Automatically Generated PDF from Existing Images

UTCL/ENV/MUM/2021/97 Date: 07th June, 2021

To The Director, IA.III CRZ Division The Ministry of Environment, Forests & Climate Change Govt. of India, Indira Paryavaran Bhavan, Jorbag Road, Aliganj, New Delhi – 110 003

Sub: CRZ clearance for the Conveying System of Cement Storage Facility at Mangalore Bulk Terminal by M/s. Ultra Tech Cement Ltd. (Unit: - Mangalore Bulk Terminal) at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka)- Reg. relisting the project and submission of EDS reply for seeking Post Facto Clearance.

Ref : 1. Application submitted to MoEFCC, New Delhi dated 28th June 2018 for seeking Post facto clearance; 2. EDS by MoEFCC, New Delhi dated 11th July 2018 for specific recommendations of concerned SCZMA; 3. Application submitted to KSCZMA dated 13th August 2018, proposal number SIA/KA/MIS/28659/2010 and revised application submitted on 24th September 2020; 4. Recommendation from KCZMA in meeting dated 4th March 2021 for Post Facto approval.

Dear Sir, M/s Ultra Tech Cement Ltd. is having a Conveying System of Cement Storage Facility of 1 MTPA capacity at Mangalore Bulk Terminal. This is not a cement manufacturing facility and consists only of handling, storage and packing facility. For storage of cement there are three silos of capacity 6000 tonnes and one packer which are out of CRZ. For transportation of material, out of total length of pipeline of 600 meters only 150 meters of the closed pipeline falls under para 4 (ii) d of CRZ Notification 2011 which is a permissible activity.

In this context, we would like to submit that the project was accorded Environmental Clearance by the Department of Forest, Environment and Ecology, Government of Karnataka in the year 1998. Copy of the same is enclosed. During the second renewal of the clearance, State Govt. had advised to obtain required CRZ clearance from competent authority vide letter no. FEE 42 ECO 2008 dated 04.02.2009. Accordingly, we had submitted application and the project was recommended by Karnataka State Coastal Zone Management Authority (KSCZMA), to MoEFCC, New Delhi for CRZ Clearance vide letter No. FEE 54 CRZ 2009 dated 16.07.2010.

Subsequent to this, the application for CRZ Clearance for the same proposal was submitted to MoEFCC, New Delhi on 11th February 2011 (F.No. 11-78/2010-IA-III). copy enclosed. Based on the documents submitted, the propsoal was recommended by the Committee in the Minutes of the 102nd Meeting of the EAC for Coastal

UltraTech Cement Limited (Manufacturing & Projects) A-Wing, Ahura Centre, 1st Floor, Mahakali Caves Road, Andheri (E) Mumbai – 400 093 Tel. 022-66917400 │ F : +91 22 2824 4970 │ W : www.ultratechcement.com Registered Office : ‘B’-Wing, Ahura Centre, 1st Floor, Mahakali Caves Road, Andheri (E) Mumbai – 400 093 T : +91 22 6691 7800 │ CIN: L26940MH2000PLC1287420

Regulation Zone, held on 23rd -24th June, 2011. MoEFFCC taking into consideration the OM dated 16.11.2010 advised to submit the Board of Resolution and the same was submitted vide letter no. UTCL/ENV/DEL/2012/28 dated 15.05.2012. However, on the submission of all required documents the file could not be processed and not received clearance. The Karnataka State Pollution Control Board has already issued the consent from time to time and latest Consent issued for the project was granted on 03.11.2016 valid up to 03.09.2021.

As per Gazette Notification issued by MoEFCC, New Delhi dated 6th March 2018, we have resubmitted the application on 26.06.2018 along with duly filled Form I as per annexure IV of CRZ Notification 2011, approved CRZ map and supporting documents to MoEFCC, New Delhi for seeking Post facto clearance. Subsequently, on 11th July, 2018 an EDS was issued by the Ministry for specific recommendations of concerned SCZMA for regularization of violation. (Referring Clause 4.3 (ii) Gazette Notification issued by MOEFCC dated 6th March 2018).

Application in this regard was submitted to KSCZMA on 13.08.2018, proposal number SIA/KA/MIS/28659/2010. The technical presentation was held before KSCZMA in 24th meeting on 16th-17th November 2018. The Regional Director (ENV) vide letter dated 25.01.2019 advised to submit the proposal as per para 8 (i) of CRZ notification 2019 along with the CRZ map on 1: 4000 scale from MoEF approved agency and accordingly the application was submitted on 24th September 2020.

Thereafter, the matter was discussed in the KCZMA meeting dated 4th March 2021 and as per the minutes of meeting, the proposal has been recommended to the MOEFCC, New Delhi for Post Facto approval as per the Notification dated 6th March 2018. Copy of the minutes of meeting recommending the project is enclosed.

Now, we are submitting the reply of the EDS issued by the Ministry on 11th July, 2018 for specific recommendations of concerned SCZMA for regularization of violation. (Referring Clause 4.3 (ii) Gazette Notification issued by MOEFCC dated 6th March 2018) along with complete application as per 4.2 of CRZ Notification 2011 and as per para 8 (i) of CRZ notification 2019.

Kindly consider our application for the further and accord CRZ Clearance at the earliest.

Yours faithfully

For M/s. UltraTech Cement Ltd.,

Dr. K.V. Reddy [Sr. VP & Corporate Head-Environment] Encl: As above

Recommendation of KCZMA in the KCZMA meeting dated 4th March 2021

APPLICATION SUBMITTED TO THE MINISTRY

From: [email protected] [mailto:[email protected]] Sent: Thursday, June 28, 2018 7:35 PM To: [email protected]; [email protected]; [email protected]; Koyya Reddy Cc: [email protected]; [email protected]; [email protected] Subject: Acknowledgement Slip for EC application

CAUTION: This email originated from outside of the organization Do not click links or open attachments unless you recognize the sender and know the content is safe

Acknowledgement Slip for EC application

This is to acknowledge that the proposal has been successfully uploaded on the portal of the Ministry. The proposal shall be examined in the Ministry to ensure that required information has been submitted. An email will be sent seeking additional information , if any, within 20 working days. Once verified, an acceptance letter shall be issued to the propject proponent .

Following should be mentioned in further correspondence

1. Proposal : IA/KA/MIS/75622/2018 No. 2. Category of : Infrastructure and Miscellaneous Projects + CRZ the Proposal CRZ Clearance for Existing Conveying System of Cement 3. Name of the : Bulk Terminal at New Mangalore Port, P.B. No. 17, Beach proposal Road, Panambur, Mangalore (Karnataka) 4. Date of Receipt of : 28/06/2018 Proposal 5. Name of the Project proponent along with contact details

a) Name of the proponent : M/s. UltraTech Cement Ltd. b) State : Karnataka c) District : Dakshina Kannada d) Pincode : 400093

EC Report

1. Project Details

Whether it is a violation case and application is being submitted under Notification No. S.O.804(E) dated 14.03.2017 ? : No

1. Project Details

i. Proposal No. : IA/KA/MIS/75622/2018 ii. MoEFCC File No. : NIL iii.Short narrative of the project: CRZ Clearance for Existing Conveying System of Cement Bulk Terminal at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka) iv. Project Sector : Infrastructure and Miscellaneous Projects + CRZ v. Company/Proponent : M/s. UltraTech Cement Ltd.

vi.Details of State of the project

Details of State of the project S.no. State Name District Name Tehsil Name 1. Karnataka Dakshina Kannada Mangalore

vii.Date of TOR Granted N/A viii.TOR letter issued by Ministry: N/A ix.Date of Submission for EC: 28 Jun 2018 x.Project Type: New

2. Uploaded Documents of EIA/EMP,Risk Assessment,Public Hearing etc. i.EIA/EMP: Annexure-EIA/EMP ii.Risk Assessment: Annexure-Risk Assessment iii.Public Hearing: Annexure-Public Hearing iv. Date of Public Hearing: 01 Jun 2018 v. Uploaded Additional Report/Study/Document as desired by Ministry/EAC: Annexure-Additional Report/Study/Document vi. Uploaded Cover Letter: Annexure-Cover Letter vii.Remarks: M/s Ultra Tech Cement Ltd. is operating a Cement Bulk Terminal of 1 MTPA capacity. This is not a manufacturing facility and consists only of handling, storage and packing facility. For storage there are three silos of capacity 6000 tonnes and one packer which are out of CRZ. For transportation of material out of total length of pipeline of 600 meters only 150 meters of the closed pipeline falls under CRZ (CRZ II) which is a permitted activity. In this context, we would like to submit that the

Additional Attachments, if any S.no. Attached File Date of Submission 1. ANNEXURES 28 Jun 2018 2. ANNEXURES 28 Jun 2018 3. documents remaining anne 28 Jun 2018

3. Additional Detail Sought: NIL

4. Accredited Consultant Details

i. Accreditation status : No ii. Reason for not hiring the Consultant : The Karnataka State Coastal Zone Management Authority (KSCZMA) recommended the project to MoEFCC, New Delhi for CRZ Clearance vide letter No. FEE 54 CRZ 2009 dated 16.07.2010. our project was recommended by the Committee in the Minutes of the 102nd Meeting of the EAC for Coastal Regulation Zone, held on 23rd -24th June, 2011. for regularization of the proposal as per Gazette Notification issued by MOEFCC dated 6th March 2018, we are resubmitting the application .

5. Undertaking

I hereby give undertaking that the data and information given in the application and enclosures are true to be best of my knowledge and belief and I am aware that if any part of the data and information found to be false or misleading at at any stage, the project will be rejected and clearance given, if any to the project will be revoked at our risk and cost.

i. Name of Applicant : Dr. K.V. ii. Designation : Vice President & Corporate Head - Environment iii. Name of Company(Applicant Name should not be given here) : M/s. UltraTech Cement Ltd. iv. Address : Ahura Centre, 1st Floor, ‘A’ Wing , Mahakali Caves Road, Andheri (E), Mumbai- 400 093 v. Uploaded copy of documents in support of the competence/authority of the person making this application to make application on behalf of the User Agency: Annexure-Uploaded copy of documents in support of the competence/authority of the person making this application to make application on behalf of the User Agency INDEX S. No. Contents Page No.

APPLICATION FOR EC

I. Form I as per annexure IV of CRZ Notification 2011

II. FORM V/ ANNEXURE -V (Under para 8 (i) of CRZ Notification, 2019) III. Updated Pre - Feasibility Report

III. Annexures As below

ANNEXURES

S. No. Annexure Name Annexure No.

1. Environmental Clearance by the Department of Forest, Annexure -1 Environment and Ecology, Government of Karnataka, 1998

2. Environmental Clearance Second Renewal, 2009 Annexure -2

3. Letter by KSCZMA to MoEFCC dated 16.07.2010 Annexure -3 4. Letter reg. Application Submission for CRZ Clearance Annexure- 4 submitted on 8th February 2011 & File (F.No. 11-78/2010-IA-III) Status 5. Minutes of the 102nd Meeting of the EAC-CRZ dt. 23rd -24th Annexure- 5 June, 2011.

6. Receipt of letter for Board Resolution submission dt. Annexure -6 22.05.2012

7. Letters submitted to MoEFCC for CRZ Clearance Annexure -7

8. Consent issued by Karnataka SPCB on 03.11.2016 Annexure -8

9. Earlier Approved CRZ map Annexure -9

10. CRZ REPORT OF NCSCM Annexure -10

11. APPROVED MAP AND REPORT FROM NCSCM, CHENNAI Annexure -11 12. RISK ASSESMENT REPORT AND Annexure -12 DISASTER MANAGEMENT PLAN

******

FORM -I

CRZ Clearance for Existing Conveying System of Cement Bulk Terminal Form- I at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka) M/s UltraTech Cement Limited (Unit: Mangalore Bulk Terminal)

Form-I for seeking clearance for Project Attracting CRZ Notification

(I) Basic information:

Name of the Project:- CRZ Clearance for Existing Conveying System of Cement Bulk Terminal at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka) Location or site alternatives under At New Mangalore Port, P.B. No. 17, Beach Road, consideration:- Panambur, Mangalore (Karnataka) Size of the project (in terms of total area) :- The project exists in Total Area of 1.67 ha. CRZ classification of the area :- The area falls in CRZ-II . Area under CRZ Clearance is only 0.0411 ha (CRZ- II).

All the activities of the bulk terminal are outside CRZ (1 Km away from HTL), out of total length of pipe conveyor of 600 mtrs. Only 150 mtrs of the closed pipe conveying system from the creek falls under CRZ II. Expected cost of the project:- Rs.32.16 Crore, Existing Plant Running Since Oct’98 Contact Information Dr. K.V. Reddy Sr. VP and Corporate Head (Environment) M/s Ultratech Cement Ltd. Ahura Centre, ‘A’ Wing, 1st Floor, Mahakali Caves Road, Andheri (East), Mumbai- 400093 Email – [email protected]

(II) Activity

1. Construction, operation or decommissioning of the Project involving actions, which will cause physical changes in the locality (topography, land use, changes in water bodies, and the like)

S. No. Information/Checklist Yes/No Details thereof (with approximate quantities/ Confirmation rates, wherever possible) with source of information data

1.1 Permanent or temporary change in No No change because it’s an existing project. land use, land cover or topography including increase in intensity of The Unit is existing in 1.67 ha area which has land use (with respect to local land been leased out by New Mangalore Port use plan) Authorities for cement storage facility. This is not a manufacturing facility and consists of only handling, storage and packaging. There are three silos of capacity 6000 Tonnes each and one packer which are out of CRZ. For transportation of material, out of total length of pipeline of 600 meters only 150 m of closed pipeline falls under

1 CRZ Clearance for Existing Conveying System of Cement Bulk Terminal Form- I at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka) M/s UltraTech Cement Limited (Unit: Mangalore Bulk Terminal)

S. No. Information/Checklist Yes/No Details thereof (with approximate quantities/ Confirmation rates, wherever possible) with source of information data

CRZ (CRZ II) which is a permissible activity.

1.2 Details of CRZ classification as per Yes The area falls in CRZ-II. the approved Coastal Zone Area under CRZ Clearance is only 0.0411 ha Management Plan? (CRZ-II).

