Maximum Security
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
11--Classicism Dark Bay Or Brown Colt; Apr 05, 2011 Mr
equineline.com Product 40P 11/14/12 18:30:04 EST 11--Classicism Dark Bay or Brown Colt; Apr 05, 2011 Mr. Prospector, 70 b Machiavellian, 87 dk b/ Coup de Folie, 82 b Street Cry (IRE), 98 dk b/ =Troy (GB), 76 b Unnamed Helen Street (GB), 82 b =Waterway (FR), 76 ch Foaled in Kentucky Seattle Slew, 74 dk b/ A.P. Indy, 89 dk b/ Classicism, 02 dk b/ Weekend Surprise, 80 b Mr. Prospector, 70 b Colour Chart, 87 b Rainbow Connection, 78 b By STREET CRY (IRE) (1998). Horse of the year in United Arab Emirates, Stakes winner of $5,150,837 USA in N.A. and United Arab Emirates, Stephen Foster H. [G1] (CD, $516,615), etc. Sire of 7 crops of racing age, 1114 foals, 717 starters, 58 stakes winners, 6 champions, 474 winners of 1381 races and earning $62,813,289 USA, including Zenyatta (Horse of the year in U.S., $7,304,580, Breeders' Cup Classic [G1] (OSA, $2,700,000), etc.), Shocking (Champion in Australia, $4,561,399 USA, Emirates Melbourne Cup [G1], etc.), Street Sense (Champion in U.S., $4,383,200, Kentucky Derby [G1] (CD, $1,450,000), etc.), Whobegotyou (Champion in Australia, $2,686,861 USA, The Age Caulfield Guineas [G1], etc.), Tomcito (Champion in Peru, $157,186 USA, Derby Nacional [G1], etc.). 1st dam CLASSICISM, by A.P. Indy. Unplaced in 1 start in ENG. Sister to TEMPERA, Barbican. Dam of 6 foals, 3 to race, 2 winners-- Lola's Love (f. by Dubai Destination). 2 wins at 3, $24,380. -
Mckinzie Headlines Loaded Runhappy Met Mile
SATURDAY, JULY 4, 2020 DIVERSITY IN RACING: JONATHON KINCHEN MCKINZIE HEADLINES Horseplayer, NYRA/Fox Analyst, Co-creator In The Money LOADED RUNHAPPY Media What if one of racing's biggest moments had a Black person at MET MILE the center? Other sports have had such moments, from Doug Williams winning the Super Bowl to Tiger Woods's first Masters victory to Venus Williams winning Wimbledon. These moments made these sports more appealing to Black people because they saw people who looked like them achieving success at the highest levels. Racing in the modern era is still waiting for that moment. And for a sport that's been so traditionally white, that's been a barrier to Black people becoming fans and feeling welcome, even though we're 20 years into the 21st Century. Cont. p3 IN TDN EUROPE TODAY McKinzie | Horsephotos OF LOVE, KINGS AND EMPERORS The delayed Investec Derby and Oaks take centre stage at A talented and deep field of eight will line up for Saturday=s last at Epsom on Saturday. Click or tap here to go straight to highly anticipated 127th renewal of the GI Runhappy TDN Europe. Metropolitan H. at Belmont Park. The prestigious event is a AWin and You=re In@ qualifier for the GI Big Ass Fans Breeders= Cup Dirt Mile. An unlucky second behind the mighty Mitole (Eskendereya) in last year=s contest, >TDN Rising Star= McKinzie (Street Sense) figures to vie for favoritism. He was first or second in all seven of his starts in 2019, led by a win in Saratoga=s GI Whitney S. -
WILL HE >JUSTIFY= the HYPE?
