Fighting Mad Caps Another Big Weekend for Baffert

Total Page:16

File Type:pdf, Size:1020Kb

Fighting Mad Caps Another Big Weekend for Baffert MONDAY, AUGUST 3, 2020 FIGHTING MAD CAPS FAVES FAIL TO SHOW ON SATURDAY, BUT EXCUSES ABOUND ANOTHER BIG WEEKEND The Week in Review, by T.D. Thornton This past Saturday wasn=t a great day to be a favorite in an FOR BAFFERT open stakes race at the nation=s premier race meets. Chalk horses went a collective one-for-seven at Saratoga and Del Mar, and the list of excuses included stutter-step starts, bumps leaving the gate, stretch-run roughhousing, getting disqualified, and being dueled into defeat in internal pace battles. Tight finishes in several stakes elevated the interest level, although the results in general did not lend clarity to the nationwide divisional races with the GI Kentucky Derby inside the five-week mark and the Breeders= Cup Championships now three months out. At the Spa, faves went zero-for-five, with the GI Personal Ensign S. setting the tone early in the day. Cont. p5 Fighting Mad | Horsephotos IN TDN EUROPE TODAY Lightly raced Fighting Mad (New Year=s Day) zipped away early WATCH ME WINS THE ROTHSCHILD and held sway late to take Sunday evening=s GI Clement L. Hirsch Watch Me (Fr) (Olympic Glory {Ire}) saluted in the G1 Prix de S. at Del Mar and stamp her ticket to the GI Breeders= Cup Rothschild at Deauville on Sunday. Click or tap here to go Distaff. Looking to add to another productive weekend for Hall straight to TDN Europe. of Fame trainer Bob Baffert that included Saturday scores in the GI Whitney S. and Shared Belief S., the Gary and Mary West homebred was backed down to 9-5 favoritism from a 4-1 morning line quote and wasted little time seizing command. Under a tight Abel Cedillo hold, the bay doled out splits of :23.15 and :46.55 before being asked to kick away from her competition heading for home. Defending champion Ollie=s Candy (Candy Ride {Arg}) and MGISW Ce Ce (Elusive Quality) were scrubbed on to try and reel in the leader approaching the stretch, but Fighting Mad began to open up at the head of the lane as Ce Ce was the first to capitulate. Ollie=s Candy kept on gamely to cut things close late, but Fighting Mad found the wire with a half-length to spare. Ce Ce held on for a distant third, while the accomplished Hard Not to Love (Hard Spun) never reached contention and brought up the rear. AI had the same instructions today that I had yesterday [for Thousand Words {Pioneerof the Nile} in the Shared Belief]--get her out of there and see if you can get to the front,@ Cedillo said. AShe really broke sharply and wanted to go right away. I got her to relax some on the backside, then she went right on with it. She=s just an amazing filly.@ Cont. p3 PUBLISHER & CEO Sue Morris Finley @suefinley [email protected] SENIOR VICE PRESIDENT Gary King @garykingTDN [email protected] EDITORIAL [email protected] Editor-in-Chief Jessica Martini @JessMartiniTDN Managing Editor Monday, August 3, 2020 Alan Carasso @EquinealTDN Senior Editor Steve Sherack @SteveSherackTDN Racing Editor Brian DiDonato @BDiDonatoTDN Deputy Editor Christie DeBernardis @CDeBernardisTDN Associate Editors Christina Bossinakis @CBossTDN Joe Bianca @JBiancaTDN News and Features Editor In Memoriam: Ben Massam (1988-2019) ADVERTISING [email protected] Director of Advertising Alycia Borer Advertising Manager Lia Best Advertising Designer Amanda Crelin Advertising Assistant/Dir. Of Distribution Rachel McCaffrey Advertising Assistants Amie Newcomb Kristen Lomasson Photographer/Photo Editor Champion Monomoy Girl (Tapizar) was among a number of noteworthy Churchill Sarah K. Andrew @SarahKAndrew Downs breezers