All the activities of the bulk terminal are outside CRZ (1 Km away from HTL), out of total length of pipe conveyor of 600 mtrs. Only 150 mtrs of the closed pipe conveying system from the creek falls under CRZ II. 1.3 Whether located in CRZ-I area? No No. The area falls in CRZ-II . Area under CRZ Clearance is only 0.0411 ha (CRZ-II). 1.4 The distance from the CRZ-I areas. Yes 1 km The existing storage facility is at a distance of 1 Km from the HTL of the sea Hence, the proposed storage facility is outside CRZ.

1.5 Whether located within the hazard No No. The site is not located within the hazard zone zone as mapped by Ministry of as mapped by Ministry of Environment and Environment and Forests/National Forests/National Disaster Management Authority. Disaster Management Authority?

1.6 Whether the area is prone to No The area falls under Seismic Zone III. As such the cyclone, tsunami, tidal surge, New Mangalore Port area is not prone to subduction, earthquake etc.? earthquake, cyclone, tsunami, tidal surge, subduction, etc

1.7 Whether the area is prone for No The area is prone for saltwater ingress. saltwater ingress?

1.8 Clearance of existing land, No No Clearance of existing land, vegetation and vegetation and buildings? buildings is required as the Unit is already existing.

1.9 Creation of new land uses? No No new land uses as the Unit is already existing.

1.10 Pre-construction investigations e.g. No Project is running since 1998. Therefore, the same bore hole, soil testing? is not applicable.

1.11 Construction works? No No Construction required.

1.12 Demolition works? No No Demolition required.

1.13 Temporary sites used for No Temporary sites used for construction works or construction works or housing of housing of construction workers. construction workers?

1.14 Above ground buildings, structures No No requirement of above ground buildings, or earthworks including linear structures or earthworks including linear

2 CRZ Clearance for Existing Conveying System of Cement Bulk Terminal Form- I at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka) M/s UltraTech Cement Limited (Unit: Mangalore Bulk Terminal)

S. No. Information/Checklist Yes/No Details thereof (with approximate quantities/ Confirmation rates, wherever possible) with source of information data

structures, cut and fill or structures, cut and fill or excavations. excavations

1.15 Underground works including No No Underground works. mining or tunneling?

1.16 Reclamation works? No No Reclamation works.

1.17 Dredging/reclamation/ land No This is an existing project. No filling/disposal of dredged material Dredging/reclamation/ land filling/disposal of etc.? dredged material etc.

1.18 Offshore structures? No None.

1.19 Production and manufacturing No No Production and manufacturing processes processes? involved.

1.20 Facilities for storage of goods or Yes There are three silos of capacity 6000 MT each. materials? The storage facility is located outside the CRZ.

1.21 Facilities for treatment or disposal No No generation of solid waste or liquid effluents. of solid waste or liquid effluents? Therefore, no facilities for treatment or disposal.

1.22 Facilities for long term housing of No No long term housing of operational workers are operational workers? required. Only local labourers are working in plant.

1.23 New road, rail or sea traffic during No New road, rail or sea traffic during construction or construction or operation? operation.

1.24 New road, rail, air waterborne or No No new road, rail, air waterborne or other transport other transport infrastructure infrastructure including new or altered routes and including new or altered routes and stations, ports, airports. stations, ports, airports etc? This is an existing unit. Transport infrastructure is already existing. NH-66 ( as per old NH-17) runs adjacent to the proposed site and the Panambur beach roads lies at the north side. 1.25 Closure or diversion of existing No Transport infrastructure is already existing. No transport routes or infrastructure Closure or diversion of existing transport routes. leading to changes in traffic No change in existing traffic movements. movements?

1.26 New or diverted transmission lines No No new or diverted transmission lines or pipelines. or pipelines? There is existing pipeline of total length 600 meters out of which only 150 meters falls under CRZ II.

1.27 Impoundment, damming, No No Impoundment, damming, culverting, culverting, realignment or other realignment or other changes to the hydrology of changes to the hydrology of watercourses or aquifers.

3 CRZ Clearance for Existing Conveying System of Cement Bulk Terminal Form- I at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka) M/s UltraTech Cement Limited (Unit: Mangalore Bulk Terminal)

S. No. Information/Checklist Yes/No Details thereof (with approximate quantities/ Confirmation rates, wherever possible) with source of information data

watercourses or aquifers?

1.28 Stream and river crossings? No No stream and river crossings. The Unit is located at New Mangalore Port.

1.29 Abstraction or transfers of water Yes Total water requirement is 2 KLPD water which will form ground or surface waters? be supplied by New Mangalore Port.

1.30 Changes in water bodies or the No This is an existing unit. No changes in water land surface affecting drainage or bodies or the land surface affecting drainage or run-off? run-off.

1.31 Transport of personnel or materials Yes For transportation of materials, there is existing for construction, operation or pipeline of 600 m of which only 150 m is falling decommissioning? within CRZ. Mangalore Bulk Terminal is fully automated terminal and operating in the New Mangalore Port Trust at Panambur. Raw material like cement comes from Gujarat cement works by ship and packing and distribution is done by road.

1.32 Long-term dismantling or No No Long-term dismantling or decommissioning or decommissioning or restoration restoration works. works?

1.33 Ongoing activity during No No. This is an existing unit. decommissioning which could have an impact on the environment?

1.34 Influx of people to an area in either No No influx of people to an area in either temporarily temporarily or permanently? or permanently.

1.35 Introduction of alien species? No No introduction of alien species. Already existing, well –established transport infrastructure is used for transportation.

1.36 Loss of native species or genetic No No loss of native species or genetic diversity. diversity? Already existing, well –established transport infrastructure is used for transportation.

1.37 Any other actions? No Not Applicable

2. Use of Natural resources for construction or operation of Project (such as land, water, materials or energy, especially any resources which are non-renewable or in short supply).

4 CRZ Clearance for Existing Conveying System of Cement Bulk Terminal Form- I at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka) M/s UltraTech Cement Limited (Unit: Mangalore Bulk Terminal)

Sr. Information/Checklist Yes/No Details thereof (with approximate quantities/ No. Confirmation rates, wherever possible) with source of information data

2.1 Land specially undeveloped or No It’s an existing project. The Unit is existing in 1.67 agricultural land (ha) ha area which has been leased out by New Mangalore Port Authorities for cement storage facility. This is not a manufacturing facility and consists of only handling, storage and packaging. There are three silos of capacity 6000 Tonnes each and one packer which are out of CRZ. For transportation of material, out of total length of pipeline of 600 meters only 150 m of closed pipeline falls under CRZ (CRZ II).

2.2 Water (expected source & Yes Present requirement of water 2 KLPD water and competing users) unit: KLD source of supply would be New Mangalore Port Trust (NMPT). No additional water required.

2.3 Minerals (MT) No Not Applicable.

2.4 Construction material – stone, No Not Applicable. aggregates, sand/soil (expected source – MT)

2.5 Forests and timber (source – MT) No Not Applicable

2.6 Energy including electricity and Yes Power Requirement is about 500 KVA for the fuels (source, competing users) functioning of the unit which is sourced from Unit: fuel (MT), energy (MW) Mangalore Electricity Supply Company limited (MESCO). A D.G set of 1 MW for back up use only. No additional power acquired.

2.7 Any other natural resources (use No No any other natural resources. appropriate standard units)

3.0 Use, storage, transport, handling or production of substances or materials, which could be harmful to human health or the environment or raise concerns about actual or perceived risks to human health

Sr. Information/Checklist Yes/No Details thereof (with approximate No. Confirmation quantities/ rates, wherever possible) with source of information data

3.1 Use of substances or materials, No No Production and manufacturing which are hazardous (as per MSIHC processes involved. Only storage, handling rules) to human health or the and transportation is involved. environment (flora, fauna, and water supplies)

5 CRZ Clearance for Existing Conveying System of Cement Bulk Terminal Form- I at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka) M/s UltraTech Cement Limited (Unit: Mangalore Bulk Terminal)

Sr. Information/Checklist Yes/No Details thereof (with approximate No. Confirmation quantities/ rates, wherever possible) with source of information data

3.2 Changes in occurrence of disease or No No such changes are envisaged. affect disease vectors (e.g. insect or water borne diseases)

3.3 Affect the welfare of people e.g. by No Not Applicable changing living conditions?

3.4 Vulnerable groups of people who No No effect envisaged. could be affected by the project e.g. hospital patients, children, the elderly etc.,

3.5 Any other causes, that would affect No Not Applicable local communities, fisherfolk, their livelihood, dwelling units of traditional local communities etc

4.0 Production of solid wastes during construction or operation or decommissioning (MT/month)

Sr. Information/Checklist Yes/ Details thereof (with approximate quantities/ No. Confirmation No rates, wherever possible) with source of information data

4.1 Spoil, overburden or mine No No generation of solid waste or liquid effluents. wastes Therefore, no facilities for treatment or disposal.

4.2 Municipal waste (domestic No No generation of solid waste or liquid effluents. and or commercial wastes) Therefore, no facilities for treatment or disposal.

4.3 Hazardous wastes (as per No None. Hazardous Waste Management Rules)

4.4 Other industrial process No No generation of solid waste or liquid effluents. wastes Therefore, no facilities for treatment or disposal.

4.5 Surplus product No No surplus product.

4.6 Sewage sludge or other No No effluent generated. sludge from effluent treatment

4.7 Construction or demolition No No Construction/ demolition work is involved. wastes

6 CRZ Clearance for Existing Conveying System of Cement Bulk Terminal Form- I at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka) M/s UltraTech Cement Limited (Unit: Mangalore Bulk Terminal)

4.8 Redundant machinery or No No Redundant machinery or equipment. equipment

4.9 Contaminated soils or other No Not envisaged. materials

4.10 Agricultural wastes No Not Applicable.

4.11 Other solid wastes No None.

5.0 Release of pollutants or any hazardous, toxic or noxious substances to air (kg/hr)

Sr. Information/Checklist Yes/ Details thereof (with approximate quantities/ No Confirmation No rates, wherever possible) with source of information data

5.1 Emissions from combustion of Yes Emission mainly from diesel operated machines fossil fuels from stationary or in cement plant. mobile sources

5.2 Emissions from production No It’s a packing plant. No production from this Unit. processes

5.3 Emissions from materials Yes The fugitive emission will be there due to the handling including storage or transportation activities. The dust particles give transport rise to increase in PM level. Covered conveyors are utilized for transportation of inside the plant. The proper mitigating measures will be envisaged to minimize them. Dust suppression will be done by water sprinkling during the above mentioned activities.

5.4 Emissions from construction No Its an existing unit. No construction. activities including plant and equipment

5.5 Dust or odours from handling No No handling of construction materials, sewage of materials including and waste is there. This is an existing unit. construction materials, sewage and waste

5.6 Emissions from incineration of No No incineration of waste is there. waste

5.7 Emissions from burning of No No burning of waste is there. waste in open air (e.g. slash materials, construction debris)

5.8 Emissions from any other No Not applicable sources

7 CRZ Clearance for Existing Conveying System of Cement Bulk Terminal Form- I at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka) M/s UltraTech Cement Limited (Unit: Mangalore Bulk Terminal)

6.0 Generation of Noise and vibration, and emissions of Light and heat

Sr. Information/Checklist Yes/ Details thereof (with approximate quantities/ No. Confirmation No rates, wherever possible) with source of information data

6.1 From operation of equipment Yes Due to operation of machinery, there is likely e.g. engines, ventilation plant, hood of some increase in noise. The noise level crushers near the machinery and it varies from 60 dB (A) to 70 dB (A) and the expected noise levels at the project boundary will be 55 to 60 dB (A). Proper noise abatement measures are being taken and persons working just close to machine and machine operators will be provided with personal protective equipment viz. Ear plugs/ Ear muffs etc. for further protection. Vibrations due to any other operation are negligible.

6.2 From industrial or similar Yes There is generation of noise due to the running processes of the machinery. Proper mitigation measures are taken for the reduction of noise levels i.e. acoustic enclosures and the workers are providers 6.3 From construction or No Not applicable demolition

6.4 From blasting or piling No Not applicable

6.5 From construction or Yes There is some noise due to movement of operational traffic machine/ vehicle but that will be within the prescribed limit.

6.6 From lighting or cooling No Not Applicable systems

6.3 From construction or No None. demolition

7.0 Risks of contamination of land or water from releases of pollutants into the ground or into sewers, surface waters, groundwater, coastal wasters or the sea

Sr. Information/Checklist Yes/ Details thereof (with approximate quantities/ No. Confirmation No rates, wherever possible) with source of information data

8 CRZ Clearance for Existing Conveying System of Cement Bulk Terminal Form- I at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka) M/s UltraTech Cement Limited (Unit: Mangalore Bulk Terminal)

7.1 From handling, storage, use No No use/ handling of hazardous material except or spillage of hazardous during annual oil change period, which is being materials handled in closed containers. Also care is taken during its use for lubrication of external part of equipment, that nothing falls on ground to contaminate soil. Equipments are maintained to see that they remain leakage free.

7.2 From discharge of sewage or No Treatment of domestic waste water other effluents to water or the land (expected mode and place of discharge)

7.3 By deposition of pollutants No Due silo is fully well equipped with latest dust emitted to air into the land or collectors and covered with shed to keep dust into water free operation.

7.4 From any other sources No Not Applicable

7.5 Is there a risk of long term No Not Applicable build up of pollutants in the environment from these sources?

8.0 Risk of accidents during construction or operation of the project, which could affect human health or the environment Sr. Information/Checklist Yes/N Details thereof (with approximate No. Confirmation o quantities/ rates, wherever possible) with source of information data

8.1 From explosions, spillages, No No chance of accident on account of fires etc and from storage, explosion, spillage, fire or hazardous handling, use or production of substances. hazardous substances Proper maintenance operation and leak proof condition of machineries eliminate any eventuality.

8.2 From any other causes No Not Applicable

8.3 Could the project be affected No Not Applicable by natural disasters causing environmental damage (e.g. floods, earthquakes, landslides, could burst etc)?