SATURDAY, APRIL 7, 2018 BLUE GRASS COULD BE WHITE OUT WILL HE >JUSTIFY= Assuming a potential snowstorm Friday night doesn=t put a THE HYPE? damper on things, a full field is set to go postward in Saturday=s GII Toyota Blue Grass S. The conversation about contenders must start with $1-million KEESEP yearling Good Magic (Curlin), who broke his maiden emphatically in the GI Breeders= Cup Juvenile at Del Mar en route to Eclipse Award honors. Heavily favored in the GII Xpressbet Fountain of Youth on seasonal debut at Gulfstream Mar. 3, he settled for a non-threatening third with no obvious excuse. Flameaway (Scat Daddy), second in the Mar. 10 GII Tampa Bay Derby behind expected scratch Quip (Distorted Humor) after annexing the GIII Sam F. Davis S. there in February, took a rained-off renewal of the GIII Bourbon S. in the Keeneland slop last October. Cont. p3 Justify | Benoit Photo IN TDN EUROPE TODAY ASTUTE AGENT HAS GLOBAL PERSPECTIVE >TDN Rising Star= Justify (Scat Daddy), almost certainly the Kelsey Riley sat down with Australia based Frenchman most highly regarded horse in the world to have not yet taken Louis Le Metayer to get his thoughts on various aspects of on stakes company, will get his class test on Saturday when he the Australian racing scene. Click or tap here to go straight faces the likes of MGISW Bolt d=Oro (Medaglia d=Oro) in the to TDN Europe. GI Santa Anita Derby. A 9 1/2-length jaw-dropping debut winner going seven panels here Feb. -
To Consignors Hip Color & No
Index to Consignors Hip Color & No. Sex Name, Year Foaled Sire Dam Barn 2 Property of Alliance Sales Agency Racing or broodmare prospect 1582 ch. m. She's Got Friends, 2015 Badge of Silver Friends Included Yearlings 1688 ch. c. unnamed, 2019 Can the Man Exotic Actress 1745 b. c. unnamed, 2019 Sky Kingdom Little Venice Barn 36 Property of Alliance Sales Agency Yearling 1026 dk. b./br. c. unnamed, 2019 Street Boss Donna D Barn 36 Consigned by Alliance Sales Agency, Agent Broodmare 912 b. m. Trac N Jam, 2008 El Corredor Swan River Barn 36 Consigned by Alliance Sales Agency, Agent II Yearling 938 dk. b./br. c. unnamed, 2019 Run Away and Hide Yaletown Barn 36 Consigned by Alliance Sales Agency, Agent IV Racing or broodmare prospect 1076 b. f. Hidden Rosie, 2016 Signature Red Yellowenglishrose Barn 39 Consigned by Amende Place (Lee McMillin), Agent Yearlings 1228 gr/ro. c. unnamed, 2019 Shackleford Silver Sal 1439 ch. f. unnamed, 2019 Gormley Honky Tonk Rose Barn 39 Consigned by Amende Place (Lee McMillin), Agent II Broodmare 1181 dk. b./br. m. Port Charlotte, 2012 Blame Port Roberto Barn 35 Consigned by Ballysax Bloodstock, Agent II Yearling 1158 b. f. unnamed, 2019 Outwork Our Nellie Barn 35 Consigned by Ballysax Bloodstock, Agent III Broodmare 1137 dk. b./br. m. Momma's Favorite, 2012 Sky Mesa Tres Dream Barn 35 Consigned by Ballysax Bloodstock, Agent VI Yearling 859 ch. f. unnamed, 2019 Street Boss Shoot the Moon Barn 35 Consigned by Ballysax Bloodstock, Agent VIII Yearling 977 ch. f. unnamed, 2019 Lord Nelson Sweetness 'n Light Barn 35 Consigned by Ballysax Bloodstock, Agent XVI Broodmare 1124 gr/ro. -
SUN LILY Barn 39 Hip No. 1213
Property of Godolphin Hip No. SUN LILY Barn 1213 Bay Mare; foaled 2016 39 Machiavellian Street Cry (IRE) .................... Helen Street (GB) Street Sense .......................... Dixieland Band Bedazzle ................................ Majestic Legend SUN LILY Storm Bird Storm Cat .............................. Terlingua Storm Lily .............................. (2004) Lion Cavern Crimplene (IRE) .................... Crimson Conquest By STREET SENSE (2004). Champion 2-year-old, classic winner of $4,383,- 200, Kentucky Derby [G1] (CD, $1,450,000), etc. Sire of 10 crops of racing age, 1294 foals, 967 starters, 70 black-type winners, 1 champion, 682 winners of 2177 races and earning $87,511,244, including McKinzie [G1] (8 wins, $3,453,560). Sire of dams of black-type winners Roaring Lion, Val - our Road, Military Zone, Plainsman, Flat Out Speed, Speed Franco, Shades of Victory, Carnival Colors (GB), Perfect Wife, Crawdaddy, K Club. 1st dam STORM LILY, by Storm Cat. Unplaced in 2 starts in England. Dam of 10 other registered foals, 9 of racing age, including a 2-year-old of 2020, 7 to race, 6 winners, including-- CLEAR WATER (f. by Hard Spun). Winner at 3 and 5, £23,873, in England; winner in 1 start at 5 in Germany, Grosser Preis von Engel & Volkers Dus - seldorf - Dusseldorfer Fliegerpreis [L]. (Total: $47,928). Gold City (g. by Pivotal). 2 wins at 2, £20,838, in England, 2nd Ripon Cham - pion Two-Year-Old Trophy [L]; winner at 5, 1,282,148 dirhams, in U.A.E., 2nd EGA Al Maktoum Challenge Round 2 [G2] , Emirates Holidays Burj Nahaar [G3] , Land Rover Firebreak S. [G3] , Lincoln MKC Dubai Creek Mile [L]. -
Graydar Oxbow
GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition. -
These Defendants Include: Patricia L. Caruso, Director of the MDOC; Unknown Straub, Deputy Director of the MDOC; Dave J
Case: 08-1779 Document: 00615826829 Filed: 08/27/2009 Page: 1 NOT RECOMMENDED FOR FULL-TEXT PUBLICATION File Name: 09a0614n.06 Nos. 08-1710/1779/1820 UNITED STATES COURT OF APPEALS FOR THE SIXTH CIRCUIT LAMONT BERNARD HEARD, ) ) Plaintiff-Appellant, ) ) v. ) ) PATRICIA CARUSO, named as ) ON APPEAL FROM THE Director of the Michigan Department ) UNITED STATES DISTRICT of Corrections, in her individual ) COURT FOR THE WESTERN capacity, et al., ) DISTRICT OF MICHIGAN ) Defendants-Appellees, ) ) O P I N I O N RANDALL MASKER, named as Mail ) Room Supervisor, in his individual ) capacity. ) ) Defendant-Appellee. ) _______________________________________) Before: MOORE, CLAY, and KETHLEDGE, Circuit Judges. KAREN NELSON MOORE, Circuit Judge. Lamont Bernard Heard (“Heard”), a Michigan prisoner proceeding pro se, appeals the district court’s grant of summary judgment in favor of Defendants-Appellees, several employees of the Michigan Department of Corrections (“MDOC”), in this civil-rights action filed under 42 U.S.C. § 1983.1 Additionally, Heard appeals the judgment 1These defendants include: Patricia L. Caruso, Director of the MDOC; Unknown Straub, Deputy Director of the MDOC; Dave J. Burnett, MDOC Special Activities Coordinator; Robert Mulvaney, MDOC Security Threat Group Coordinator; Jeri-Ann Sherry, Warden of Chippewa Correctional Facility (“Chippewa”); Greg McQuiggin, Deputy Warden of Chippewa; Michael Brown, Security Threat Group Coordinator at Chippewa; Steven Therrian, a lieutenant at Chippewa; Case: 08-1779 Document: 00615826829 Filed: 08/27/2009 Page: 2 in favor of MDOC employee Randall Masker (“Masker”) following a bench trial on Heard’s claim that Masker opened Heard’s legal mail outside Heard’s presence. These cases have been referred to a panel of the court pursuant to Rule 34(j)(1), Rules of the Sixth Circuit. -
CHESTNUT COLT Barn 31 Hip No
Consigned by Claiborne Farm, Agent Barn Hip No. 31 CHESTNUT COLT 845 Foaled April 25, 2006 Storm Bird Storm Cat ......................... Terlingua Forestry ............................ Pleasant Colony Shared Interest.................. Surgery CHESTNUT COLT Mr. Prospector Forty Niner........................ File Tour .................................. (1990) Full Pocket Fun Flight ......................... Fun and Tears By FORESTRY (1996). Stakes winner of $591,225, King's Bishop S. [G1], etc. Sire of 5 crops of racing age, 403 foals, 208 starters, 27 stakes winners, 139 winners of 327 races and earning $11,442,572 & $130,795(CAN) in N.A., including Smokey Glacken ($656,960, Distaff Breeders' Cup H. [G2] (AQU, $94,800), etc.), Diplomat Lady ($552,784, Hollywood Starlet S. [G1] (HOL, $273,600), etc.), Old Forester [G3] ($451,080 & $13,848 (CAN)), Forest Danger ($423,000, Carter H. [G1] (AQU, $210,000), etc.). 