Sunday morning. She covered four furlongs in :49.80 (39/75) and has [email protected] her sights set on the GI La Troienne S. Sept. 4. | Coady Social Media Strategist Justina Severni NODA TAKING BIG SWING IN TRAVERS Director of Customer Service 9 Vicki Forbes Young trainer Orlando Noda has confirmed recent maiden breaker [email protected] First Line (First Samurai) for the GI Runhappy Travers S. “I'm entering to win." he told Bill finley. "He might surprise some people." Marketing Manager Alayna Cullen @AlaynaCullen Director of IT/Accounting BIG FEW MINUTES FOR NYQUIST RR Ray Villa First-crop sire Nyquist went from one winner to three in a matter of [email protected] minutes Sunday. First second timer Gretzky the Great dominated [email protected] at Woodbine, and then well-backed firster Lady Lilly held off fast-finishing Mo Dean, by Nyquist’s sire Uncle Mo. Uncle Mo WORLDWIDE INFORMATION got his own juvenile winner Sunday in the form of longshot International Editor Roll Up Mo Money at Del Mar. Kelsey Riley @kelseynrileyTDN [email protected] European Editor Emma Berry [email protected] Associate International Editor Heather Anderson @HLAndersonTDN Newmarket Bureau, Cafe Racing Sean Cronin & Tom Frary [email protected] 60 Broad Street, Suite 100 Red Bank, NJ 07701 732-747-8060 | 732-747-8955 (fax) www.TheTDN.com TDN HEADLINE NEWS • PAGE 3 OF 13 • THETDN.COM MONDAY • AUGUST 3, 2020 3--Ce Ce, 125, f, 4, by Elusive Quality 1st Dam: Miss Houdini, by Belong to Me Sunday, Del Mar 2nd Dam: Magical Maiden, by Lord Avie CLEMENT L. HIRSCH S.-GI, $250,500, Del Mar, 8-2, 3yo/up, f/m, 3rd Dam: Gils Magic, by Magesterial 1 1/16m, 1:43.46, ft. O/B-Bo Hirsch LLC (KY); T-Michael W. McCarthy. $30,000. 1--FIGHTING MAD, 123, f, 4, by New Year's Day Margins: HF, 4 3/4, 3 1/4. Odds: 1.80, 3.40, 2.40. 1st Dam: Smokey's Love, by Forestry Also Ran: Hang a Star, Dogtag, Hard Not to Love. 2nd Dam: Smokey Mirage, by Holy Bull Click for the Equibase.com chart, the TJCIS.com PPs or the free 3rd Dam: Verbasle, by Slewpy Equineline.com catalogue-style pedigree. VIDEO, sponsored by 1ST GRADE I WIN. O-Gary & Mary West; B-Gary & Mary West Fasig-Tipton. Stables Inc. (KY); T-Bob Baffert; J-Abel Cedillo. $150,000. "I was a little bit worried about her because she was getting Lifetime Record: 8-5-1-0, $444,008. Werk Nick Rating: B+. pretty warm in the paddock, but Abel knows her pretty well and Click for the eNicks report & 5-cross pedigree. he knows speed is her weapon,@ Baffert said. ATo look at her you wouldn't think she could go [a distance], but when she started 2--Ollie's Candy, 123, m, 5, by Candy Ride (Arg) opening up, I figured he must know what he's doing. Basically, 1st Dam: Afternoon Stroll, by Stroll she ran them off their feet. The way she acted in the paddock, 2nd Dam: Gertie, by Danzatore she ran an incredible race. She was trembling and sweating and I 3rd Dam: Granny Ruth, by Key to the Mint was worried, but once the race started she was pretty serious. " ($45,000 RNA Ylg '16 KEESEP). O/B-Paul & Karen Eggert (KY); A nose graduate on debut here in her lone juvenile start two T-John W. Sadler. $50,000. years ago, Fighting Mad resurfaced at Churchill to take an allowance last April. Cont. p4 TDN HEADLINE NEWS • PAGE 4 OF 13 • THETDN.COM MONDAY • AUGUST 3, 2020 Clement Hirsch cont. She faded to seventh in Pimlico=s GIII Miss Preakness S. that May, and resurfaced back at Del Mar to be a close second in an optional claimer July 19. Fighting Mad=s first two-turn attempt resulted in an eight-length romp in the GIII Torrey Pines S. Aug. 17, but she was again sidelined after that. The bay crossed the wire fourth in Santa Anita=s six-furlong GIII Desert Stormer S. May 