9.0 Factors which should be considered (such as consequential development) which could lead to environmental effects or the potential for cumulative impacts with other existing or planned activities in the locality

9 CRZ Clearance for Existing Conveying System of Cement Bulk Terminal Form- I at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka) M/s UltraTech Cement Limited (Unit: Mangalore Bulk Terminal)

Sr. Information/Checklist Yes/N Details thereof (with approximate No. Confirmation o quantities/ rates, wherever possible) with source of information data

9.1 Lead to development of Yes Project results in considerable growth of supporting, facilities, ancillary the surrounding areas by increased direct development or development and indirect employment opportunities in stimulated by the project which the region including ancillary development could have impact on the and no adverse effect on environment. environment e.g.:

Supporting infrastructure (roads, power supply, waste or waste water treatment, etc) Housing development extractive industries supply industries other

9.2 Lead to after use of the site, No Not Applicable which could have an impact on the environment

9.3 Set a precedent for later No Not Applicable developments

9.4 Have cumulative effects due to No Not existing in the area and hence no proximity to other existing or cumulative impacts has been seen. planned projects with similar effects

(III) Environmental Sensitivity

Sr. Areas Name/ Aerial distance (within 15 km) Proposed No. project location boundary Identity

1 Areas protected under No Not Applicable international conventions, national or local legislation for their ecological, landscape, cultural or other related value

2 Areas which are important or CRZ- I CRZ- I Area Arabian Sea (1 km from sensitive for ecological project Site) reasons - Wetlands, watercourses or other water

10 CRZ Clearance for Existing Conveying System of Cement Bulk Terminal Form- I at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka) M/s UltraTech Cement Limited (Unit: Mangalore Bulk Terminal)

Sr. Areas Name/ Aerial distance (within 15 km) Proposed No. project location boundary Identity

bodies, coastal zone, biospheres, mountains, forests

3 Areas used by protected, CRZ I, II The CRZ-1 is considered the most important or sensitive species ecologically sensitive areas such as of flora or fauna for breeding, mangroves, coral reefs and sand dunes. nesting, foraging, resting, over wintering, migration

4 Inland, coastal, marine or Arabian Sea Arabian Sea ( 1km from Project Site) underground waters

5 State, National boundaries No None.

6 Routes or facilities used by NH-66 (as NH-66 (as per old NH- 17) from Mumbai to the public for access to per old NH- Kochi at about 250 meters. recreation or other tourist, 17) pilgrim areas

7 Defence installations No None

8 Densely populated or built-up Mangalore Mangalore City ( 9 km from Project Site) area City

9 Areas occupied by sensitive Yes Unit established at New Mangalore Port man-made land uses Area. It’s an Industrial Area. (hospitals, schools, places of worship, community facilities)

10 Areas containing important, CRZ I, II The CRZ-1 is considered the most high quality or scarce ecologically sensitive areas such as resources (ground water mangroves, coral reefs, fisheries and sand resources, surface resources, dunes. forestry, agriculture, fisheries, tourism, minerals)

11 Areas already subjected to No New Mangalore Port Trust has leased pollution or environmental several units in this region. damage. (those where existing legal environmental standards are exceeded)

12 Areas susceptible to natural No Not Applicable hazard which could cause the project to present

11 CRZ Clearance for Existing Conveying System of Cement Bulk Terminal Form- I at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka) M/s UltraTech Cement Limited (Unit: Mangalore Bulk Terminal)

Sr. Areas Name/ Aerial distance (within 15 km) Proposed No. project location boundary Identity

environmental problems (earthquakes, subsidence, landslides, erosion, flooding or extreme or adverse climatic conditions)

******

12 FORM V/ ANNEXURE -V (Under para 8 (i) of CRZ Notification, 2019) ANNEXURE -V (Under para 8 (i) of CRZ NOTIFICATION dated 18th January, 2019)

PROJECT INFORMATION DETAILS

1. PROJECT DETAILS A. Project Name CRZ Clearance of the pipe conveying system of cement storage facility at Mangalore Bulk Terminal at New Mangalore Port, Dakshina Kannada, (Karnataka) by M/s UltraTech Cement Limited. B. Survey No./ Village/ Co-ordinates . The project site entirely falls under New Mangalore Port Area. . CRZ-II Starting Point 12° 56’ 22.151’’ N & 74° 48’ 49.662” E and 12° 56’ 4.374” N & 74° 48’ 58.959” E. . The project site falls within sheet no. D 43 U13/NW (Map no. KA 4) of approved CZMP Map prepared under CRZ Notification 2011. C. District Dakshina Kannada D. State Karnataka E. Whether the proposal is for (Select relevant field) (i) Fresh Clearance under CRZ Fresh Clearance under CRZ. (ii) Amendment to an already issued - CRZ clearance (iii) Extension of validity of an already - issued CRZ clearance F. Name of the Applicant M/s. Ultratech Cement Limited (Unit: - Mangalore Bulk Terminal) G. Address of the Applicant Beach Road, Panambur. PO-Mangalore, Dist-Dakshina Kannada Karnataka, PIN-575010 H. Contact details (Telephone nos. and e-mail Kausik Bishayee address) Asst. General Manager & BT Head Landline: +91 8242408113 Mobile : +91 8722804602 Email- [email protected] I. Cost of the project (Rs in crores) 8.5 Crs 2. BENEFITS OF THE PROJECT A. Details of Project Benefits  M/s Ultra Tech Cement Ltd. is operating a Cement Bulk Terminal of 1 MTPA capacity which only consists handling, storage and packing facility.  No manufacturing facility is there.  The project site entirely falls under New Mangalore Port Area.  For storage, there are three silos of capacity 6000 tons each and one packer which are out of CRZ.  For transportation of material, out of total length of pipeline of 600 meters only 150 meters of the closed pipeline falls under CRZ (CRZ II) which is a permissible activity. B. Employment Likely to be Generated Yes, (Yes/No)If Yes (i) Total Manpower Requirement 64 (ii) Permanent Employment (Numbers) 12 (iii) Temporary Employment (Numbers) 52 (iv) Temporary Employment- During It is a pipe conveying system, which is a part of Construction (Numbers) Bulk terminal facility. (v) Temporary Employment- During It is a pipe conveying system, which is a part of Operation (Numbers) Bulk terminal facility. 3. DESCRIPTION OF THE PROJECT UNDER CONSIDERATION (Select the Category of the project): A. Resort/ Buildings/ civic amenities Not applicable as this project comprise of only pipe conveying system of cement storage facility. (i) Total area/Built-up area (in sqm.) - (ii) Height of structure - (iii) FSI ratio - (iv) Name of concerned town planning - authority/ Panchayat etc. (v) Details of provision of car parking area - B. Coastal Roads / Roads on Stilt Not applicable. (i) Area of land reclamation - (ii) Estimated quantity of muck/earth for - reclamation (iii) Traffic carrying capacity - (iv) Dimensions of road - C. Pipelines from thermal power blow down Not applicable. (i) Length of pipeline - (ii) Length traversing CRZ area - (iii) Depth of excavation -

(iv) Width of excavation -

(v) Length of pipeline from seashore to - deep sea

(vi) Depth of outfall point from surface of - sea water (vii)Temperature of effluent above ambient at disposal point D. Marine Disposal of Treated Effluent Not applicable. No Marine Disposal of Treated through pipelines Effluent through pipelines. Project comprise of only pipe conveying system of cement storage facility. (i) Location of intake/ outfall - (ii) Depth of outfall point - (iii) Length of pipeline - (iv) Length traversing CRZ area - (v) Depth of excavation - (vi) Width of excavation - (vii) Length of pipeline from shore to deep - sea/creek (viii) Depth of outfall point from surface of - water (ix) Depth of water at disposal point - (x) BOD, COD, TSS, oil and grease, heavy - metals in the effluent E. Facility for storage of goods/ chemicals (i) Name of chemical Bulk Cement Storage Terminal is out of CRZ Categories CRZ I, CRZ II, CRZ III and CRZ IV categories and only a part of existing pipe conveying system falls within the CRZ II . For transportation of material, out of total length of pipeline of 600 meters only 150 meters of the closed pipeline falls under CRZ (CRZ II) which is a permissible activity. (ii) End use of the chemical - (iii) No. of tanks for storage For storage, there are three silos of capacity 6000 tons each and one packer which are out of CRZ. (iv) Capacity of tanks There are no storage tank in CRZ area. F. Offshore structures Not applicable as no offshore structures. (i) Exploration or development - (ii) Depth of sea bed - (iii) No. of rigs - (iv) No. of platform - (v) Details of group gathering stations - G. Desalination Plant Not applicable as no desalination plant. (i) Capacity of desalination - (ii) Total brine generation - (iii) Temperature of effluent above ambient - at disposal point (iv) Ambient salinity - (v) Disposal point - H. Mining of atomic minerals Not applicable as project does not comprise of any Mining. (i) Capacity of mining - (ii) Type of mineral to be extracted - (iii) End use of the mineral - (iv) Government order for mining lease/ - exploration and approved mining plan details (v) Extent of mining lease area - I. Sewage Treatment Plants Not applicable.

(i) Capacity - (ii) Total area of construction - (iii) Compliance of effluent parameters as - laid down by CPCB/SPCB/other authorized agency (iv) Whether discharge is in sea - water/creek? If yes • Distance of marine outfall point from - shore/from the tidal river bank

• Depth of outfall point from sea water/river - water surface • Depth of seabed/riverbed at outfall point J. Lighthouse Not applicable. No lighthouse. (i) Total ground area of foundation/ platform - (ii) Height of the structure - K. Wind Mills Not applicable. No wind mills (i) Capacity (MW) - (ii) Height of the windmill - (iii) Diameter of the windmill - (iv) Length of blade - (v) Speed of rotation - (vi) Transmission lines (overhead or - underground) L. Others (i) Please specify with salient features (ii) Upload relevant Documents (upload Enclosed. PDF only) 4. PROJECT LOCATION AS PER CRZ The area falls in CRZ-II. CLASSIFICATION (If project site falls in . The project site entirely falls under New different/ multiple CRZ categories the same Mangalore Port Area. may also be elaborated) . Bulk Cement Storage Terminal is out of CRZ Categories CRZ I, CRZ II, CRZ III and CRZ IV categories and only a part of existing pipe conveying system falls within the CRZ II . . For transportation of material, out of total length of pipeline of 600 meters only 150 meters of the closed pipeline falls under CRZ (CRZ II) which is a permissible activity. . Area under CRZ Clearance is only 0.0411 ha (CRZ-II). . The project site falls within sheet no. D 43 U13/NW (Map no. KA 4) of approved CZMP Map prepared under CRZ Notification 2011. . Copy of Approved CRZ Map and Report indicating HTL, LTL demarcation enclosed. 5. CLAUSE OF CRZ NOTIFICATION UNDER As per Clause 5. Regulation of permissible WHICH PROJECT IS A PERMISSIBLE/ activities in CRZ, Para 5.2 CRZ II, Point (i) of CRZ REGULATED ACTIVITY. Notification 2019. 6. MANDATORY FIELDS FOR PROJECT ASSESSMENT A. CRZ map in 1:4000 scale indicating HTL, LTL demarcation and distance of the nearest project boundary (in meters) from Enclosed HTL to be stated (i) Upload Map (kml file) B. Project layout superimposed on CRZ Map 1:4000 scale with classification of project location including other notified Enclosed ESAs prepared (i) Upload Map (kml file) C. CRZ map 1:25000 scale covering 7 km radius around Project site Enclosed (i) Upload Map (kml file) 7. PROJECT LOCATED IN (Select Type) (i) Non eroding Coast Non Eroding Coast (ii) Low and Medium eroding coast - (iii) High eroding Coast - 8. DETAILS OF FOREST/ MANGROVES LAND INVOLVED (YES/NO) NO. There is no Forest/ Mangroves Land IF YES Involved. (i) Detail of area diverted - (ii) Forest clearance to be submitted - (Upload document) (iii) No. of trees to be cut under the project - (iv) Compensatory afforestation plan to be - submitted (Upload document) 9. DISTANCE OF PROPOSED PROJECT FROM ESA/MARINE PARK/ WILD LIFE SANCTUARY (i) Within 10 kilometre radius from the • Arabian Sea 1 km. project site (Yes/No) If YES • Permission from NBWL to be submitted - (Upload document) 10. NOC OR CONSENT TO ESTABLISH FROM STATE/ UT POLLUTION CONTROL BOARDS OBTAINED (YES/NO) If YES (i) Copy of NOC to be provided (Upload Enclosed. document) (ii) Conditions imposed to be stated (Upload Enclosed. document) 11. Environment Impact Assessment (EIA) Not applicable. The project involve only pipe studies (relevant fields to be filled) conveying system of cement storage facility. The project is not covered under EIA Notification, 2006 as amended. A. Terrestrial studies: Not applicable. (i) Summary details of EIA (Terrestrial) Studies (ii) Upload Recommendation made in EIAs (Upload document) (iii) State period of Study B. Marine Studies: . The project site entirely falls under New (i) Summary details of EIA (Marine) Studies Mangalore Port Area. . Bulk Cement Storage Terminal is out of CRZ Categories CRZ I, CRZ II, CRZ III and CRZ IV categories and only a part of existing pipe conveying system falls within the CRZ II . . For transportation of material, out of total length of pipeline of 600 meters only 150 meters of the closed pipeline falls under CRZ (CRZ II) which is a permissible activity. . No manufacturing facility is there. . Copy of Approved CRZ Map and Report indicating HTL, LTL demarcation carried out by NCSCM, Chennai enclosed. (ii) Upload Recommendation made in EIAs Copy of Approved CRZ Map and Report indicating (Upload document) HTL, LTL demarcation carried out by NCSCM, Chennai enclosed. (iii) State period of Study - 12. DISASTER MANAGEMENT PLAN/ Disaster Management Plan enclosed. NATIONAL OIL SPILL DISASTER CONTINGENCY PLAN (if applicable) 13. PROJECT INVOLVING DISCHARGE OF Not applicable. The project involves only closed LIQUID EFFLUENTS: pipe conveying system of cement storage facility. (i) Capacity of Sewage Treatment Plant - (ii) Quantity of effluent generated - (iii) Quantity of effluent treated - (iv) Method of treatment and disposal - 14. PROJECT INVOLVING DISCHARGE OF Not applicable. The project involves only closed SOLID WASTE: pipe conveying system of cement storage facility. (i) Type of solid waste - (ii) Quantity of solid waste generated - (iii) Method of disposal - (iv) Mode of transport - 15. WATER REQUIREMENT in kilo liters per Not applicable. The project involves only closed day (KLD) pipe conveying system of cement storage facility. . Bulk Cement Storage Terminal is out of CRZ Categories CRZ I, CRZ II, CRZ III and CRZ IV categories and only a part of existing pipe conveying system falls within the CRZ II . (i) Quantity of water required - (ii) Source of water - (iii) If Ground water (Upload a copy of - approval from Central Ground Water Authority or other authorised body) (iv) If other Source (Upload a copy of - permission from competent authority) (v) Mode of transport - (vi) Commitment of water supply (Upload - document) 16 DETAILS OF WATER TREATMENT AND RECYCLING (If any) (Multiple Entries Allowed) Type/ Quantity Treatment Treatment Mode of Quantity of Quantity of Source of Waste Capacity Method Disposal Discharged Treatment Water (Kilos Water Water used in Generated Litre (Kilos Recycling/Reuse (Kilos per Day) Litre per (Kilo Litre per Litre Treatment Day) Day) per Day) Method