1st dam TOUR, by Forty Niner. 5 wins, 2 to 4, $254,939, Curious Clover H. [L] (HOL, $29,100), 2nd Bold Jill H. [L] (SA, $10,000), CERF H. [L] (HOL, $10,000), Very Subtle H.-R (HOL, $11,000), Frosty Shades H. (GG, $6,000), etc. Sister to FLIGHT FORTY NINE. Dam of 8 other registered foals, 8 of rac- ing age, including a 2-year-old of 2007, 6 to race, 4 winners-- TRIP (f. by Lord At War (ARG)). 11 wins, 3 to 5, $888,773, Turfway Breed- ers' Cup S. [G3], Turfway Breeders’ Cup S. [G3] (TP, $125,500), Chi- cago Breeders' Cup H. [G3], Bourbonette Breeders' Cup S. [L] (TP, $93,600), Iowa Oaks [L] (PRM, $90,000), Fairway Fun S. [L] (TP, $31,- 300), 2nd Delaware Oaks [G3], Regret S. -
SENSITIVE 9 Bay Mare (Branded Nr Sh
Barn B On Account of DARLEY, Hunter Valley, NSW Lot 150 SENSITIVE 9 Bay mare (Branded nr sh. off sh.) Foaled 2010 0 Mr. Prospector .................by Raise a Native .......... Machiavellian .................. SIRE Coup de Folie ............. by Halo....................... STREET CRY (IRE) ... Troy .......................... by Petingo .................. Helen Street .................. Waterway .................. by Riverman................ Bletchingly.................. by Biscay ...................... DAM Canny Lad....................... Jesmond Lass............. by Lunchtime (GB)....... SEANCES ................... Danehill (USA) ........... by Danzig ................... 1999 Spirit ............................. Star Aura ................... by Kaoru Star .............. STREET CRY (IRE) (Bay or Brown 1998-Stud 2003). 5 wins-1 at 2, Dubai World Cup, Gr.1. Champion USA Sire (AEI) 2010. Sire of 1115 rnrs, 749 wnrs, 89 SW, inc. Zenyatta (Breeders' Cup Classic S., Gr.1), Street Sense, Shocking, Whobegotyou, Tomcito, Long John, Street Boss, Pride of Dubai, Seventh Street, Winx, Lyric of Light, Victor's Cry, Majestic Roi, New Year's Day, Here Comes Ben, Street Hero, Cry and Catch Me, Princess Highway, etc. 1st Dam SEANCES, by Canny Lad. 5 wins at 1200, 1400m, $260,000, STC Millie Fox S., L, VRC Moet & Chandon H., STC Rooty Hill RSL Club & Resort H., AJC Waverley College Centenary P., 2d STC Makinson & d'Apice Series H., AJC Thakral Holdings Bob Hawke H., 3d STC Wenona Girl H. Half-sister to UNWORLDLY, GORDO, Daemons - Sikander (H.K.). Dam of 8 named foals, 6 to race, 4 winners, inc:- RENAISSANCE (f by Lonhro). 6 wins 1100 to 1400m, $234,630, AJC Sapphire S., Gr 2, St Johns Park H., STC 7 Steel Buildings Solutions H., Canterbury Event Centre H., Freeway Hotel Artarmon H., 2d Hawkesbury RC Darley Crown, L. -
ETCHED Chestnut Horse, 2005; 16.3 Hands DIPLOMAT LADY: 4 Wins, $552,784, Hollywood Starlet S-G1, Beaumont S-G2, Etc
ETCHED Chestnut Horse, 2005; 16.3 Hands DIPLOMAT LADY: 4 wins, $552,784, Hollywood Starlet S-G1, Beaumont S-G2, etc. Storm Bird Northern Dancer FOREST DANGER: 5 wins, $423,000 in 8 starts, Carter H-G1, etc. Sire. South Ocean Storm Cat QUIZ KID: 6 wins, $200,701 to 5, 2016 in Argentina, Gran Premio Estrellas Clas- Terlingua Secretariat sic-G1, Premio Pr Progreso-G3 twice, etc. Forestry Crimson Saint FANTASTIC FOUR: 5 wins, $168,289 to 4, 2016 in Argentina, Gran Premio Joaquin Bay, 1996 His Majesty V. Gonzalez-G1, Premio 25 De Mayo De 1810-G2, etc. Pleasant Colony Sun Colony Shared Interest SMOKEY GLACKEN: 10 wins, $656,960, Distaff Breeders’ Cup H-G2, etc. Dr. Fager Surgery Bold Sequence HOMERUN BERTI: 22 wins, $496,397 to 10, 2016, Lea County Sprint S, etc. OLD FORESTER: 6 wins, $462,632, Cliff Hanger S-G3, Canadian Turf H, Santa Unbridled Fappiano Claus S, etc. Set ncr at Gulfstream Park. Sire. Unbridled’s Song Gana Facil Trolley Song Caro (Ire) Unbridled Elaine Lucky Spell FEMALE LINE Gray or Roan, 1998 In Reality UNBRIDLED ELAINE. 