17 before being moved to fourth by the stewards, and belied 10-1 odds last time when running away with the GII Santa Maria S. in Arcadia May 21 over Hard Not to Love and Ce Ce and recent GIII Molly Pitcher S. scorer Horologist (Gemologist). FIGHTING MAD WIN AND YOU’RE IN ™ Fighting Mad | Benoit Photo connection earnings include: $ Automatic berth into #BC20 Distaff $ $60,000 in pre-entry & entry fees Pedigree Notes: $ Travel award up to $10,000 for domestic Fighting Mad becomes the second highest-level winner for her starters and $40,000 for international exported sire, following in the hoofsteps of now stablemate and starters +$10,000 nominator award to Gary & fellow West homebred Maximum Security. That champion Mary West 3-year-old took the GII San Diego H. under Cedillo last Saturday. The Wests and Baffert campaigned New Year=s Day (Street Cry Click HERE for the full 2020 {Ire}) to a victory in the 2013 GI Breeders= Cup Juvenile. #WINANDYOUREIN rules and race schedule. Cont. p5 The ultimate Sarago-to stallion Moretti in the Birdstone takes Medaglia d’Oro to 20 Black Type winners at Saratoga. He’s the Spa’s greatest ever stallion. Start spreading the news. STALLIONS BY SARATOGA BLACK TYPE WINNERS 1 MEDAGLIA D’ORO 20 2 A.P. INDY 19 3 DANZIG 16 GIANT’S CAUSEWAY 16 STORM CAT 16 Making history: it takes foresight Darley TDN HEADLINE NEWS • PAGE 5 OF 13 • THETDN.COM MONDAY • AUGUST 3, 2020 Fighting Mad Pedigree Note cont. Week in Review cont. from p1 Fighting Mad is the sixth Grade I winner out of a Forestry mare The 9-1 Vexatious (Giant=s Causeway), who hadn=t won since among a group produced by a diverse list of sires (Rushing Fall scoring in a 1 3/8 miles turf stakes at Del Mar two summers ago, {More Than Ready}, Nyquist {Uncle Mo}, Turbulent Descent ran the race of her life at age six while attending the pace over {Congrats}, Instilled Regard {Arch} and Bobby=s Kitten {Kitten=s nine furlongs on dirt.
Recommended publications
  • Graydar Oxbow
    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
    [Show full text]
  • CHESTNUT COLT Barn 31 Hip No
    Consigned by Claiborne Farm, Agent Barn Hip No. 31 CHESTNUT COLT 845 Foaled April 25, 2006 Storm Bird Storm Cat ......................... Terlingua Forestry ............................ Pleasant Colony Shared Interest.................. Surgery CHESTNUT COLT Mr. Prospector Forty Niner........................ File Tour .................................. (1990) Full Pocket Fun Flight ......................... Fun and Tears By FORESTRY (1996). Stakes winner of $591,225, King's Bishop S. [G1], etc. Sire of 5 crops of racing age, 403 foals, 208 starters, 27 stakes winners, 139 winners of 327 races and earning $11,442,572 & $130,795(CAN) in N.A., including Smokey Glacken ($656,960, Distaff Breeders' Cup H. [G2] (AQU, $94,800), etc.), Diplomat Lady ($552,784, Hollywood Starlet S. [G1] (HOL, $273,600), etc.), Old Forester [G3] ($451,080 & $13,848 (CAN)), Forest Danger ($423,000, Carter H. [G1] (AQU, $210,000), etc.). 1st dam TOUR, by Forty Niner. 5 wins, 2 to 4, $254,939, Curious Clover H. [L] (HOL, $29,100), 2nd Bold Jill H. [L] (SA, $10,000), CERF H. [L] (HOL, $10,000), Very Subtle H.-R (HOL, $11,000), Frosty Shades H. (GG, $6,000), etc. Sister to FLIGHT FORTY NINE. Dam of 8 other registered foals, 8 of rac- ing age, including a 2-year-old of 2007, 6 to race, 4 winners-- TRIP (f. by Lord At War (ARG)). 11 wins, 3 to 5, $888,773, Turfway Breed- ers' Cup S. [G3], Turfway Breeders’ Cup S. [G3] (TP, $125,500), Chi- cago Breeders' Cup H. [G3], Bourbonette Breeders' Cup S. [L] (TP, $93,600), Iowa Oaks [L] (PRM, $90,000), Fairway Fun S. [L] (TP, $31,- 300), 2nd Delaware Oaks [G3], Regret S.
