei Unbridled 276 1874 1418 (76 ) 1010 (54 ) 78 (4 ) $106,150,134 1.44 Nicking Stats for mares by Unbridled when bred to Forestry mares foals* starters (%) winners (%) BW (%) earnings ($) aei 26 33 26 (79 ) 18 (55 ) 1 (3 ) $4,410,032 3.40 * Foals of racing age Interactive Nicking To generate a second set of Nicking Stats for this Pedigree, click on a Sire and Broodmare Sire combination below to view the results. Forestry with Fappiano mares Storm Cat with Unbridled mares Storm Cat with Fappiano mares Storm Bird with Unbridled mares Storm Bird with Fappiano mares Copyright © 2016 The Jockey Club Information Systems, Inc. Page 2 of 2.
Load more

Recommended publications
  • HEADLINE NEWS • 8/13/07 • PAGE 2 of 8
    Salute the Sarge Takes Best Pal ...p. 4 HEADLINE For information about TDN, call 732-747-8060. NEWS www.thoroughbreddailynews.com MONDAY, AUGUST 13, 2007 MERV GRIFFIN DEAD SAOIRSE SHOCKER Entertainment icon and prominent horse owner Merv Jim Bolger has already made headlines this year with Griffin died Sunday morning of prostate cancer. He was a daughter of Mr. Greeley in Finsceal Beo (Ire) and he 82. Griffin had successfully battled the disease for the unleashed another burgeoning starlet by Gainesway’s better part of 11 years, resident in Saoirse Abu in yesterday’s G1 Independent but was admitted to Ce- Waterford Wedgwood Phoenix S. at The Curragh. Sent dars Sinai Hospital in Los off at 25-1 in first-time blinkers, the chestnut toughed Angeles last month and it out up front and drew on extra reserves to forge a took a turn for the worse length victory from likely defeat as Henrythenavigator a few days ago. Among (Kingmambo) swooped. “She is a different type of Mr. the horses campaigned Greeley,” her trainer commented when asked for a by the creator of the hit comparison with Finsceal Beo. “This is a soft-ground game shows Jeopardy! one, although she doesn’t have to have it soft and she and Wheel of Fortune is brave.” Video, courtesy attheraces.com Cont. p3 was Stevie Wonderboy, the son of Stephen Got THE MAIN MAN Even who was awarded Few horses who stamp their class on the best an Eclipse Award after middle-distance contests can do the same at the top capturing the 2005 re- level over a mile, but Manduro (Ger) (Monsun {Ger}) Merv Griffin 1926 - 2007 newal of the GI Breeders’ achieved the formidable feat in style yesterday when Horsephotos Cup Juvenile (click here collecting Deauville’s G1 Prix du Haras de Fresnay-le- for video of race and in- Buffard-Jacques le Marois.
    [Show full text]
  • Graydar Oxbow
    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
    [Show full text]
  • Oppenheim: the Class of 2015
    WEDNESDAY, MAY 31, 2017 IN THEIR FOOTSTEPS: TEAL ALBERTRANI OPPENHEIM: by Carly Silver THE CLASS OF 2015 A daughter of jockey-turned-trainer Tom Albertrani and his wife, former exercise rider Fonda, 23-year-old Teal Albertrani belies her years with her extensive experience in the Thoroughbred industry. She currently is the director of partner relations for West Point Thoroughbreds. Teal, who currently splits her time between Florida in the winter, Belmont Park in the spring and fall, and Saratoga in the summer, got equine experience from a young age. AIt was definitely always horses from the beginning. I guess I was just born into the industry,@ she said. A former assistant to Hall of Famer Bill Mott, Tom Albertrani was recruited to become an assistant trainer for Sheikh Mohammed bin Rashid al Maktoum's Godolphin Stable in the United Arab Emirates. Cont. p7 Orb | Claiborne Farm IN TDN EUROPE TODAY JOHNSTON CONFIDENT IN PERMIAN Trainer Mark Johnston says Cracksman (GB) (Frankel {GB}) will “have to improve significantly” to beat his Permian (Ire) According to the TDN Sales Statistics tables (click (Teofilo {Ire}) again in Saturday’s G1 Investec Derby. here), five North American sires have averaged Click or tap here to go straight to TDN Europe. over $340,000 at the 2-year-old in training sales this year. The top two are the same two sires which topped the $600,000 mark in 2016 yearling average: Claiborne=s War Front, who had two 2-year-old colts average $512,500, and Gainesway=s three-time champion sire Tapit, who=s had seven 2-year-olds average $493,571.