17. DETAILS OF RAINWATER HARVESTING Not applicable. The project involves only closed pipe conveying system of cement storage facility. Bulk Cement Storage Terminal is out of CRZ Categories CRZ I, CRZ II, CRZ III and CRZ IV categories and only a part of existing pipe conveying system falls within the CRZ II . (i) No. of Storage tanks - (ii) Total capacity of tanks (iii) No. of Recharge Pits - (iv) Capacity of pits - 18. ENERGY REQUIREMENT AND SOURCES (i) Total Power Requirements (kwh) 425 kVA (ii) Source Grid Power (MESCOM) (iii) Upload Copy of Agreement (upload pdf only) (iv) Stand by Arrangement (Details) DG ( 2 X 500 kVA) 19. ENERGY EFFICIENCY/SAVING Not Applicable. MEASURES (i) Source/Mode - (ii) Details of savings - 20. RECOMMENDATION OF STATE COASTAL ZONE MANAGEMENT AUTHORITY (i) Upload Copy of CZMA recommendations Already on 16.07.2010, earlier recommendation (Upload pdf only) was issued by KSZMA and the Ministry recommended the project for CRZ Clearance in the minutes of the 102nd meeting of the EAC for CRZ, held dated 23rd -24th June, 2011. (ii) Compliance status of the Conditions - Imposed 21 WHETHER PROPOSAL ATTRACTS EIA No. Project does not attracts EIA NOTIFICATION, 2006. (Yes/No) NOTIFICATION, 2006. If YES, (i) the category thereof - (ii) Status of proposal for EC (as applicable) - 22. Social and environmental issues and None mitigations measures suggested including but not limited to R&R, water, air, hazardous wastes, ecological aspects, etc. (Brief Details to be Provided) 23. DETAILS OF COURT CASES Whether NIL there is any Court Cases pending against the project and/ or land in which the project is proposed to be set up? (Yes/No) If Yes, Pending or Disposed (Select relevant) (i) Name of the Court (Supreme Court, High - Court, National Green Tribunal) (ii) Case No. - (iii) Case Details - (iv) Orders/ Directions of the court, if any - and its relevance with the proposed project (Upload document) 24. Additional Information, If any None

UNDERTAKING: It is certified that the information given above are true to the best of my knowledge and belief and nothing contravening the provisions of CRZ Notification, 2011 and as amended in 2019 has been concealed therefore.

Name and Signature of the applicant: Kausik Bishayee Date:

Pre- Feasibility Report

CRZ Clearance for Existing Conveying System of Cement Bulk Terminal Pre- Feasibility at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka) Report M/s UltraTech Cement Limited (Unit: Manglore Bulk Terminal)

DETAILED PRE-FEASIBILITY REPORT 1.0 INTRODUCTION

M/s Ultratech Cement Ltd. (Unit: Mangalore Cement Unit) has an existing bulk terminal commissioned in 1998 at New Mangalore Port. P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka).

Mangalore Bulk Terminal is fully automated terminal and operating in the New Mangalore Port Trust at Panambur, on a lease basis. Cement is brought to the terminal in bulk through 16000 to 18,000-tonne specially designed bulk carriers from Gujarat Cement Works.

This is not a manufacturing facility and consists of only handling, storage and packaging. There are three silos of capacity 6000 Tonnes each and one packer which are out of CRZ.

All the activities of the bulk terminal are outside CRZ (1 Km away from HTL). For transportation of material, out of total length of pipeline of 600 meters only 150 m of closed pipeline falls under CRZ (CRZ II) which is a permissible activity.

Established Bulk Terminal for the first time in India at NMPT for dust free handling of cement with latest technology of pipe conveying system. The belt conveyor attains a shape of pipe by a specially designed roller frame. The terminal has three storage silos of capacity 6000 MT each for storing cement with a mechanism of pumping huge quantity of air from the bottom of the silo through aeration nozzle pipes for homogenization process.

The Environment Clearance was accorded Environmental Clearance Department of Forest, Ecology and Environment, Karnataka initially for a period of 5 years (1998- 2003) on dated 18.09.1998 and renewed for a period of another 5 years from 2003- 2008 on dated 10.11.2003 from Department of Forest, Ecology and Environment, Karnataka.

During the second renewal of Clearance, the State Government has advised to obtain required CRZ clearance from Competent Authority vide letter no. FEE42 ECO 2008 dated 04.02.2009. Accordingly, we have submitted application and the project was recommended by Karnataka State Coastal Zone Management Authority (KSCZMA) to MoEFCC, New Delhi for CRZ Clearance vide letter No. FEE 54 CRZ

Page 13 CRZ Clearance for Existing Conveying System of Cement Bulk Terminal Pre- Feasibility at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka) Report M/s UltraTech Cement Limited (Unit: Manglore Bulk Terminal)

2009 dated 16.07.2010. Subsequent to this, the application for CRZ Clearance for the same proposal was submitted earlier to MoEFCC, New Delhi on 11th February 2011 (F.No. 11-78/2010-IA-III).

Based on the documents submitted, our project was recommended by the Ministry in the Minutes of the 102nd Meeting of the EAC for Coastal Regulation Zone, held on 23rd -24th June, 2011, taking into consideration the OM dated 16.11.2010. MoEFCC taking into consideration the OM dated 16.11.2010 advised to submit Board Resolution and the same was submitted dated 15.05.2012 Subsequent to this, we have been following up with the Ministry and we have not received any communication nor clearance letter for the same. The Karnataka State Pollution Control Board has issued the consent from time to time and latest Consent issued for the project was granted on 03.11.2016 valid upto 03.09.2021. Apropos the above, for regularization of the proposal as per Gazette Notification issued by MOEFCC dated 6th March 2018, we are submitting the application for seeking CRZ Clearance along with duly filled Form I as per annexure IV of CRZ Notification 2011, approved CRZ map and supporting documents.

1.1 ABOUT THE PROJECT PROPONENT

UltraTech Cement Limited is the largest cement company in India and among the leading producers of cement globally. It is also the country’s largest manufacturer of white cement and Ready Mix Concrete. UltraTech Cement has 19 integrated plants, 1 clinkerisation unit, 25 grinding units, 7 bulk terminals, 1 white cement plant, 2 WallCare putty plants and more than 100 RMC plants – spanning India, UAE, Bahrain, Bangladesh and Sri Lanka. UltraTech Cement is also India's largest exporter of cement and clinker reaching out to meet demand in countries around the Indian Ocean, Africa, Europe and the Middle East. UTCL’s focus have always been towards initiatives that addresses environmental issues, contributes to business performance and demonstrate responsibility towards the society.

Page 14 CRZ Clearance for Existing Conveying System of Cement Bulk Terminal Pre- Feasibility at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka) Report M/s UltraTech Cement Limited (Unit: Manglore Bulk Terminal)

1.2 PROJECT ACTIVITY

Details of activity at

Name of the Project:- CRZ Clearance for Existing Conveying System of Cement Bulk Terminal at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka)

Project Details Cement Bulk Terminal of 1 MTPA. The Unit consists of only handling, storage and packing facility.

This is not a manufacturing facility and consists of only handling, storage and packaging. There are three silos of capacity 6000 Tonnes each and one packer which are out of CRZ. For transportation of material, out of total length of pipeline of 600 meters only 150 m of closed pipeline falls under CRZ (CRZ II) which is a permissible activity.

Location or site alternatives At New Mangalore Port, P.B. No. 17, Beach Road, under consideration:- Panambur, Manglore (Karnataka)

Size of the project (in terms of The project exists in Total Area of 1.67 ha. total area) :-

CRZ classification of The area falls in CRZ-II . the area Area under CRZ Clearance is only 0.0411 ha (CRZ-II).

Page 15 CRZ Clearance for Existing Conveying System of Cement Bulk Terminal Pre- Feasibility at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka) Report M/s UltraTech Cement Limited (Unit: Manglore Bulk Terminal)

1.3 PROJECT DETAILS S. No. Particular Details ABOUT THE PROJECT 1. Nature & Size of the Project CRZ –II clearance for Pipe conveying system installed for dust free transport of cement at New Mangalore Port Trust which is recognized by NMPT as state-of-art Technology for the first time in India in all major ports 2. Project Proponent M/s Ultra Tech Cement Ltd. (Unit: Manglore Bulk Terminal) LOCATION At New Mangalore Port, P.B. No. 17, Beach Road, Panambur. 3. District Mangalore State Karnataka Plant Site CRZ- II staring Sea Point Point Latitude 12°56’34.3” N 12°56’15.9” N 12°56’0.72” N 4. Longitude 74°48’8.36” E 74°48’9.36” E 74°48’9.83” E

Elevation in Meter 14.0 6.4 2.0 LAND DETAILS Total Area Area under CRZ-II clearance 1.67 ha (Existing) The area falls in CRZ-II . Area under CRZ Clearance is only 0.0411 ha (CRZ-II).

5. Land Requirement All the activities of the bulk terminal are outside CRZ (1 Km away from HTL), out of total length of pipe conveyor of 600 mtrs. Only 150 mtrs of the closed pipe conveying system from the creek falls under CRZ II. 6. Owner ship/ Occupancy Leased by NMPT (Existing Unit) ENVIRONMENTAL SETTINGS 7. Nearest National Highway/ NH-66 (as per old NH- 17) from Mumbai to Kochi at about State Highway 250 meters. 8. Distance from CRZ I 1 Km away from HTL 9. Nearest Railway Station Mangalore Central Railway Station ~9 Km (Aerial distance) 10. Nearest Town Mangalore City

Page 16 CRZ Clearance for Existing Conveying System of Cement Bulk Terminal Pre- Feasibility at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka) Report M/s UltraTech Cement Limited (Unit: Manglore Bulk Terminal)

11. Nearest Airport Mangalore IXE BAJPE Airport ~9 Km 12. Nearest Water bodies Arabian Sea 13. National Park, Wildlife Sanctuary, Biosphere reserve, Wildlife corridors, None within 10 km radius of the project site. etc.) found within the study area 14. Seismic Zone Zone III REQUIREMENTS FOR THE PROJECT 15. Water Requirement No water requirement. Existing water requirement – 2 KLPD Source: NMPT supply 16. Power Requirement 500 KVA for the functioning of the unit which is sourced from MESCOM. One D.G set of 1 MW for back up use only. No additional Power required.

Page 17 CRZ Clearance for Existing Conveying System of Cement Bulk Terminal Pre- Feasibility at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka) Report M/s UltraTech Cement Limited (Unit: Manglore Bulk Terminal)

LOCATION MAP

LOCATION MAP – EXISTING UNIT

MCF

UltraTech 600 mtr Pipe conveyor belt

Universal agro

1 km from sea HTL

CRZ MAP

1.4.1 SITE SELECTION AND INFRASTRUCTURE The site is in functional since 1998. However according to the CRZ notification, 150 meters of the conveyor belt region falls under CRZ II region for which clearance is required. The project site is very well connected with all means of transportation.

1.4.2 ALTERNATIVE SITE SELECTION No Alternative site selection. 2.0 REQUIREMENTS FOR THE PROJECT

2.1 Land Requirements No additional land requirement. The project exists on an area of 1.67 ha however the area under clearance of CRZ is 0.0411 ha.

2.2 Water Requirements Water requirement for the existing project is 2 KLPD and the source of supply would be NMPT. No additional water required.

2.3 Power Requirements The power requirement is about 500 KVA for the functioning of the unit which is sourced from MESCOM. A D.G set of 1 MW for back up use only. No additional Power required.

LAYOUT OF PLANT & PIPE CONVEYOR

Page 18 CRZ Clearance for Existing Conveying System of Cement Bulk Terminal Pre- Feasibility at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka) Report M/s UltraTech Cement Limited (Unit: Manglore Bulk Terminal)

3.0 PROCESS DESCRIPTION Mangalore Cement Unit is fully automated terminal and located in the New Mangalore port area at Panambur. Cement in bulk is brought to the terminal through 16000 to 18000- tonner specially designed bulk carriers from Gujarat Cement Works. The bulk carrier’s completely closed covers have an aerated bottom with a vertical screw conveyor system for removal of cement from the hold and a compressed air system near the berth. 1. Chartered vessel (with self-uploading and pneumatic discharge system) carries bulk cement from Gujarat to Mangalore. 2. Cement is being conveyed pneumatically from the ship to cyclone separators. 3. Cyclone separators and dust collectors provided to separate cement from the conveying air. 4. Cement is discharged on the belt conveyor for onward movement to cylindrical cement silos. 5. Negative draft is being maintained to prevent escape of dust emission to atmosphere. 6. The packing machine received cement from the silos through air slides and bucket elevator. 7. Silos are weather proof and equipped with aeration system at the bottom to extract bulk cement. Dust collectors are installed to control fugitive emissions from silos.