6 wins at 2 and 3, $1,770,740, Breeders’ Cup Distaff Taylor’s Falls Nilene Wonder Carols Folly S-G1, Monmouth Breeders’ Cup Oaks-G2, Iowa Oaks, Pocahontas S, No Trespassing Bob’s Dusty Private Parking 2nd Pennsylvania Derby-G3, etc. Dam of 8 foals, 4 to race, 3 winners— ETCHED (Forestry). Stakes winner. Dosage Profile: 4 11 7 0 0 OUT OF BOUNDS (Discreet Cat). 3 wins, 2 to 4, $177,673 in U.S., U.A.E. -
The Triple Crown (1867-2020)
The Triple Crown (1867-2020) Kentucky Derby Winner Preakness Stakes Winner Belmont Stakes Winner Horse of the Year Jockey Jockey Jockey Champion 3yo Trainer Trainer Trainer Year Owner Owner Owner 2020 Authentic (Sept. 5, 2020) f-Swiss Skydiver (Oct. 3, 2020) Tiz the Law (June 20, 2020) Authentic John Velazquez Robby Albarado Manny Franco Authentic Bob Baffert Kenny McPeek Barclay Tagg Spendthrift Farm, MyRaceHorse Stable, Madaket Stables & Starlight Racing Peter J. Callaghan Sackatoga Stable 2019 Country House War of Will Sir Winston Bricks and Mortar Flavien Prat Tyler Gaffalione Joel Rosario Maximum Security Bill Mott Mark Casse Mark Casse Mrs. J.V. Shields Jr., E.J.M. McFadden Jr. & LNJ Foxwoods Gary Barber Tracy Farmer 2018 Justify Justify Justify Justify Mike Smith Mike Smith Mike Smith Justify Bob Baffert Bob Baffert Bob Baffert WinStar Farm LLC, China Horse Club, Starlight Racing & Head of Plains Partners LLC WinStar Farm LLC, China Horse Club, Starlight Racing & Head of Plains Partners LLC WinStar Farm LLC, China Horse Club, Starlight Racing & Head of Plains Partners LLC 2017 Always Dreaming Cloud Computing Tapwrit Gun Runner John Velazquez Javier Castellano Joel Ortiz West Coast Todd Pletcher Chad Brown Todd Pletcher MeB Racing, Brooklyn Boyz, Teresa Viola, St. Elias, Siena Farm & West Point Thoroughbreds Bridlewood Farm, Eclipse Thoroughbred Partners & Robert V. LaPenta Klaravich Stables Inc. & William H. Lawrence 2016 Nyquist Exaggerator Creator California Chrome Mario Gutierrez Kent Desormeaux Irad Ortiz Jr. Arrogate Doug -
Frankie on Snowfall in Cazoo Oaks
THURSDAY, 3 JUNE 2021 FRANKIE ON SNOWFALL LAST CALL FOR BREEZERS AT GORESBRIDGE IN NEWMARKET By Emma Berry IN CAZOO OAKS NEWMARKET, UKCCA little later than scheduled, the European 2-year-old sales season will conclude on Thursday with the Tattersalls Ireland Goresbridge Breeze-up, which has returned to Newmarket for a second year owing to ongoing Covid travel restrictions. What was already a bumper catalogue for a one-day sale of more than 200 horses has been beefed up still by the inclusion of 16 wild cards that have been rerouted from other recent sales for a variety of reasons. They include horses with some pretty starry pedigrees, so be prepared for some of the major action to take place late in the day. Indeed the last three catalogued all have plenty to recommend them on paper. Lot 241 from Mayfield Stables is the American Pharoah colt out of the Irish champion 2-year-old filly Damson (Ire) (Entrepreneur). Cont. p5 Snowfall | PA Sport IN TDN AMERICA TODAY by Tom Frary BAFFERT SUSPENDED FROM CHURCHILL AFTER MEDINA Aidan O=Brien has booked Frankie Dettori for the G3 Musidora SPLIT POSITIVE S. winner Snowfall (Jpn) (Deep Impact {Jpn}) in Friday=s G1 Trainer Bob Baffert was suspended for two years by Churchill Downs Cazoo Oaks at Epsom, for which 14 fillies were confirmed on after the split sample of GI Kentucky Derby winner Medina Spirit (Protonico) came back positive. Click or tap here to go straight to Wednesday. Registering a career-best when winning by 3 3/4 TDN America.