    [Show full text]
  • ETCHED Chestnut Horse, 2005; 16.3 Hands DIPLOMAT LADY: 4 Wins, $552,784, Hollywood Starlet S-G1, Beaumont­ S-G2, Etc
    ETCHED Chestnut Horse, 2005; 16.3 Hands DIPLOMAT LADY: 4 wins, $552,784, Hollywood Starlet S-G1, Beaumont S-G2, etc. Storm Bird Northern Dancer FOREST DANGER: 5 wins, $423,000 in 8 starts, Carter H-G1, etc. Sire. South Ocean Storm Cat QUIZ KID: 6 wins, $200,701 to 5, 2016 in Argentina, Gran Premio Estrellas Clas- Terlingua Secretariat sic-G1, Premio Pr Progreso-G3 twice, etc. Forestry Crimson Saint FANTASTIC FOUR: 5 wins, $168,289 to 4, 2016 in Argentina, Gran Premio Joaquin Bay, 1996 His Majesty V. Gonzalez-G1, Premio 25 De Mayo De 1810-G2, etc. Pleasant Colony Sun Colony Shared Interest SMOKEY GLACKEN: 10 wins, $656,960, Distaff Breeders’ Cup H-G2, etc. Dr. Fager Surgery Bold Sequence HOMERUN BERTI: 22 wins, $496,397 to 10, 2016, Lea County Sprint S, etc. OLD FORESTER: 6 wins, $462,632, Cliff Hanger S-G3, Canadian Turf H, Santa Unbridled Fappiano Claus S, etc. Set ncr at Gulfstream Park. Sire. Unbridled’s Song Gana Facil Trolley Song Caro (Ire) Unbridled Elaine Lucky Spell FEMALE LINE Gray or Roan, 1998 In Reality UNBRIDLED ELAINE. 6 wins at 2 and 3, $1,770,740, Breeders’ Cup Distaff Taylor’s Falls Nilene Wonder Carols Folly S-G1, Monmouth Breeders’ Cup Oaks-G2, Iowa Oaks, Pocahontas S, No Trespassing Bob’s Dusty Private Parking 2nd Pennsylvania Derby-G3, etc. Dam of 8 foals, 4 to race, 3 winners— ETCHED (Forestry). Stakes winner. Dosage Profile: 4 11 7 0 0 OUT OF BOUNDS (Discreet Cat). 3 wins, 2 to 4, $177,673 in U.S., U.A.E.
    [Show full text]
  • Top Beyer Speed Figures • 1993-2018
    TOP BEYER SPEED FIGURES • 1993-2018 2-year-olds, 1993 2-year-olds, 1996 Beyer Beyer No. Horse Track Dist Date No. Horse Track Dist Date 106 VALIANT NATURE HOL 8.5 12/19/1993 108 THISNEARLYWASMINE SA 6 10/23/1996 105 BROCCO HOL 8.5 12/19/1993 107 KELLY KIP SAR 6 07/26/1996 105 POLAR EXPEDITION AP 6 08/14/1993 106 IN EXCESSIVE BULL SA 6 10/23/1996 103 HOLY BULL BEL 7 09/18/1993 104 HOLZMEISTER HAW 8.5 11/17/1996 102 DEHERE BEL 7 09/18/1993 104 KELLY KIP BEL 5 06/21/1996 101 HOLY BULL MTH 5.5 08/14/1993 103 IN C C’S HONOR LRL 6 12/21/1996 100 FLYING SENSATION HOL 8.5 12/19/1993 102 DIXIE FLAG (F) AQU 6 11/24/1996 100 SARDULA (F) DMR 7 09/04/1993 101 CAPTAIN BODGIT LRL 9 11/02/1996 99 BLUMIN AFFAIR HOL 8.5 12/19/1993 101 GOLD CASE FG 6 12/30/1996 99 INDIVIDUAL STYLE HOL 7 11/26/1993 101 IN EXCESSIVE BULL HOL 7 11/10/1996 99 YOU AND I AQU 7 10/20/1993 101 IN EXCESSIVE BULL SA 6 10/05/1996 Champion 2-year-old male Dehere had one of the highest Beyer Speed 101 MUD ROUTE HOL 6.5 12/15/1996 Figures of the season, but Valiant Nature earned the highest when beating 101 ORDWAY BEL 8.5 10/05/1996 Breeders’ Cup Juvenile winner Brocco in the Hollywood Futurity.