Page 19 CRZ Clearance for Existing Conveying System of Cement Bulk Terminal Pre- Feasibility at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka) Report M/s UltraTech Cement Limited (Unit: Manglore Bulk Terminal)

ADVANTAGES OF PIPE CONVEYOR The pipe conveyor is such a design special grade belt, which will not allow dust particle to come out and running efficiently. Compressor room are present at port end to supply dry air in JPF for purging air inside to release cement from special filter bags installed in JPF. Cement is being transported by pipe conveyor belt and not by bowser/ tanker. There are good reasons that it saves HSD – fuel, conjuction in road traffic and dust proof and operational during monsoon period. 1st of its state of art conveying system, which is functional even during monsoon because of its pipe shape. 8. At receiving end belt will open for filling at respected Silo. There we have installed dust collectors like JPF [ Jet pulse filter} on each silo and at the discharge end we have cassette filter which does not allow dust to fly in air, top of the silo is fully well equipped with latest dust collectors and covered with shed to keep dust free operation. 9. The terminal has three storage silos of capacity 6000 M.T. each for storing cement with the pumping huge quantity of air from the bottom of the silo through aeration nozzle pipes for homogenization process. This cement will be extracted for bagging. Each silo contains 16 Meters length screw conveyor with 14 manual gates. As per the

Page 20 CRZ Clearance for Existing Conveying System of Cement Bulk Terminal Pre- Feasibility at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka) Report M/s UltraTech Cement Limited (Unit: Manglore Bulk Terminal)

requirement the gates will be opened & cement flows to the bucket elevator through the 40 Meters common screw conveyor & falls on to the 20-ton capacity feed hopper through a rotary screen. 10. Cement will be received at RU12 packer for bagging through feed valve for maintaining the packer level. The designed capacity of packer output is 95 TPH. The cement will be bagged & weighs 50 KGs moves to the truck loader equipment through RBC. We have JPF- latest filter for collecting cement particles from packer area for recycling and to keep healthy working atmosphere. At truck loader area the bags will be loaded into the trucks with JPF- filtration installation for making dust free environment & dispatched to the required destination as per the requirement of Marketing. 4.0 ENVIRONMENTAL MANAGEMENT PLAN 4.1 Ambient Air Quality Management  Cement is transferred pneumatically through pipe conveyor belt system to control the dust emission.  Cement is stored in close silos.  Dense green belt within the plant area and along the roads to control the fugitive emission from vehicular movement.  Regular cleaning of roads and plant area by Vaccum cleaning machine.  Periodic monitoring of Ambient Air quality is being done.  Better maintenance and installation of proper pollution control equipment like Bag filters is help in reducing such emissions. 4.2 Noise Pollution Management  Proper maintenance, oiling and greasing of machines at regular intervals will be done to reduce generation of noise.  Personal Protective Equipments like earplugs and earmuffs are provided to the workers exposed to high noise level.  Sufficient green belt within the plant area has already been developed and maintained.  Regular monitoring of noise level is being carried out and corrective measures in concerned machinery are being adopted accordingly to the possible extent. 4.3 Water Management  No waste water is generated from the process.  Treatment of domestic waste water is done at common STP at New Mangalore Port

Page 21 CRZ Clearance for Existing Conveying System of Cement Bulk Terminal Pre- Feasibility at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka) Report M/s UltraTech Cement Limited (Unit: Manglore Bulk Terminal)

Trust. 4.4 Waste Management Used Oil (only HW) to be disposed of through CPCB/ KSPCB registered recyclers. 4.5 Green Belt Development The project proponent is committed to develop greenbelt and plantation in 33% of total project area. Green belt is being developed along the road & plant boundary will attenuate noise level, arrest dust and improve the environment in surrounding. The native plant species are selected as per CPCB guidelines in consultation with local forest department. 4.6 Consent For Operate issued by Karnataka State Pollution Control Board The Karnataka State Pollution Control Board has issued the consent from time to time and latest Consent issued for the project was granted on 03.11.2016 valid upto 03.09.2021.  We have consent for Air and water from KSPCB under orange category, Registration under Karnataka Factory act. Registered under Excise, ALC, Weights & Measures act, Explosives License for DG sets, Handling of hazardous waste material i.e. spent oil.  Every six months filling stack monitoring and ambient air analysis report to Bangalore.  Monthly, half yearly and yearly submission of stack emission of packer/ silo top and DG sets to regional office, KSPCB, Baikampady, Mangalore. 5.0 SOCIO ECONOMICS MEASURES The project proponent is committed to undertake activities for the upliftment of the social community through community development. CSR is mainstream of the Company and UTCL is delivering societal value which has given UltraTech tremendous returns, albeit of a different kind – the turnaround of human lives, lifting tens of thousands of people out of stark poverty. 6.0 REHABILTATION AND RESETTLEMENT PLAN The rehabilitation and resettlement plan is not applicable in this case. 7.0 CONCLUSION This is not a manufacturing facility and consists of only handling, storage and packaging. There are three silos of capacity 6000 Tonnes each and one packer which

Page 22 CRZ Clearance for Existing Conveying System of Cement Bulk Terminal Pre- Feasibility at New Mangalore Port, P.B. No. 17, Beach Road, Panambur, Mangalore (Karnataka) Report M/s UltraTech Cement Limited (Unit: Manglore Bulk Terminal)

are out of CRZ. For transportation of material, out of total length of pipeline of 600 meters only 150 m of closed pipeline falls under CRZ (CRZ II) which is a permissible activity. The pipe conveyor is such a design special grade belt, which will not allow dust particle to come out and running efficiently. Cement is transferred pneumatically through pipe conveyor belt system to control the dust emission. Also, UltraTech is committed and pro-active for Environment Conservation and Management. The project activity and the management has proved as economy booster for the locals for socio-economic development of the nearby people. Around 70 employees are hired on contract basis and seven are from UltraTech Cement Limited. The overall effect will improve the development of the area and support the infrastructural growth of a developing nation like India.

*******

Page 23

Annexure -1

Environment Clearance by the Department of Forest, Environment and Ecology, Government of Karnataka, 1998

Annexure -2

Environmental Clearance Second Renewal, 2009

Annexure -3

Letter by KSCZMA to MOEFCC dated 16.07.2010

Annexure -4

Letter reg. Application Submission for CRZ Clearance submitted on 8th February 2011 & File (F.No.11-78/2010- IA-III)

Annexure -5

Minutes of the 102nd Meeting of the EAC-CRZ dt. 23rd - 24th June, 2011

0LQXWHV dŚĞDŝŶƵƚĞƐŽĨƚŚĞϭϬϮŶĚDĞĞƟŶŐŽĨƚŚĞǆƉĞƌƚƉƉƌĂŝƐĂůŽŵŵŝƩĞĞĨŽƌƵŝůĚŝŶŐͬŽŶƐƚƌƵĐƟŽŶWƌŽũĞĐƚƐͬdŽǁŶƐŚŝƉĂŶĚƌĞĂĞǀĞůŽƉŵĞŶƚ WƌŽũĞĐƚƐ͕ŽĂƐƚĂůZĞŐƵůĂƟŽŶŽŶĞ͕/ŶĨƌĂƐƚƌƵĐƚƵƌĞĞǀĞůŽƉŵĞŶƚĂŶĚDŝƐĐĞůůĂŶĞŽƵƐƉƌŽũĞĐƚƐŚĞůĚŽŶϮϯƌĚͲϮϰƚŚ:ƵŶĞ͕ϮϬϭϭŝŶ&ĂǌĂůŚĂŵďĞƌ͕ ^ĐŽƉĞŽŵƉůĞǆ͕EĞǁĞůŚŝ͘ 2SHQLQJ5HPDUNVRIWKH&KDLUPDQ 7KH&KDLUPDQZHOFRPHGWKHPHPEHUVWRWKHQGPHHWLQJRIWKH($&0HPEHU6HFUHWDU\LQIRUPHGDERXWWKHDFWLRQWDNHQRQWKHGHFLVLRQVRI WKHVWPHHWLQJKHOGRQVW0D\LQ1HZ'HOKL &RQILUPDWLRQRIWKH0LQXWHVRIWKHVW0HHWLQJRIWKH($&KHOGRQVW0D\DW1HZ'HOKL DŝŶƵƚĞƐŽĨƚŚĞϭϬϭƐƚPHHWLQJKHOGRQVW0D\DW1HZ'HOKLZHUHFRQILUPHGZLWKWKHIROORZLQJDPHQGPHQWV

L ,QLWHP1RRIWKHPLQXWHVRIWKH($&PHHWLQJKHOGRQWK±WK$SULO³(QYLURQPHQWDO&OHDUDQFHIRUWKHSURMHFW L GHYHORSPHQWRI(DVWTXD\±,$ (4$ EHUWKRQVRXWKVLGHRI(4 LL GHYHORSPHQWRI(DVWTXD\± (4 E\UHSODFLQJWKHH[LVWLQJ(4 EHUWKDQGSDUWRI(4EHUWKDW9LVDNKDSDWQDP3RUWE\0V9LVDNKDSDWQDP3RUW7UXVW´7KHSURSRQHQWYLGHOHWWHUGDWHGKDV UHTXHVWHGIRUWKHIROORZLQJFRUUHFWLRQV

ŽŶĚŝƟŽŶƐƐƟƉƵůĂƚĞĚďǇ͘ ŵĞŶĚŵĞŶƚƌĞƋƵĞƐƚĞĚ

[L 3URSRQHQWVKDOOH[SORUHSURYLGLQJ 3URSRQHQWVKDOOH[SORUHSURYLGLQJVFUHZ VFUHZFRQYH\RUV\VWHPIRUWUDQVSRUWDWLRQ FRQYH\RUV\VWHPDQ\RWKHUVXLWDEOH RIFRDOIURPVKLSWREHOWFRQYH\RULQ PHFKDQLVPIRUWUDQVSRUWDWLRQRIFRDOIURP SODFHRIJUDEORDGHUDQGVKDOOVXEPLWWR VKLSWREHOWFRQYH\RULQSODFHRIJUDEORDGHU 0R()DQGWR63&%WRPLQLPL]HWKH WRPLQLPL]HWKHIXJLWLYHHPLVVLRQVDQGVKDOO IXJLWLYHGXVWHPLVVLRQVDWWKHWLPHRI VXEPLWWR0R()DQGWR63&%ZLWKLQ VKLSXQORDGLQJ PRQWKWRPLQLPL]HWKHIXJLWLYHGXVW HPLVVLRQVDWWKHWLPHRIVKLSXQORDGLQJ

[LL 7KHFRDOVWRUDJHVKDOOEHLQFORVHG 7KHFRDOVWRUDJHVKDOOEHLQHQFORVHGVKHG VKHGWRPLQLPL]HWKHIXJLWLYHHPLVVLRQV WRPLQLPL]HWKHIXJLWLYHHPLVVLRQVDQGWKH DQGWKHGUDZLQJVVKDOOEHVXEPLWWHGWR GUDZLQJVVKDOOEHVXEPLWWHGWR0R()DQGWR 0R()DQGWR63&% 63&%

7KH&RPPLWWHHUHFRPPHQGHGIRUWKHFRUUHFWLRQV

LL ,QLWHPQR³&5=FOHDUDQFHIRUWKHFRQVWUXFWLRQRI5DMNNDPDQJDODP)LVKLQJ+DUERXUDW1HHQGDNDUDL%YLOODJH$JDVWKHHVZDUDP 7DOXN.DQLDNXPDUL'LVW7DPLO1DGXE\0V5DMDNNDPDQJDOP7KXUDL)LVKLQJ+DUERXU3YW/WG>)1R,$,,,@´LQWKHFRQGLWLRQ³ 7KHQRUWKHUQVLGHEUHDNZDWHUVKDOOEHVKLIWHGDWOHDVWPGLVWDQFHWRZDUGVZHVWIURPWKHULYHUPRXWK´7KHSURSRQHQWUHTXHVWHGWKDWWKH GLVWDQFHEHUHGXFHGWRPDVSUHVHQWHGEHIRUHWKH($& 7KHFRPPLWWHHGLGQRWDJUHHWRUHGXFHWKHGLVWDQFHDQGUHFRPPHQGHGWRPDLQWDLQDGLVWDQFHRIDWOHDVWPIURPWKHULYHUPRXWK ;ŝŝŝͿ/ŶŝƚĞŵ͞ZĐůĞĂƌĂŶĐĞĨŽƌĐŽŶƐƚƌƵĐƟŽŶĂŶĚŽƉĞƌĂƟŽŶŽĨZKZK&ĞƌƌǇ^ĞƌǀŝĐĞdĞƌŵŝŶĂůƐĂƚ'ŚŽŐŚĂĂŶĚĂŚĞũ͕'ƵũĂƌĂƚďǇDͬƐ͘'ƵũĂƌĂƚ DĂƌŝƟŵĞŽĂƌĚ͕͟ƚŚĞĚƌĞĚŝŶŐƋƵĂŶƟƚǇϭFXPLQ*KRJKDDQGFXPDW'DKHMVKDOOEHUHDGDV0FXPDQG0FXPUHVSHFWLYHO\VLQFHLWZDV W\SRJUDSKLFDOHUURUV dŚĞĐŽŵŵŝƩĞĞƌĞĐŽŵŵĞŶĚĞĚĨŽƌĐŽƌƌĞĐƟŽŶƐ͘ &RQVLGHUDWLRQRI2OG3URSRVDOV ϯ͘ϭ&5=FOHDUDQFHIRUHVWDEOLVKPHQWRIFRQYH\LQJV\VWHPRIFHPHQWVWRUDJHIDFLOLW\DW1HZ0DQJDORUH3RUWE\0V8OWUD7HFK &HPHQW/WG>)1R,$,,,@ $VSUHVHQWHGE\WKHSURMHFWSURSRQHQW0V8OWUD7HFK&HPHQW/WGLVRSHUDWLQJD&HPHQW%XON7HUPLQDORI073$FDSDFLW\DORQJ ZLWKLWVKDQGOLQJDQGFRQYH\LQJV\VWHPLQ+DODQGREWDLQHGIURP1HZ0DQJDORUH3RUW7UXVWRQDOHDVHEDVLVIRUVWRULQJSDFNLQJDQG GLVSDWFKLQJFHPHQW7KHUHDUHWKUHHFHPHQWVWRULQJVLORVRIFDSDFLW\WRQHDFKZKLFKDUHRIPWUVKHLJKW(QYLURQPHQWDO&OHDUDQFHZDV REWDLQHGIURPWKH'HSDUWPHQWRI(FRORJ\ (QYLURQPHQW*RYHUQPHQWRI.DUQDWDNDLQ7KHSUHVHQWSURSRVDOLVIRUWKH&5=&OHDUDQFHRI PWUVFORVHGFRQYH\HUEHOW $VSHUWKH.DUQDWDND6WDWH&RDVWDO=RQH0DQDJHPHQW$XWKRULW\ .6&=0$ WKHVLWHIDOOVLQ&5=,,7KH'HSDUWPHQWRI(FRORJ\ (QYLURQPHQW*RYHUQPHQWRI.DUQDWDND .&=0$ UHFRPPHQGHGWKHSURMHFWWR0LQLVWU\YLGHOHWWHU1R)((&5=GDWHG dŚĞĞĂƌůŝĞƌĐŽŶƐŝĚĞƌĞĚƚŚĞƉƌŽũĞĐƚŝŶŝƚƐŵĞĞƟŶŐŚĞůĚŽŶϭϰƚŚͲϭϱƚŚ&ĞďƌƵĂƌǇ͕ϮϬϭϭĂŶĚŶŽƚĞĚƚŚĂƚƚŚĞĐŽŶǀĞǇŽƌǁĂƐĞƐƚĂďůŝƐŚĞĚƉƌŝŽƌƚŽ ƚŚĞĐůĞĂƌĂŶĐĞŽďƚĂŝŶĞĚ͖ŚĞŶĐĞŝƚĂŵŽƵŶƚƐƚŽǀŝŽůĂƟŽŶŽĨƚŚĞŶǀŝƌŽŶŵĞŶƚ;WƌŽƚĞĐƟŽŶͿĐƚ͕ϭϵϴϲ͘dŚĞŽŵŵŝƩĞĞƐƵŐŐĞƐƚĞĚƚŚĂƚƚŚĞDŝŶŝƐƚƌǇ ƐŚŽƵůĚŝŶŝƟĂƚĞĂĐƟŽŶĂŐĂŝŶƐƚǀŝŽůĂƟŽŶ͘ 'XULQJGLVFXVVLRQVLWZDVLQIRUPHGWKDW L 7KHDUHDEHORQJVWRWKH1HZ0DQJDORUH3RUW7UXVW 1037 DQGLWKDVEHHQJLYHQRQOHDVHEDVLVWRWKH8OWUDWHFK&HPHQW7KH 1037VKRXOGKDYHWDNHQWKH&5=FOHDUDQFHORQJEDFN LL SLOODUVRIWKHFRQYH\RULQ&5=,,ZHUHFRQVWUXFWHGDQGRSHUDWLRQDOVLQFH1HZ0DQJDORUH3RUW7UXVWKDVLVVXHGD12&WR 8OWUD7HFKWRREWDLQ&5=FOHDUDQFH DĞŵďĞƌ^ĞĐƌĞƚĂƌǇŝŶĨŽƌŵĞĚƚŚĂƚĂƐƉĞƌƚŚĞKDĚĂƚĞĚϭϲƚŚEŽǀĞŵďĞƌϮϬϭϬ͕ĂŌĞƌƚŚĞƌĞĐŽŵŵĞŶĚĂƟŽŶŽĨƚŚĞĨŽƌƚŚĞĐůĞĂƌĂŶĐĞĂŶĚƚŚĞ ĂƉƉƌŽǀĂůŽĨŽŵƉĞƚĞŶƚƵƚŚŽƌŝƚǇ͕ƚŚĞƉƌŽƉŽŶĞŶƚǁŝůůďĞĂĚĚƌĞƐƐĞĚƚŽƐƵďŵŝƚĂƌĞƐŽůƵƟŽŶƉĂƐƐĞĚďǇƚŚĞŽĂƌĚŽĨŝƌĞĐƚŽƌƐƚŽƚŚĞĞīĞĐƚƚŚĂƚ ƐƵĐŚǀŝŽůĂƟŽŶƐǁŝůůŶŽƚďĞƌĞƉĞĂƚĞĚ͘ 7KHFRPPLWWHHUHFRPPHQGHGWKDWDFWLRQVKRXOGEHWDNHQDJDLQVWWKHGHIDXOWHU7KH&RPPLWWHHDOVRIXUWKHUUHFRPPHQGHGIRUWKH&5= FOHDUDQFHDQGVXJJHVWHGWRSURFHHGDVSHU20GDWHGDJDLQVWWKHYLRODWLRQ ϯ͘ϮZĂŶĚĨŽƌƚŚĞĐŽŶƐƚƌƵĐƟŽŶŽĨƌĞƐŝĚĞŶƟĂůďƵŝůĚŝŶŐ͚ŽĐŚŝŶZĞƐŝĚĞŶƟĂůĞǀĞůŽƉŵĞŶƚWƌŽũĞĐƚ͛Ăƚ^Ǉ͘EŽ͘ϴϰϯŽĨƌŶĂŬƵůĂŵsŝůůĂŐĞ <ĞƌĂůĂďǇDͬƐdZ/&<ŽĐŚŝWƌŽũĞĐƚƐ>ƚĚ΀&͘EŽ͘ϭϭͲϭϭͬϮϬϭϭͲ/Ͳ///΁͘