    [Show full text]
  • CHESTNUT COLT Barn 31 Hip No
    Consigned by Claiborne Farm, Agent Barn Hip No. 31 CHESTNUT COLT 845 Foaled April 25, 2006 Storm Bird Storm Cat ......................... Terlingua Forestry ............................ Pleasant Colony Shared Interest.................. Surgery CHESTNUT COLT Mr. Prospector Forty Niner........................ File Tour .................................. (1990) Full Pocket Fun Flight ......................... Fun and Tears By FORESTRY (1996). Stakes winner of $591,225, King's Bishop S. [G1], etc. Sire of 5 crops of racing age, 403 foals, 208 starters, 27 stakes winners, 139 winners of 327 races and earning $11,442,572 & $130,795(CAN) in N.A., including Smokey Glacken ($656,960, Distaff Breeders' Cup H. [G2] (AQU, $94,800), etc.), Diplomat Lady ($552,784, Hollywood Starlet S. [G1] (HOL, $273,600), etc.), Old Forester [G3] ($451,080 & $13,848 (CAN)), Forest Danger ($423,000, Carter H. [G1] (AQU, $210,000), etc.). 1st dam TOUR, by Forty Niner. 5 wins, 2 to 4, $254,939, Curious Clover H. [L] (HOL, $29,100), 2nd Bold Jill H. [L] (SA, $10,000), CERF H. [L] (HOL, $10,000), Very Subtle H.-R (HOL, $11,000), Frosty Shades H. (GG, $6,000), etc. Sister to FLIGHT FORTY NINE. Dam of 8 other registered foals, 8 of rac- ing age, including a 2-year-old of 2007, 6 to race, 4 winners-- TRIP (f. by Lord At War (ARG)). 11 wins, 3 to 5, $888,773, Turfway Breed- ers' Cup S. [G3], Turfway Breeders’ Cup S. [G3] (TP, $125,500), Chi- cago Breeders' Cup H. [G3], Bourbonette Breeders' Cup S. [L] (TP, $93,600), Iowa Oaks [L] (PRM, $90,000), Fairway Fun S. [L] (TP, $31,- 300), 2nd Delaware Oaks [G3], Regret S.
    [Show full text]
  • 138904 09 Juvenilefilliesturf.Pdf
    breeders’ cup JUVENILE FILLIES TURF BREEDERs’ Cup JUVENILE FILLIES TURF (GR. I) 6th Running Santa Anita Park $1,000,000 Guaranteed FOR FILLIES, TWO-YEARS-OLD ONE MILE ON THE TURF Weight, 122 lbs. Guaranteed $1 million purse including travel awards, of which 55% of all monies to the owner of the winner, 18% to second, 10% to third, 6% to fourth and 3% to fifth; plus travel awards to starters not based in California. The maximum number of starters for the Breeders’ Cup Juvenile Fillies Turf will be limited to fourteen (14). If more than fourteen (14) horses pre-enter, selection will be determined by a combination of Breeders’ Cup Challenge winners, Graded Stakes points and the Breeders’ Cup Racing Secretaries and Directors panel. Please refer to the 2013 Breeders’ Cup World Championships Horsemen’s Information Guide (available upon request) for more information. Nominated Horses Breeders’ Cup Racing Office Pre-Entry Fee: 1% of purse Santa Anita Park Entry Fee: 1% of purse 285 W. Huntington Dr. Arcadia, CA 91007 Phone: (859) 514-9422 To Be Run Friday, November 1, 2013 Fax: (859) 514-9432 Pre-Entries Close Monday, October 21, 2013 E-mail: [email protected] Pre-entries for the Breeders' Cup Juvenile Fillies Turf (G1) Horse Owner Trainer Al Thakhira (GB) Sheikh Joaan Bin Hamad Al Thani Marco Botti B.f.2 Dubawi (IRE) - Dahama (GB) by Green Desert - Bred in Great Britain by Qatar Bloodstock Ltd Chriselliam (IRE) Willie Carson, Miss E. Asprey & Christopher Wright Charles Hills B.f.2 Iffraaj (GB) - Danielli (IRE) by Danehill - Bred in Ireland by Ballylinch Stud Clenor (IRE) Great Friends Stable, Robert Cseplo & Steven Keh Doug O'Neill B.f.2 Oratorio (IRE) - Chantarella (IRE) by Royal Academy - Bred in Ireland by Mrs Lucy Stack Colonel Joan Kathy Harty & Mark DeDomenico, LLC Eoin G.