    [Show full text]
  • LEADERS Oppenheim: Constitution, American Pharoah Top Second-Crop Sires See Page 4
    MONDAY, JUNE 1, 2020 BLOODHORSE.COM/DAILY ANNE M. EBERHARDT ANNE M. LEADERS Oppenheim: Constitution, American Pharoah Top Second-Crop Sires See page 4 IN THIS ISSUE 11 Quality Road, Blame Colts Shine at OBS Under Tack Show 13 Ward Hones Stable Roster for Royal Ascot Bid 17 Grade 1-Winning Sprinter Imperial Hint Retired BLOODHORSE DAILY Download the FREE smartphone app PAGE 1 OF 30 CONTENTS 4 Oppenheim: Constitution, American Pharoah Top Second-Crop Sires 10 Leading KY Sires by % Black-Type Performers 11 Quality Road, Blame Colts Shine at OBS Under Tack Show 13 Ward Hones Stable Roster for Royal Ascot Bid 15 Fighting Mad Makes It Look Easy in Santa Maria Stakes 16 Dynasty of Her Own Makes All in California Oaks 17 Grade 1-Winning Sprinter Imperial Hint Retired 21 NYRA Making Safety a Priority at Belmont Park 23 Authentic Has Final Work Ahead of Santa Anita Derby 23 Mr Havercamp Retired With Pelvis Injury 24 Contrail Remains Undefeated With Japanese Derby Romp 25 Victor Ludorum Heads Fabre Trio in French Guineas 26 Tropbeau Headlines French One Thousand Guineas 27 Relieved Trainers Prepare to Resume Racing in Britain 28 Results & Entries ANNE M. EBERHARDT ANNE M. 2020 PENNSYLVANIA Still searching for the perfect match for your mare? STALLION Click to view our 2020 Stallion Directory & BOARDING FARM DIRECTORY pabred.com A publication of The Jockey Club Information Systems, Inc. and TOBA Media Properties, Inc. ON THE COVER Editorial Director General Manager WinStar Farm’s Constitution is almost on even terms Evan Hammonds Scott Carling with leading second-crop sire American Pharoah Visuals Director Managing Editor Anne M.
    [Show full text]
  • MANY RIVERS Ch, 2005
    MANY RIVERS ch, 2005 Dosage (7-4-8-1-0); DI: 3.00; CD: 0.85 See gray pages—Nearctic RACE AND (BLACK TYPE) RECORD Northern Dancer, 1961 Nearctic, by Nearco Age Starts 1st 2nd 3rd Earned 18s, BTW, $580,647 Storm Bird, 1978 636 f, 147 BTW, 4.11 AEI Natalma, by Native Dancer 2 8 1 2 1(1) $45,180 6s, BTW, $169,181 3 8 1 0 1 $26,526 682 f, 63 BTW, 2.26 AEI South Ocean, 1967 New Providence, by Bull Page 22s, BTW, $70,147 4 0 0 0 0 — Storm Cat, dkb/br, 1983 8s, BTW, $570,610 12 f, 9 r, 9 w, 4 BTW Shining Sun, by Chop Chop 5 2 0 0 0 $800 1,414 f, 177 BTW, 2.94 AEI Totals 18 2 2 2(1) $72,506 Secretariat, 1970 Bold Ruler, by Nasrullah 7.08 AWD 21s, BTW, $1,316,808 Won At 2 Terlingua, 1976 653 f, 54 BTW, 2.98 AEI Somethingroyal, by Princequillo 17s, BTW, $423,896 A maiden special weight race at BM ($40,200, 5.5f in 11 f, 9 r, 6 w, 2 BTW Crimson Saint, 1969 Crimson Satan, by Spy Song 1:04.47, dftg. Kentucky Twostep, Autism 11s, BTW, $91,770 Awareness, Vadheim, Forearlthepearl, Strong 11 f, 8 r, 7 w, 4 BTW Bolero Rose, by Bolero Suggestion, Sweetville, Searchforthetruth, Exclusive Native, 1965 Raise a Native, by Native Dancer Hurricane Deputy). 13s, BTW, $169,013 3rd Gold Rush S (8f, AW, to El Gato Malo, Bert’s Law, Affrmed, 1975 507 f, 69 BTW, 3.72 AEI Exclusive, by Shut Out 29s, BTW, $2,393,818 dftg.