$VSUHVHQWHGE\WKHSURMHFWSURSRQHQWWKHSURMHFWLQYROYHVFRQVWUXFWLRQRIUHVLGHQWLDOSURMHFWRQDSORWDUHDRI+D7KHWRWDO EXLOWXSDUHDSURSRVHGLV6TP,WLVSURSRVHGWRFRQVWUXFWGZHOOLQJXQLWV %5 1RV%5 1RVDQG %5 1RV ZLWKFOXEIDFLOLW\LQWRZHUV 3RGLXP*URXQG)ORRUV 7KHWRWDOZDWHUUHTXLUHPHQWLV./' IUHVKZDWHUUHTXLUHPHQWLV./' 7KHFDSDFLW\RI673SURSRVHGLV./'7UHDWHGZDVWHZDWHUWREHXVHGIRUIOXVKLQJRI WRLOHWV./' KRUWLFXOWXUH./'7RWDOVROLGZDVWHJHQHUDWLRQZLOOEH.JGD\7KHSRZHUUHTXLUHPHQWLV09$ 7KHWRWDOSDUNLQJVSDFHVSURSRVHGDUHIRUFDUVWZRZKHHOHUV7RWDOFRVWRIWKHSURMHFWLV5V&URUHV 7KHSURMHFWLVIDOOLQJLQ&5=,,DQGWKH.HUDOD&RDVWDO=RQH0DQDJHPHQW$XWKRULW\FRQVLGHUHGLQLWVVWDQGQGPHHWLQJVDQG UHFRPPHQGHGWKHSURMHFWWR0R()IRU&5=FOHDUDQFH dŚĞƉƌŽƉŽƐĂůǁĂƐĐŽŶƐŝĚĞƌĞĚďǇƚŚĞŝŶŝƚƐϭϬϬƚŚŵĞĞƟŶŐŚĞůĚŽŶϭϭƚŚʹϭϮƚŚDĂǇ͕ϮϬϭϭĂŶĚƐŽƵŐŚƚĂĚĚŝƟŽŶĂůŝŶĨŽƌŵĂƟŽŶ͘dŚĞĚĞƚĂŝůƐ ƐƵďŵŝƩĞĚĂŶĚƉƌĞƐĞŶƚĞĚďǇƚŚĞƉƌŽƉŽŶĞŶƚǁĞƌĞĞǆĂŵŝŶĞĚďǇƚŚĞŽŵŵŝƩĞĞ͘ 'XULQJWKHGLVFXVVLRQWKHIROORZLQJSRLQWVHPHUJHG L 7KH&RPPLWWHHQRWHGWKDWSURSRQHQWDSSOLHGIRUWKH12&IURP0LQLVWU\RI'HIHQFH ,QGLDQ1DY\ DVSHUWKHREVHUYDWLRQRI($&VLQFH WKHSURMHFWLVORFDWHGZLWKLQNP .P IURPWKH1DYDOHVWDEOLVKPHQWDQG\HWWRUHFHLYH7KH&RPPLWWHHVXJJHVWHGWKHSURSRQHQWWRVXEPLW DFRS\RIWKH12& LL 6XEPLWWKHFRUUHFWFRQWRXU3ODQDVWKHFRQWRXUSODQVXEPLWWHGDSSHDUVWREHZURQJ LLL &RQVLGHULQJWKHODQGHOHYDWLRQRIWKHDUHDVWRUPZDWHUFKDQQHOVWRWKHEDFNZDWHUVDVRSHQLQJVDQGKHLJKWRIWKHURDGDORQJWKHEDQNRIWKH EDFNZDWHUWKHDUHDDQGWKHSURSRVHGVWUXFWXUHLVYXOQHUDEOHWRWVXQDPLDQGVHDZDWHUULVHGXHWRFOLPDWHFKDQJHLQORQJWHUPSHUVSHFWLYH ([LVWHQFHRIIDXOWOLQHLQWKH$UDELDQ6HDLVJRRGHQRXJKUHDVRQIRUSRVVLEOHWVXQDPLLQWKHDUHD5DLVLQJRIWKHURDGKHLJKWDQGFRQVWUXFWLRQRI JDWHVDWWKHFKDQQHORSHQLQJVVKDOOEHFRQVLGHUHGWRDYRLGWKHDERYHVLWXDWLRQ LY $VWKHWRWDOKHLJKWRIWKHEXLOGLQJLVDERYHPWKHSURSRQHQWDJUHHGWRUHYLVHWKHSODQV6XEPLWDUHYLVHGSODQLQDFFRUGDQFHZLWKWKHILUH ILJKWLQJIDFLOLWLHVDYDLODEOH7KHWRWDOKHLJKWVKDOOQRWEHPRUHWKDQP Y 6XEPLWUHYLVHGSDUNLQJDQGFLUFXODWLRQSODQV /ŶǀŝĞǁŽĨƚŚĞĨŽƌĞŐŽŝŶŐŽďƐĞƌǀĂƟŽŶƐ͕ƚŚĞĐŽŵŵŝƩĞĞĚĞĨĞƌƌĞĚƚŚĞƉƌŽƉŽƐĂůĂŶĚƐŚĂůůďĞƌĞĐŽŶƐŝĚĞƌĞĚĂŌĞƌƚŚĞĂďŽǀĞŽďƐĞƌǀĂƟŽŶƐĂƌĞ ĂĚĚƌĞƐƐĞĚĂŶĚƐƵďŵŝƩĞĚ͘ (QYLURQPHQWDODQG&5=&OHDUDQFHIRUWKH0HJDFRQWDLQHUWHUPLQDODW&KHQQDL3RUWE\0V&KHQQDL3RUW7UXVW>)1R ,$,,,@ 6KUL%KDUDW%KXVKDQ0HPEHU6HFUHWDU\ 6XSSRUWLQJ6WDII 6KUL(7KLUXQDYXNNDUDVX'\'LUHFWRU0R() 'U396XEED5DR5HVHDUFK2IILFHU 3URMHFW$XWKRULWLHV ZĞƉƌĞƐĞŶƚĂƟǀĞƐĨƌŽŵDͬƐ͘8OWUD7HFK&HPHQW/WG ZĞƉƌĞƐĞŶƚĂƟǀĞƐĨƌŽŵDͬƐ͘75,).RFKL3URMHFWV/WG ZĞƉƌĞƐĞŶƚĂƟǀĞƐĨƌŽŵDͬƐ͘&KHQQDL3RUW7UXVW ZĞƉƌĞƐĞŶƚĂƟǀĞƐĨƌŽŵDͬƐ͘d/&DQG$05/,QWHUQDWLRQDO7HFK&LW\/WG ZĞƉƌĞƐĞŶƚĂƟǀĞƐĨƌŽŵDͬƐ͘^ƵďĂƌŶĂƌĞŬŚĂWŽƌƚWǀƚ>ƚĚ͘ ZĞƉƌĞƐĞŶƚĂƟǀĞƐĨƌŽŵDͬƐ͘DĞŐŚĂůĂǇĂhƌďĂŶĞǀĞůŽƉŵĞŶƚƵƚŚŽƌŝƚǇ͘ ZĞƉƌĞƐĞŶƚĂƟǀĞƐĨƌŽŵDͬƐ͘ĂĚĚŝ/ŶĨƌĂƐƚƌƵĐƚƵƌĞ ZĞƉƌĞƐĞŶƚĂƟǀĞƐĨƌŽŵDͬƐ͘ZĞůŽŐŝƐƟĐƐ/ŶĨƌĂƐƚƌƵĐƚƵƌĞ>ƚĚ͘ ZĞƉƌĞƐĞŶƚĂƟǀĞƐĨƌŽŵDͬƐ͘^ĂƐŵŝƌĂ ZĞƉƌĞƐĞŶƚĂƟǀĞƐĨƌŽŵDͬƐ͘:ŝŶĚĂů^ƚĞĞůΘƉŽǁĞƌ>ƚĚ͘ ZĞƉƌĞƐĞŶƚĂƟǀĞƐĨƌŽŵDͬƐ͘E,/ ZĞƉƌĞƐĞŶƚĂƟǀĞƐĨƌŽŵDͬƐ͘6LUND]KL3RUW3ULYDWH/LPLWHG ZĞƉƌĞƐĞŶƚĂƟǀĞƐĨƌŽŵDͬƐ͘*XMDUDW+\GURFDUERQVDQG3RZHU6(=/WG ZĞƉƌĞƐĞŶƚĂƟǀĞƐĨƌŽŵDͬƐ͘*XZDKDWL0HWURSROLWDQ'HY$XWKRULW\ ZĞƉƌĞƐĞŶƚĂƟǀĞƐĨƌŽŵDͬƐ͘/DUVHQ 7RXEUR/WG ZĞƉƌĞƐĞŶƚĂƟǀĞƐĨƌŽŵDͬƐ͘$UP\:HOIDUH+RXVLQJ2UJDQLVDWLRQ ZĞƉƌĞƐĞŶƚĂƟǀĞƐĨƌŽŵDͬƐ͘6.5(%XLOGLQJ)XWXUH3YW/WG ZĞƉƌĞƐĞŶƚĂƟǀĞƐĨƌŽŵDͬƐ͘%UDKPDSXWUD,QIUDVWUXFWXUH/WG ZĞƉƌĞƐĞŶƚĂƟǀĞƐĨƌŽŵDͬƐ͘5HOLDQFH+DU\DQD6(=/WG ZĞƉƌĞƐĞŶƚĂƟǀĞƐĨƌŽŵDͬƐ͘3DQDVRQLF,QGLD/WG ZĞƉƌĞƐĞŶƚĂƟǀĞƐĨƌŽŵDͬƐ͘'0(GXFDWLRQDQG5HVHDUFK)RXQGDWLRQ

Annexure -6

Receipt of Letter for board Resolution submission dt. 22.05.2012

Annexure -7

Letters submitted to MOEFCC for CRZ clearance

Annexure -8

Consent issued by Karnataka SPCB on 03.11.2016

Consent For Operation Karnataka State Pollution Control Board Zonal Office : Mangalore, (CFO-Air,Water) Plot No.10B, Parisara Bhavana, Baikampady Industrial Area,Mangalore-575011 Tele : 0824-2408420 Industry Colour: Industry Scale: LARGE ORANGE

(This document contains 6 pages including annexure) Combined Consent Order No: AW-301316 PCB ID: 11334 Date: 03/11/2016 Combined consent for discharge of effluents under the Water (Prevention and Control of Pollution) Act , 1974 and emission under Air (Prevention and Control of Pollution)Act , 1981

Ref: 1. Application filed by the industry / organization on 20/10/2016 2.Inspection of the Industry/organization/by RO, - Mangalore on 20/10/2016

Consent is hereby granted under Section 25(4) of the Water (Prevention & Control of Pollution) Act, 1974 ( herein referred to as the Water Act) & Section 21 of Air (Prevention & Control of Pollution) Act, 1981, ( herein referred to as the Air Act) and the Rules and Orders made there under and subject to the terms and conditions as detailed in the Schedule Annexed to this order. The Occupier is authorized to operate /carryout industry/activity & to make discharge of the effluents & emissions confirming to the stipulated standards from the premises mentioned below: Location:

Name of the Industry: Ultra Tech Cement Limited Address: -, NMPT Land, Mangalore Cement Unit Industrial Area: Not In I.A, Mangalore , Taluk: Mangalore, District: Dakshina Kannada Discharge of effluents under the Water Act: Sr Water Code WC(KLD) WWG(KLD) Remark 1 Domestic Purpose 2.000 1.600 Discharge to Septic tank/Soak pit Discharge of Air emissions under the Air Act from the following stacks etc. Sl. No. Description of chimney/outlet Limits specified refer schedule The details of Sources, control equipments and its specification, type of fuel, rate of emissions, constituents to be controlled in emissions etc. are detailed in Annexure-I.