    [Show full text]
  • ETCHED Chestnut Horse, 2005; 16.3 Hands DIPLOMAT LADY: 4 Wins, $552,784, Hollywood Starlet S-G1, Beaumont­ S-G2, Etc
    ETCHED Chestnut Horse, 2005; 16.3 Hands DIPLOMAT LADY: 4 wins, $552,784, Hollywood Starlet S-G1, Beaumont S-G2, etc. Storm Bird Northern Dancer FOREST DANGER: 5 wins, $423,000 in 8 starts, Carter H-G1, etc. Sire. South Ocean Storm Cat QUIZ KID: 6 wins, $200,701 to 5, 2016 in Argentina, Gran Premio Estrellas Clas- Terlingua Secretariat sic-G1, Premio Pr Progreso-G3 twice, etc. Forestry Crimson Saint FANTASTIC FOUR: 5 wins, $168,289 to 4, 2016 in Argentina, Gran Premio Joaquin Bay, 1996 His Majesty V. Gonzalez-G1, Premio 25 De Mayo De 1810-G2, etc. Pleasant Colony Sun Colony Shared Interest SMOKEY GLACKEN: 10 wins, $656,960, Distaff Breeders’ Cup H-G2, etc. Dr. Fager Surgery Bold Sequence HOMERUN BERTI: 22 wins, $496,397 to 10, 2016, Lea County Sprint S, etc. OLD FORESTER: 6 wins, $462,632, Cliff Hanger S-G3, Canadian Turf H, Santa Unbridled Fappiano Claus S, etc. Set ncr at Gulfstream Park. Sire. Unbridled’s Song Gana Facil Trolley Song Caro (Ire) Unbridled Elaine Lucky Spell FEMALE LINE Gray or Roan, 1998 In Reality UNBRIDLED ELAINE. 6 wins at 2 and 3, $1,770,740, Breeders’ Cup Distaff Taylor’s Falls Nilene Wonder Carols Folly S-G1, Monmouth Breeders’ Cup Oaks-G2, Iowa Oaks, Pocahontas S, No Trespassing Bob’s Dusty Private Parking 2nd Pennsylvania Derby-G3, etc. Dam of 8 foals, 4 to race, 3 winners— ETCHED (Forestry). Stakes winner. Dosage Profile: 4 11 7 0 0 OUT OF BOUNDS (Discreet Cat). 3 wins, 2 to 4, $177,673 in U.S., U.A.E.
    [Show full text]
  • Top Beyer Speed Figures • 1993-2018
    TOP BEYER SPEED FIGURES • 1993-2018 2-year-olds, 1993 2-year-olds, 1996 Beyer Beyer No. Horse Track Dist Date No. Horse Track Dist Date 106 VALIANT NATURE HOL 8.5 12/19/1993 108 THISNEARLYWASMINE SA 6 10/23/1996 105 BROCCO HOL 8.5 12/19/1993 107 KELLY KIP SAR 6 07/26/1996 105 POLAR EXPEDITION AP 6 08/14/1993 106 IN EXCESSIVE BULL SA 6 10/23/1996 103 HOLY BULL BEL 7 09/18/1993 104 HOLZMEISTER HAW 8.5 11/17/1996 102 DEHERE BEL 7 09/18/1993 104 KELLY KIP BEL 5 06/21/1996 101 HOLY BULL MTH 5.5 08/14/1993 103 IN C C’S HONOR LRL 6 12/21/1996 100 FLYING SENSATION HOL 8.5 12/19/1993 102 DIXIE FLAG (F) AQU 6 11/24/1996 100 SARDULA (F) DMR 7 09/04/1993 101 CAPTAIN BODGIT LRL 9 11/02/1996 99 BLUMIN AFFAIR HOL 8.5 12/19/1993 101 GOLD CASE FG 6 12/30/1996 99 INDIVIDUAL STYLE HOL 7 11/26/1993 101 IN EXCESSIVE BULL HOL 7 11/10/1996 99 YOU AND I AQU 7 10/20/1993 101 IN EXCESSIVE BULL SA 6 10/05/1996 Champion 2-year-old male Dehere had one of the highest Beyer Speed 101 MUD ROUTE HOL 6.5 12/15/1996 Figures of the season, but Valiant Nature earned the highest when beating 101 ORDWAY BEL 8.5 10/05/1996 Breeders’ Cup Juvenile winner Brocco in the Hollywood Futurity.