    [Show full text]
  • The Green Monkey Bay Horse; Feb 04, 2004 View Complete Auction History 3 Starts, Placed Click Here for Interactive Nicking
    equineline.com Product 10N 11/30/16 15:12:38 EST The Green Monkey Bay Horse; Feb 04, 2004 View Complete Auction History 3 Starts, Placed Click here for Interactive Nicking Nearctic, 54 br Northern Dancer, 61 b Natalma, 57 b Storm Bird, 78 b New Providence, 56 b South Ocean, 67 b Shining Sun, 62 b Storm Cat, 83 dk b/ Bold Ruler, 54 dk b Secretariat, 70 ch Somethingroyal, 52 b Terlingua, 76 ch Crimson Satan, 59 ch Crimson Saint, 69 ch Bolero Rose, 58 ch Forestry, 96 b *Ribot, 52 b His Majesty, 68 b Flower Bowl, 52 b Pleasant Colony, 78 dk b/ Sunrise Flight, 59 dk b Sun Colony, 68 b *Colonia, 59 b Shared Interest, 88 b Rough'n Tumble, 48 b Dr. Fager, 64 b Aspidistra, 54 b Surgery, 76 b Bold Ruler, 54 dk b Bold Sequence, 61 br Sequence, 46 dk b The Green Monkey Bay Horse Raise a Native, 61 ch Foaled Feb 04, 2004 Mr. Prospector, 70 b in Florida Gold Digger, 62 b Fappiano, 77 b 3 Starts Dr. Fager, 64 b Placed Killaloe, 70 b Grand Splendor, 62 b Unbridled, 87 b =Wild Risk (FR), 40 b *Le Fabuleux, 61 ch =Anguar (FR), 50 b Gana Facil, 81 ch In Reality, 64 b Charedi, 76 dk b/ Magic, 69 dk b/ Magical Masquerade, 98 ch Intentionally, 56 blk In Reality, 64 b My Dear Girl, 57 ch Valid Appeal, 72 b Moslem Chief, 57 b Desert Trial, 63 ch Scotch Verdict, 60 ch Nannerl, 87 ch Proud Clarion, 64 b Proud Birdie, 73 b Bernie Bird, 65 dk b/ Allouette, 80 b Bayou Bourg, 59 ch Madame Defage, 67 ro Let's Misbehave, 55 gr Breeder: Padua Stables (FL) Inbreeding: Dr.
    [Show full text]
  • Shackleford D Based on the Cross of Forestry/Unbridled and His Sons and Grandsons Variant = 0.73 Breeder: Mike Lauffer & Bill Cubbedge (KY)
    11/01/11 11:44:17 EDT Shackleford D Based on the cross of Forestry/Unbridled and his sons and grandsons Variant = 0.73 Breeder: Mike Lauffer & Bill Cubbedge (KY) Nearctic, 54 br Northern Dancer, 61 b Natalma, 57 b Storm Bird, 78 b New Providence, 56 b South Ocean, 67 b Shining Sun, 62 b Storm Cat, 83 dk b/ Bold Ruler, 54 dk b Secretariat, 70 ch Somethingroyal, 52 b Terlingua, 76 ch Crimson Satan, 59 ch Crimson Saint, 69 ch Bolero Rose, 58 ch Forestry, 96 b *Ribot, 52 b His Majesty, 68 b Flower Bowl, 52 b Pleasant Colony, 78 dk b/ Sunrise Flight, 59 dk b Sun Colony, 68 b *Colonia, 59 b Shared Interest, 88 b Rough'n Tumble, 48 b Dr. Fager, 64 b Aspidistra, 54 b Surgery, 76 b Bold Ruler, 54 dk b Bold Sequence, 61 br Sequence, 46 dk b Shackleford Chestnut Colt Raise a Native, 61 ch Foaled Feb 25, 2008 Mr. Prospector, 70 b in Kentucky Gold Digger, 62 b Fappiano, 77 b Dr. Fager, 64 b Killaloe, 70 b Grand Splendor, 62 b Unbridled, 87 b =Wild Risk (FR), 40 b *Le Fabuleux, 61 ch =Anguar (FR), 50 b Gana Facil, 81 ch In Reality, 64 b Charedi, 76 dk b/ Magic, 69 dk b/ Oatsee, 97 ch Hail to Reason, 58 br Roberto, 69 b Bramalea, 59 dk b/ Lear Fan, 81 b Lt. Stevens, 61 b Wac, 69 b Belthazar, 60 br With Every Wish, 91 b Speak John, 58 b Hold Your Peace, 69 b Blue Moon, 48 b Amo, 85 ch In Reality, 64 b Taminette, 73 ch Tamerett, 62 dk b/ Note on terminology in this report: Direct Cross refers to Dosage Profile: 6 13 9 0 2 Inbreeding: Dr.