The consent for operation is granted considering the following activities/Products; Sr Product Name Applied Qty/Month Unit 1 Cement Storage, Homogenization & Bagging Plant 25000.0000 TON This consent is valid for the period from 20/10/2016 to 30/09/2021

For and on behalf of the Karnataka State Pollution Control Board

Page-1 e_outwardno2841--03/11/2016 e-signed(physical Printed from SENIOR ENVIRONMENTAL OFFICER signature not require XGN Consent For Operation Karnataka State Pollution Control Board Zonal Office : Mangalore, (CFO-Air,Water) Plot No.10B, Parisara Bhavana, Baikampady Industrial Area,Mangalore-575011 Tele : 0824-2408420 Industry Colour: Industry Scale: LARGE ORANGE

(This document contains 6 pages including annexure)

Shri Rajashekar Puranik-Senior Environmental Officer To, Ultra Tech Cement Limited Beach Road Mangalore

NOTE: The following Conditions A(2b, 3a & 3b) mentioned above are not applicable.

COPY TO:

1. The Regional Officer, Mangalore for information and necessary action. 2. Master Register. 3. Case file.

1. Consent Fee paid : Rs. 400000

SCHEDULE

TERMS AND CONDITIONS

A. TREATMENT AND DISPOSAL OF EFFLUENTS UNDER THE WATER ACT. 1. The discharge from the premises of the occupier shall pass through the terminal manhole/manholes where from the Board shall be free to collect samples in accordance with the provisions of the Act/Rules made there under.

2(a). The sewage/domestic effluent shall be treated in septic tank and with soak pit. No overflow from the soak pit is allowed. The septic tank and soak pit shall be as per IS 2470 Part-I & Part-II.

2(b).The treated sewage effluent discharged shall conform to the standards specified in Annexure-I.

3(a). The trade effluent generated in the industry shall be treated in the ETP and treated effluent shall confirm to the standards stipulated by the Board in Annexure-1

3(b).The trade effluent shall be handed over to CETP and maintain logbook of effluent generated & sent every day.

Page-2 e_outwardno2841--03/11/2016 e-signed(physical Printed from SENIOR ENVIRONMENTAL OFFICER signature not require XGN Consent For Operation Karnataka State Pollution Control Board Zonal Office : Mangalore, (CFO-Air,Water) Plot No.10B, Parisara Bhavana, Baikampady Industrial Area,Mangalore-575011 Tele : 0824-2408420 Industry Colour: Industry Scale: LARGE ORANGE

(This document contains 6 pages including annexure) 4. The occupier shall install flow measuring/recording devices to record the discharge quantity and maintain the record.

5. The occupier shall not change or alter either the quality or the quantity or the place of discharge or temperature or the point of discharge without the previous consent/ permission of the Board.

6. The Occupier shall not allow the discharge from the other premises to mix with the discharge from his premises. Storm water shall not be allowed to mix with the effluents on the upstream of the terminal manhole where the flow measuring devices are installed.

B. EMISSIONS:

1. The discharge of emissions from the premises of the applicant shall pass through the air pollution control equipment and discharged through stacks/chimneys mentioned in Annexure-II where from the Board shall be free to collect the samples at any time in accordance with the provisions of the Act and Rules made there under.

2. The occupier shall provide port holes for sampling of emission, access platforms for carrying out stack sampling, electrical points and all other necessary arrangements including ladder as indicated in Annexure-II.

3. The Occupier shall upgrade/modify/replace the control equipment with prior permission of the Board. C. WATER CESS:

1. The Occupier shall provide water meter at all the intake points as specified under Section (5) of the Water Cess Act, 1977 and shall file the Water Cess returns regularly before fifth of every month and also pay the Cess assessed with the time stipulated. D.MONITORING & REPORTING:

1. The occupier shall get the samples of effluents & emissions collected and get them analyzed once a month/ Indicated in Annexure for the parameters.

E. SOLID WASTE (OTHER THAN HAZARDOUS WASTE) DISPOSAL:

1. The Occupier shall segregate solid waste from Hazardous Waste, Municipal Solid Waste and store it properly till treatment/disposal without causing pollution to the surrounding Environment.

2. The solid waste generated shall be handled & disposed by scientific method without causing eye sore to the general public and to the surrounding environment.

F. NOISE POLLUTION CONTROL:

1. The industry shall ensure that the ambient noise levels within its premises shall not exceed the limits i.e 75 dB(A) Leq during day time and 70 dB(A) Leq during night time as specified in the Environment (Protection) Rules.

Page-3 e_outwardno2841--03/11/2016 e-signed(physical Printed from SENIOR ENVIRONMENTAL OFFICER signature not require XGN Consent For Operation Karnataka State Pollution Control Board Zonal Office : Mangalore, (CFO-Air,Water) Plot No.10B, Parisara Bhavana, Baikampady Industrial Area,Mangalore-575011 Tele : 0824-2408420 Industry Colour: Industry Scale: LARGE ORANGE

(This document contains 6 pages including annexure) G. GENERAL CONDITIONS:

1. The Board reserves the right to review, impose additional conditions, revoke, change or alter terms and conditions of this consent.

2. The Occupier shall forthwith keep the Board informed of any accidental discharge of emissions/effluents into the atmosphere in excess of the standards laid down by the Board. The applicant shall also take corrective steps to mitigate the impact.

3. The Occupier shall provide alternative power supply sufficient to operate all Pollution control equipments.

4. The entire premises shall always be kept clean. The effluent holding area, inspection chambers, outlets, flow measuring points should made easily approachable.

5. The Occupier shall display the consent granted in a prominent place for perusal of the inspecting officers of the Board.

6. The Occupier his heirs, legal representatives or assigns shall have no claims what so ever to the continuation or renewal of this consent after expiry of the validity of consent.

7. The Occupier shall make an application for consent at least 45 days before expiry of this consent.

8. The occupier shall maintain register recording the ambient air quality and stack monitoring. The register shall be open for inspection by the Board Officers at all time.

For and on behalf of the Karnataka State Pollution Control Board

Shri Rajashekar Puranik - Senior Environment Officer

Note: All efforts should be made to remove colour and unpleasant odour as far as practicable.

Page-4 e_outwardno2841--03/11/2016 e-signed(physical Printed from SENIOR ENVIRONMENTAL OFFICER signature not require XGN Consent For Operation Karnataka State Pollution Control Board Zonal Office : Mangalore, (CFO-Air,Water) Plot No.10B, Parisara Bhavana, Baikampady Industrial Area,Mangalore-575011 Tele : 0824-2408420 Industry Colour: Industry Scale: LARGE ORANGE

(This document contains 6 pages including annexure) Annexure-II Chim. Chimney KVA Minimum Constituents to be controlled in Tolerance Air pollution Date on which air No. attached to Rating/ chimney the emission limits Control pollution control Capacity height to mg/NM3 equipment to equipments shall be be installed,in be provided to provided addition to achieve the above chimney height stipulated ground as per col.(4) tolerance limits level and chimney (in Mtr) heights conforming to stipulated heights.

1 Any Other Packing 16 PM(mg/NM3),SO2(PPM),NOx 150,0,0 FIL,DUS --- ..... Plant (PPM) 2 Any Other Bucket 40 PM(mg/NM3),SO2(PPM),NOx 150,0,0 FIL --- ..... Elevator (PPM) 3 Any Other Ship 9 PM(mg/NM3),SO2(PPM),NOx 150,0,0 FIL --- ..... loading (PPM) 4 Any Other Silo-II 35 PM(mg/NM3),SO2(PPM),NOx 150,0,0 DUS --- ..... (PPM) 5 Any Other Silo-III 35 PM(mg/NM3),SO2(PPM),NOx 150,0,0 DUS --- ..... (PPM) 6 Any Other Silo-I 35 PM(mg/NM3),SO2(PPM),NOx 150,0,0 DUS --- ..... (PPM) 7 D.G. Sets 500KVA 7 PM(mg/NM3),SO2(PPM),NOx 150,0,0 AEC --- (PPM) 8 D.G. Sets 500KVA 7 PM(mg/NM3),SO2(PPM),NOx 150,0,0 AEC --- (PPM) Note: FIL,DUS : Bag Filter FIL : Bag Filter DUS : Dust Collector AEC : Accoustic Enclosures

Page-5 e_outwardno2841--03/11/2016 e-signed(physical Printed from SENIOR ENVIRONMENTAL OFFICER signature not require XGN Consent For Operation Karnataka State Pollution Control Board Zonal Office : Mangalore, (CFO-Air,Water) Plot No.10B, Parisara Bhavana, Baikampady Industrial Area,Mangalore-575011 Tele : 0824-2408420 Industry Colour: Industry Scale: LARGE ORANGE

(This document contains 6 pages including annexure) Note: 1. The Noise levels within the premises shall not exceed 75 dB (A) leq during day time and 70 dB(A) leq during night time respectively.

2. The DG set shall be provided with acoustic measures as per SI.No.94 in Schedule-I of Environment (Protection)Rules.

3. There shall be no smell or odour nuisance from the industry.

LOCATION OF SAMPLING PORTHOLES, THE PLATFORMS, THE ELECTRICAL OUTLET.

1. Location of Portholes and approach platform:

Portholes shall be provided for all chimneys, stacks and other sources of emission. These shall serve as the sampling points. The sampling point should be located at a distance equal to atleast eight times the stack or duct diameters downstream and two diameters upstream from source of low disturbance such as a Bend, Expansion, Construction Valve, Fitting or Visible Flame for rectangular stacks, the equivalent diameter can be calculated from the following equation.

2 (Length x Width) Equivalent Diameter = ------(Length + Width)

2. The diameter of the sampling port should not be less than 3”. Arrangements should be made so that the porthole is closed firmly during the period when it is not used for sampling.

3. An easily accessible platform to accommodate 3 to 4 persons to conveniently monitor the stack emission from the portholes shall be provided. Arrangements for an Electric Outlet Point off 230 V 15 A with suitable switch control and 3 Pin Point shall be provided at the Porthole location.

Page-6 e_outwardno2841--03/11/2016 e-signed(physical Printed from SENIOR ENVIRONMENTAL OFFICER signature not require XGN

Annexure -9

Approved CRZ map

Annexure -9 ANNEXURE-10 CRZ REPORT OF NCSCM

ANNEXURE 11 APPROVED MAP AND REPORT FROM NCSCM, CHENNAI

Annexure-12 RISK ASSESMENT REPORT AND DISASTER MANAGEMENT PLAN

Disaster Management Plan

Ultratech Cement Limited Mangalore Cement Unit, Beach Road, Panambur, Mangalore – 575 010

Disaster Plan

MANGALORE CEMENT UNIT Disaster Plan MANGALORE Quality Management System Rev.No-0.0

In Conformance with ISO 9001(2015) Date: 02.04.2018

2/25

Disaster Plan

Established by: ------Safety I/C Reviewed & Approved by: ------Plant Head

Change Record

Rev Date Responsible Person Description of Change 01 02

09 10

3/25

Disaster Plan Index

Topic

1. Introduction

2. Emergency Organization

3. Risk Identification & Response

4. Emergency Preparedness

5. Communication

6. Emergency Equipment

7. Return to Normalcy

8. Training

9. Mock Drills

10. Emergency Telephone Numbers

11. Site Plan

4/25

Disaster Plan

Introduction

Disaster or Emergency may be defined as sudden occurrence of such magnitude that it disrupts normal activities and has the potential to cause injury, loss of life, damage to buildings and property or disruption and loss of day to day business.

The evidence shows that the extent of a disaster’s impact depends heavily on the immediate emergency response at the site or the speed of recovery of business and restart of the operations. We may not be able to prevent all disasters but we may be able to mitigate or reduce the effects of a disaster.

Hazard is defined as any situation, which has the potential for causing injury to life and health or damage to equipment, property and / or environment. The situation may also have the potential to disrupt the normal business operations.

Risk is the combination of probability of a hazard occurring and the severity of the impact. The impact could be on the People, Material, and Equipment, Environment or the functioning of the business.

The overall goal of this Disaster Management Plan is to identify hazards and risks in the industry, and prevent loss of life, and property, and to ensure environmental safety. The plan also seeks to limit the damage to the organisation’s business, assets and reputation. It also defines ways to restart the business to prevent loss of Market.

Breach of Security shall be treated as an emergency and shall be handled as per the Disaster Plan.

This Disaster Management Plan is established to achieve the above goal by: 1. Increasing Knowledge and Awareness a. Trainings in Safety b. Trainings in First Aid c. Trainings in Fire Drills & Co-Coordinated Response

5/25

Disaster Plan

2. Build coordinated emergency response Strategy by: a. Identifying risks in different areas - Risk Register b. Providing information on different emergency situations - Displays c. Developing response capabilities for identified hazards and risks d. Developing systems for backups of Data and restarting the IT systems – Backups and alternate systems e. Training personnel in coordinated response – Mock Drills & Fire Drills f. Providing emergency response equipment g. Defining responsibilities h. Defining Authorities

6/25

Disaster Plan Emergency Organisation

The Disaster Management Team shall consist of the following personnel.