    [Show full text]
  • HOPING to CATCH a RISING STAR the Next Portion of the Road to the Kentucky Derby Challenge Kicks Off Saturday with a Pair of $400,000 Events for 3- Year-Olds
    WEDNESDAY, FEBRUARY 20, 2013 732-747-8060 • TDN Home Page Click Here HOPING TO CATCH A RISING STAR The next portion of the Road to the Kentucky Derby Challenge kicks off Saturday with a pair of $400,000 events for 3- year-olds. Gulfstream will stage the GII Besilu Stables Fountain of Youth S. at 5:35 p.m. and, about 20 minutes later, a full field is expected for the GII Risen Star S. at Fair Grounds. J. Paul Reddam’s California-based runner He’s Had Enough (Tapit) was entered in both races, but is Calumet Farm’s Oxbow Francesca Cumani is the presenter of the CNN expected to contest the Fountain (Awesome Again) corners for International show Winning Post. Each month, the team of Youth. home in the GIII Lecomte S. reports from a major race day, wherever it may be in “We drew post nine in the (video). He is the second choice in the Risen Star the world. This month, they were in St. Moritz for the Fountain of Youth and 12 of 15 Hodges Photography White Turf, which Francesca describes in her first in the Risen Star,” said trainer feature for the TDN here (CNN VIDEO). Next up is the Doug O’Neill. “I’d say we’re Emir's Sword in Qatar Feb. 28th, then the Dubai World leaning towards the Fountain of Youth.” Cup in March. For more information visit Trainer Al Stall Jr. entered a pair of promising colts in www.cnn.com/winningpost or watch Winning Post at the Risen Star, but didn’t have much luck when post the following times (GMT): Saturday, Feb.
    [Show full text]
  • LEADERS Oppenheim: Constitution, American Pharoah Top Second-Crop Sires See Page 4
    MONDAY, JUNE 1, 2020 BLOODHORSE.COM/DAILY ANNE M. EBERHARDT ANNE M. LEADERS Oppenheim: Constitution, American Pharoah Top Second-Crop Sires See page 4 IN THIS ISSUE 11 Quality Road, Blame Colts Shine at OBS Under Tack Show 13 Ward Hones Stable Roster for Royal Ascot Bid 17 Grade 1-Winning Sprinter Imperial Hint Retired BLOODHORSE DAILY Download the FREE smartphone app PAGE 1 OF 30 CONTENTS 4 Oppenheim: Constitution, American Pharoah Top Second-Crop Sires 10 Leading KY Sires by % Black-Type Performers 11 Quality Road, Blame Colts Shine at OBS Under Tack Show 13 Ward Hones Stable Roster for Royal Ascot Bid 15 Fighting Mad Makes It Look Easy in Santa Maria Stakes 16 Dynasty of Her Own Makes All in California Oaks 17 Grade 1-Winning Sprinter Imperial Hint Retired 21 NYRA Making Safety a Priority at Belmont Park 23 Authentic Has Final Work Ahead of Santa Anita Derby 23 Mr Havercamp Retired With Pelvis Injury 24 Contrail Remains Undefeated With Japanese Derby Romp 25 Victor Ludorum Heads Fabre Trio in French Guineas 26 Tropbeau Headlines French One Thousand Guineas 27 Relieved Trainers Prepare to Resume Racing in Britain 28 Results & Entries ANNE M. EBERHARDT ANNE M. 2020 PENNSYLVANIA Still searching for the perfect match for your mare? STALLION Click to view our 2020 Stallion Directory & BOARDING FARM DIRECTORY pabred.com A publication of The Jockey Club Information Systems, Inc. and TOBA Media Properties, Inc. ON THE COVER Editorial Director General Manager WinStar Farm’s Constitution is almost on even terms Evan Hammonds Scott Carling with leading second-crop sire American Pharoah Visuals Director Managing Editor Anne M.