    [Show full text]
  • PEDIGREE INSIGHTS: by T.D
    TUESDAY, MARCH 6, 2018 THE TDN DERBY TOP 12 PEDIGREE INSIGHTS: by T.D. Thornton PROMISES FULFILLED We have a new No. 1 in the TDN Top 12 rankings, but for how long? The two previous early-season leaders couldn=t quite live up to their advance billings when returning off layoffs, and we=ve seen a steady progression of sophomores advancing through the ranks more or less by default without witnessing one powerfully dominant AWow!@ performance yet this season. But the cadence will quicken and the plot will thicken this coming weekend, with a trifecta of coast-to-coast preps spanning California, Florida and New York. Cont. p5 (click here) Promises Fulfilled | Lauren King IN TDN EUROPE TODAY by Andrew Caulfield PETER STANLEY: LET’S MAKE IT PAY TO STAY Only a week ago, when discussing the long-term prospects for Chris McGrath sits down with Peter Stanley to get his views on the survival of Storm Cat=s male line, I wasn=t sure whether to the breeding industry. Click or tap here to go straight to TDN mention the Forestry branch alongside those of Harlan, Europe. Hennessy and Giant=s Causeway. In the end I decided not to, but perhaps I should have--it was Forestry=s son Shackleford who supplied Promises Fulfilled, the unexpected winner of Saturday=s GII Fountain of Youth S. Promises Fulfilled comes from only the second crop of 3-year-olds by the 2011 GI Preakness S. winner, and the first also produced a winner of a Grade II carrying 50 Kentucky Derby points to the winner.
    [Show full text]
  • CAPRI's SON Barn 9 & 10 Hip No. 3176
    Consigned by Paramount Sales, Agent XXXII Barn CAPRI'S SON Hip No. 9 & 10 Gray or Roan Colt; foaled January 31, 2018 3176 Storm Cat Forestry ................................ Shared Interest Shackleford .......................... Unbridled Oatsee .................................... With Every Wish CAPRI'S SON Southern Halo More Than Ready .................. Woodman's Girl Capri Song ............................ (2014) Unbridled's Song Grey Song ............................ Dispute By SHACKLEFORD (2008). Classic winner of $3,090,101, Preakness S. [G1] (PIM, $1,100,000), etc. Sire of 3 crops of racing age, 321 foals, 184 start- ers, 113 winners of 230 races and earning $7,698,301, including black- type winners Malagacy ($627,920, Rebel S. [G2] (OP, $540,000)), Promis- es Fulfilled ($495,280, Xpressbet Fountain of Youth S. [G2] (GP, $238,080), etc.), Wellabled ($224,856, Arlington-Washington Futurity [G3] (AP, $57,- 000), etc.), Dream It Is [G3] (3 wins, $175,544), Salmanazar ($116,880). 1st dam CAPRI SONG, by More Than Ready. Unraced. Dam of 1 registered foal, above. 2nd dam GREY SONG, by Unbridled's Song. Unraced. Dam of 4 winners, including-- Nobadeer. 8 wins, 3 to 7, 2018, $144,830. 3rd dam DISPUTE , by Danzig. 9 wins, 2 to 4, $1,106,907, Spinster S. [G1] , Kentucky Oaks [G1] , Beldame S. [G1] , Gazelle H. [G1] , etc. Sister to ADJUDICATING [G1] , half-sister to TIME FOR A CHANGE -G1 , TAX COLLECTION . Dam of-- Plaintiff. Winner at 3, $42,600. Sent to Argentina. Dam of 5 winners, incl.-- PLAINSWOMAN . 4 wins, 2 to 4, 1,111,245 pesos, in Argentina, Manuel J. Guiraldes [G3] , 2nd Bayakoa, Luis Monteverde, etc. (Total: $71,652).
    [Show full text]
  • FORESTRY Among ALL Sires, the Record-Setting Grade 1 Winner by Storm Cat Was The
    Wednesday, Thoroughbred Daily News March 13, 2002 TDN For information, call (732) 747-8060. HEADLINE NEWS CIGAR LEADS HALL OF FAME NOMINEES T R I P L E T H R E A T S Two-time Horse of the Year Cigar has been named P P a finalist in the contemporary male category for nomination REPENT SLIGHT DERBY FAVORITE into the National Museum of Churchill oddsmaker Mike Battaglia has made GII Racing’s Hall of Fame. Others Louisiana Derby winner Repent (Louis Quatorze) the 4-1 nominated in that category favorite for Pool 2 of the Kentucky Derby Future include Ancient Title and Wager. The mutuel field is listed as the 5-1 second Precisionist. Cigar raced into choice in the pool, which opens Thursday at noon and fame when he reeled off a continues through Sunday at 5:30 p.m. Just behind the remarkable 16 straight victo- top two choices in the 24-interest field are a trio of ries, including the inaugural horses at 6-1: champion two-year-old Johannesburg Dubai World Cup in 1996. (Hennessy), GII San Rafael winner Came Home (Gone Ancient Title and Precisionist West) and GI Hollywood Futurity winner Siphonic (Si- are among only five horses to phon {Brz}). Pool 2 includes eight horses who were not sweep Santa Anita’s Strub included in the first pool: Blue Burner (French Deputy), Series: the Malibu, San Easy Grades (Honor Grades), Essence of Dubai (Pulpit), Fernando and Strub S. Cigar Horsephotos Mayakovsky (Matty G), Perfect Drift (Dynaformer), Showmeitall (All Gone), Sunday Break (Jpn) (Forty Niner) Precisionist won the 1985 GI and Yougottawanna (Candi’s Gold).
    [Show full text]
  • AMERMAN RACING STABLE Ack Ack H
    Other Major Stakes Wins AMERMAN RACING STABLE Ack Ack H. (GIII-CD)—Demarcation (2009) Arlington Matron H. (GIII-AP)—Adoration (2004) (John & Jerry Amerman) Aubrey Skirball-Kenis (Hol)—Fencelineneighbor (2003) Ballston Spa BC H. (GII-Sar)—Valor Lady (GIII-1997) Bay Meadows Derby (BM)—Blue Stellar (2001) Residence: Palos Verdes Estates, Beverly Hills H. (GII-Hol)—Happyanunoit (GI-2000) California CERF H. (Dmr)—Simply Because (2005) Clark H. (GII-CD)—Lido Palace (2002) Silks: Royal blue, blue "A" on white Coaching Club American Oaks (GI-Bel)—Spoken Fur (2003) ball on back, white bars on sleeve, El Cajon H. (Dmr)—Adoration (2003) blue cap Elkhorn (GIII-Kee)—Drama Critic (2000) Fleur de Lis H. (GII-CD)—Adoration (2004) Franklin-Simpson (KD)—Demarcation (2006) Gamely BC H. (GI-Hol)—Happyanunoit (2001) Golden Gate BC H. (GIII-GG)—No Slip (2002) Breeders’ Cup Win Hawthorne H. (GII-Hol)—Printemps (2001) Distaff (GI)—Adoration (2003-OT) Hialeah BC H. (Hia)—Valor Lady (1997) Hollywood BC Oaks (GII-Hol)—Adoration (2002) Hollywood Futurity (GI-Hol)—Siphonic (2001) Santa Anita Stakes Wins Lane’s End BC Futurity (GII-Kee)—Siphonic (2001) Ack’s Secret—Society Dream (1998) Matiara (Hol)—Heads Will Roll (2001) Clement L. Hirsch H. (GI-OT)—Mash One (1999, 2000) Matriarch (GI-Hol)—Happyanunoit (1999) Henry P. Russell H. (OT)—Big Sky Chester (1997) Mazarine (WO)—Blue Heart Hidden Light (OT)—Gotdream (2002) Mineshaft H. (GIII-FG)—Demarcation (2011) Hill Rise—Chattahoochee War (2005) Mint Julep (CD)—Valor Lady (1997) La Cañada (GII)—Balance (2007) Mother Goose (GI-Bel)—Spoken Fur (2003) Las Virgenes (GI)—Balance (2006) Navarone (Dmr)—Six Zero (2000) Oak Tree Derby (GII-OT)—No Slip (2002) Palomar BC H.
    [Show full text]