    [Show full text]
  • BRED to DEATH How the Racing Industry’S Drive for Profit and Glory Is Ruining the Thoroughbred Horse
    Researched by Dene Stansall Written by Dene Stansall & Andrew Tyler BRED TO DEATH How the racing industry’s drive for profit and glory is ruining the Thoroughbred horse www.animalaid.org.uk Published: September 2006 ISBN 1-905327-21-8 CONTENTS Glossary of Horse Racing Terms ................................................................................1 Summary ........................................................................................................................2 Introduction ....................................................................................................................4 Thoroughbred Breeding Numbers ............................................................................6 Recent Breeding Records............................................................................................7 The Fate of the Stallion ................................................................................................8 Shuttle Stallions ............................................................................................................10 The Fate of the Broodmare ........................................................................................11 Influence of North American Sire Lines and The Rise of the Coolmore and Darley Operations ......................................................................13 Top Ten Flat Sires in Britain and Ireland 2005 ........................................................16 Improvement of the Breed ........................................................................................17
    [Show full text]
  • Female Division Headlines Weekend in Today's Edition
    GHOSTZAPPER 3.41 ‘A Runner’ Index Only Galileo and War Front DAILY Rank Higher ADENA SPRINGS SATURDAY, AUGUST 22, 2015 WWW.BLOODHORSE.COM KENTUCKY IN TODAY’S EDITION MECCA’S ANGEL DENIES ACAPULCO 2 OBS AUGUST POISED FOR REBOUND 3 OFFICIAL: LASIX SYSTEM ‘WIDELY ACCEPTED’ 4 FLORIDA RACING ON SUMMER UPSWING 4 LOOK FOR BAYERN TO WAKE UP 5 RESULTS 6 ENTRIES 9 LEADING LISTS 16 GARY TASICH GARY Champion mare Beholder takes on males Saturday in the Pacific Classic FEMALE DIVISION HEADLINES WEEKEND By Claire Novak ith champion Beholder entered in the TVG Pacific WClassic Stakes (gr. I) and Longines Kentucky Oaks (gr. I) winner Lovely Maria facing I'm a Chatterbox and emerging star Curalina in the Alabama Stakes (gr. I), coast-to-coast racing focuses on the filly and mare divi- sion Aug. 22 with ramifications for the rest of the year. Beholder has already earned a "Win and You're In" berth to defend her title in the Breeders' Cup Distaff (gr. I), but should she win not only her first start against males but also her first at 1 1/4 miles, might her connections send her to the Breeders' Cup Classic (gr. I)? Regardless, a victory here could add to the already expected fireworks when she goes through the auction ring this fall. And speaking of the Breeders' Cup, could the Pacific Classic's male contenders pose a threat to Bob Baffert's trainee American Pharoah down the road at Keeneland? What about 2014 Breeders' Cup Classic winner Bayern or Clark Handicap (gr. I) victor Hoppertunity from his very own barn? BH BLOOD-HORSE DAILY Download the FREE smartphone app PAGE 1 OF 16 LATEST HEADLINES FROM BLOODHORSE.COM F-T ADDS DAY TO OCTOBER YEARLING SALE With a record number of 1,400 entries to date, Fasig-Tipton has added an additional day to its October yearling sale in Lexington that will run Oct.
    [Show full text]
  • Ocala Stud Sets 2019 Stallion Roster and Fees
    ftboa.com • Thursday • October 18, 2018 FEC/FTBOA PUBLICATION Bulmahn, de Meric, Fuller- FOR ADVERTISING INFORMATION Vargas join FTBOA Board or to subscribe, please call Antoinette at 352-732-8858 or Fernung returns as president email: [email protected] OCALA, FLA.— T. Paul Bulmahn, Nick de Meric, both of Ocala, Fla.; and Laurine Fuller- Vargas of Morriston, Fla., have been named to the Florida Thoroughbred Breeders’ and Owners’ Association board of directors while Richard Kent of Ocala remains on the board for his second term. After a one-year absence as a voting member on the board due In This Issue: to term limits, past president George Russell of Reddick, Fla., also returns as an officio director, as announced at the FTBOA annual meeting last Thursday. Each of them will Warrior’s Club Breezes Half-Mile Bullet serve three-year terms that will run through 2021. in Prep for BC Sprint Leaving the board because of term limits outlined in the FTBOA by-laws were Fred Florida Racing Laboratory Fully See FTBOA BOARD on page 3 Accredited by RMTC Turf Racing Rooted in Woodbine’s Future Breeders’ Cup Announces 2018 Race Order, Wagering Menu First Dude Answers Opportunity’s Knock With a Grade 2 Winner Accelerate Heads Record 221 Breeders’ Cup Pre-Entries Brent Fernung/FILE PHOTO T. Paul Bulmahn/FILE PHOTO Nick de Meric/FILE PHOTO Laurine Fuller-Vargas/ FILE PHOTO Mena Set to Return to Riding Thursday Ocala Stud sets 2019 Chase to the Championship Florida Stallion Progeny List stallion roster and fees Florida Breeders’ List PRESS RELEASE_______________________________________________________ Wire to Wire Business Place Ocala Stud has set its 2019 stallion roster and fees, led by Girvin who will stand his first season at stud for $7,500 S&N.
    [Show full text]