Site Controller / Incidence Controller

HOD_MCU

Alternate Site Controller / Incidence Controller

Engineer - E&I

Duties

1. Go to the site and take overall command.

2. Continually review the course of the incident and determine best counter measures.

3. Take operations control of work outside the immediate incident area.

4. Liaise with Emergency Services and Regulatory Authorities.

5. Maintain Incident Log.

6. Manage communications.

7. Manage contact with press & media.

8. Preserve evidence wherever possible to help investigation.

9. Control rehabilitation of the affected area.

10. Handle breach of security situation.

11. Co-Ordinate with Security and Police personnel.

7/25

Disaster Plan

Evacuation (Floor) In charge

Mech. Officer and Contract Supervisor-1

Alternate Floor Incharge

Sr. Supervisor- Mech., Dept.

Duties

1. Assess incidence and decide on the scale of response

2. Direct all the operations at the scene of the incident

3. Call emergency services

4. Ensure key personnel are summoned

5. Isolate the area as required

6. Know the exit plan & guide people

7. Ensure all persons are safe and evacuate in time. Ensure no one is left behind.

8. Handle Breach of security situation till Site Controller arrives

Fire Fighting In charge

Engineer E&I

Alternate Fire Fighting In Charge

QC Officer

Duties

1. Take charge of the fire fighting team at the assembly point

2. Start fire fighting as required

3. Guide team members

4. Call outside fire brigade help as required

5. Keep track of the fire fighters

6. Put out the fire or contain the escalation of the fire

8/25

Disaster Plan

First Aid In charge

HR & Admin Officer

Alternate First Aid in Charge

Security Head Guard

Duties

1. Take charge of the First aid team at assembly point

2. Remove the injured from the scene of incident to safer place

3. Administer first aid where possible till help arrives

4. Call for Ambulance and Doctors as required

5. Inform Hospitals and other emergency medical facilities

6. Transfer the injured to nearest medical facility as soon as possible

Security Officers & Guards

Senior Guard

Alternate

Security Guard

Duties

1. Cordon off the incident area as per the plan

2. Take a head count to ensure every one is out of the incident area

3. Inform the incident controller of any missing persons

4. Open the gates in case evacuation is required as with fire, earthquake

5. Close the gates if required during social disturbances

6. Handle the Security breach as per the instructions from Head of the Department or Site Controller

7. Hold the employees in their departments till the breach situation is resolved.

9/25

Disaster Plan 8. Contact Police after discussion with the Site Controller

9. Manage the emergency response equipment

Payroll records In Charge

Dept. Manager A/C

Alternate Systems in Charge

Purchasing Officer

Duties

1. Recovery of HR data and payroll records etc.

2. A/C records.

3. Vander information.

Information System In Charge

Engineer E&I.

Alternate Systems in Charge

Sr. Supervisor- Mech., Dept.

Duties

1. Maintain a system of backups of data – On site and offsite

2. Identify alternate arrangements that can be made in case of system outage

3. Backup plan for restarting e-mails and website

4. Recovery of the lost data

10/25

Disaster Plan

Communications In Charge

HR & Admin Officer

Alternate Communications in Charge

Sr. Supervisor- E&I Dept.

Duties

1. Maintain some sort of communication lines during a disaster

2. Identify alternate ways of communications

3. Restart he communication lines ASAP

4. Plan for alternate communication systems in case of power outages

Transport In charge

HR & Admin Officer

Alternate Transport in Charge

Contract Supervisor-1

Duties

1. Arrange for transportation in case of evacuation

2. Identify the options in case the public transport system fails

Administration In charge

HR & Admin Officer

Alternate Administration in Charge

Sr. Supervisor- E&I Dept.

Duties

1. Plan for backup copies of Insurance documents

2. Have backup of other relevant documents to restart the operations after disaster

3. Identify local utilities where help can be received from 11/25

Disaster Plan 4. Arrange to inform the families of employees

5. Plan emergency supplies in case the employees are stranded in the plant

6. Arrange for payment to employees in case of disaster

All Employees

Duties of all employees when the emergency alarm / siren sound

7. Stop all running equipment safely

8. Switch off power of your equipment before leaving

9. Calmly move out to assembly point

10. Pick up any safety equipments like fire extinguishers on the way

11. Check along the way if there are any people incapacitated in rooms

12. Help visitors in your vicinity to evacuate

13. Assemble at assembly point to facilitate head count

14. In case of Security Breach, please stay at your work place.

15. Await instructions

12/25

Disaster Plan Risk Identification & Response

1 Industry Related Events Situation Hazards Response Acid Spillage Air Pollution due to acid fumes Neutralize the acid and clean the area Fire due to corrosion & reaction Remove other chemicals around it to prevent unwanted reactions Evacuate people from the area to prevent injuries Inform Fire Brigade Chemical / Oil Toxic Acid smoke due to fire Use Masks and breathing Fire apparatus to fight fire Evacuate people from the area and gather at assemble point Inform Emergency services of the nature of chemicals stored Contact with Acid Burns Wash the contact area with plenty Acid or Acid of water to remove the corrosive fumes substance Treat the burns & immediately get medical help If large area of body is burnt, prevent shock by covering in blanket Transfer victim to hospital where required Gas Cylinder Injury due to explosion Treat the injured & isolate the Explosion area Property damage due to Assess the damage and decide explosion on evacuation Flammable Fire due to gas explosion Start fire fighting with CO2 Gas Cylinder extinguishers and call for fire Explosion brigade Use Helmet, Face & Body Protection to fight fire Evacuate all personnel and assemble at assembly point Treat burns by cooling them with lot of cool water Do not apply oil or greasy ointment Give water to burn victim to prevent dehydration HSD Fire / Smoke & Toxic fumes due to fire Fight the fire to put it out early Lube oil Fire with mechanical foam or DCP extinguishers Escalation of fire Remove all combustible material

13/25

Disaster Plan from surrounding area to starve the fire Electrical Fire Toxic smoke due to insulation Evacuate the area and assemble burning at assembly point Possibility of shock and injury due Shut the power to current Possibility of equipment damage due to power surge Injury / Heart Death or aggravated injury Bring to ground from Height with Attack at the help of stretcher height CPR and then bring to ground after resuscitation Fall from Injury or death Immobilize the injured Height Transfer to Hospital

2 Social Events Situation Risks Response Riots Injury or death of persons Close and secure the premises and inform police Stone throwing and mob attack Inform police Movement restrictions Inform homes of personnel & provide food and water Bomb Threat Injury or death of personnel Inform police and bomb squad. Isolate the area Panic Inform the situation to all personnel Damage to property Take precautionary measures in case there is a fire Injury or Panic Evacuate the area if required Strike Damage to property Cordon off the area Inform Police and Labour Department Injury to people Treat and evacuate the people Cordon off the affected area

14/25

Disaster Plan

3 Accidents Situation Risks Response Chemical Permanent damage to body part Wash the burn area with cool Burns Infection and complication water Cover the area with clean sterilized gauze Shift to hospital Scalds Infection and damage to body Pour Cool Water to cool the burn Cover the scald with clean sterilized dressing Do not rupture the blisters Get medical help Burns due to Permanent Injury / disability Cool the part under running water hot metal till burning sensation subsides Cover the parts with a clean burn dressing Shock Cover and keep warm Loss of fluids Keep giving fluids Move to hospital immediately Cuts Excessive Bleeding Stop bleeding Infection Cover with antiseptic dressing & clean gauze Shock Keep warm & rush to hospital Fracture Permanent damage and disability Immobilize the joint. With splint if necessary Shock due to pain Keep warm and covered Move to medical facility as soon as possible Electric Shock and death Keep warm and covered Shock Breathing / Heart stops Administer CPR if breathing stopped Move person immediately for medical help or call ambulance Fall Spinal injury Do not move more than essential Immobilize the body with splints if spinal injury suspected Move to hospital immediately Danger from Pain, Injury and Death Move to hospital immediately snake bite

15/25

Disaster Plan

4 Naturally Occurring Events Situation Risks Response Earthquake Building collapse Declare emergency and start evacuation Take head count to ensure everyone is safely out Arrange for shelter, food and water for people Injury due to stampede Administer first aid and get medical help Entrapment in collapsed building Call emergency services for rescue Move debris to reach trapped persons where possible Inform the next of kin Cyclone Lightning strike Treat injured. Administer CPR where required. Move injured to hospital Structural collapse Remove injured from the site of damage Injury due to falling debris and Get help to remove trapped entrapment under the rubble persons Arrange transport for people to go home Heavy rain and flooding. High Evacuate people to their homes in winds. Injury due to flying debris. case of cyclone warning. In case the evacuation is not possible, take shelter in lunch room behind the silos where there is some protection from wind. Thunder Flooding Provide food and water to Storms stranded persons Provide transport where possible Evacuate the people and let them go home Lightning strike Fight fire Call emergency services Heavy Rains Flooding Allow people to go home Provide food and shelter if evacuation is not possible Tsunami Damage to plant and severe Evacuate the people if there is injury to people time Take head count and provide food and shelter where possible Establish communication channels through satellite link

16/25

Disaster Plan

5 Security Breach

Situation Risks Response Break In Loss of Property Inform Police Inform Senior Management Inform Insurance surveyor Pilferage Loss of Property Inform Senior Management Inform Police as required Stop movements in & out of Factory Hold all employees at their work place till frisking starts Frisk everyone on exit

6 Offsite Emergency Situation Risks Response Leakage of Health risk and chemical injury to Evacuate against the wind to be Ammonia employees safe from the ammonia fumes from MCF Tanks Inform Fire Brigade for water curtain & blanketing Inform Mangalore Chemicals & Fertilizers Inform Insurance surveyor Inform Pollution Control Board Fire on ship Toxic Smoke and fumes Evacuate the employees carrying crude oil

17/25

Disaster Plan Emergency Preparedness

1 For Prevention

a. PPE

b. Safe Work Practices

c. Hazard Signage

d. Awareness about Hazards & Risks

e. Proper Earthing of Building & Equipment

f. Display of MSDS of the chemicals used and create awareness

g. Store chemicals as per the Handling and Storage instructions in MSDS

h. Storage of chemicals as per compatibility chart

i. Segregate the non-compatible chemicals to avoid unwanted reactions

j. Establish safety programs

2 For Detection

a. Regular inspection of the facility

b. Security Guards

3 For response

a. Location Plan with Exits & Assembly Point

b. Fire Extinguishers

c. Trained Fire Fighters

d. First Aid Equipment

e. Trained First Aiders

f. Emergency Tool Kit

g. Emergency Lights

h. Emergency Telephone Numbers

18/25

Disaster Plan Communication

Following procedure shall be followed for emergency communications

1 Whenever an emergency is spotted shout

2 Shout Fire, Fire if you spot fire

3 Inform the Security on telephone number

4 Inform the Location, Type of emergency, How Big is the situation, Extent of Injury if any to facilitate correct response

5 On the gravity of the situation, sound alarm / siren to declare emergency

6 Evacuate the factory and assemble at the assembly point

7 Alternate Site controller to take charge of the situation in the absence of site controller

8 Site controller shall be informed immediately

9 Fire, Police, Ambulance and other help services may be informed as required

10 Authorities should be informed

11 Communicate the news of any injury to family members of the injured

12 Transfer the injured to medical help

13 Only site controller to speak to the press or media

14 Sound the all clear siren when the situation is under control

19/25

Disaster Plan Emergency Equipment

The following Emergency Equipment shall be kept as an Emergency Kit

1 Helmets and Face Shields 2

2 Leather Hand Gloves 2

3 Electrical Hand Gloves 1

4 Emergency First Aid Box 1

5 Emergency Lights / Torches 2

All emergency equipment shall be kept at a designate place in Security. It shall be inspected periodically to ensure availability at the time of emergency.

The First Aid Box shall contain the following

1. Wound Dressing Small / Medium / Large

2. Burn Dressing Medium / Large

3. Eye Pads

4. Absorbent Cotton Wool

5. Antiseptic Cream

6. Bandages

7. Adhesive Plaster

8. Scissors

9. Burn Ointment Burnol

10. Tourniquet

11. Eye Wash Bottles

12. Splints

13. Antiseptic lotion

20/25

Disaster Plan Return to Normalcy

The following procedure shall be followed after the emergency is over

1 The all clear siren / hooter shall sound

2 All personnel belonging to the area not affected by the emergency shall go to their work stations

3 The Site controller shall inspect the area affected by the emergency and instruct the personnel as to the further course of action

4 The Site controller shall hand over the charge to the head of the department for further action for restoring normalcy

5 All team leaders shall submit a report on the handling of the emergency to the site controller

6 Site controller shall carry out investigation in the immediate cause and the Basic cause of the emergency situation.

7 Site controller shall also assess the effects of the emergency response on the environment and take appropriate action. These could be

a. Land contamination by DCP or Foam extinguishers

b. Water contamination by fire water runoff

c. Air pollution by the smoke and toxic fumes from a fire

d. Health hazard to people or animals surrounding the area

e. Disposal of the debris after a fire

f. Effect of the smoke on surrounding vegetation

g. Release of CFC in the atmosphere due to breakage of air-conditioners

8 Site Controller shall hold a de-briefing meeting to discuss the ways and means to prevent a recurrence of the situation

21/25

Disaster Plan Training

The following types of trainings shall be given

1. Awareness Training

a. Awareness about the chemicals used in the company by display of MSDS

b. Awareness about the Emergency Plan and required response

c. Mock Drills and Fire Drills

d. Alarm systems

e. Site Plan & location of Fire Extinguishers

f. Emergency Exits and Exit routes

g. Roles and Responsibilities

2. Training in the use of Fire Fighting Equipment

a. Causes of Fire

b. Prevention of Fire

c. Use of Fire Fighting Equipment

3. Training in First Aid

a. Basic First Aid

b. Attending to Fracture & Wounds

c. Attending to Burns and Scalds

d. Attending to Electric Shock

e. CPR

22/25

Disaster Plan Mock Drill

The mock drill shall be carried out to evaluate the effectiveness of the Emergency Plan as also to evaluate the effectiveness of the training provided.

Mock drills clarify the responsibilities of the persons involved.

Mock drills also throw up opportunities for improvement in the system.

An observer shall monitor all mock drills and a record of events shall be kept in the Mock Drill Record. This shall be evaluated for identifying training needs and finding opportunities for improvement in the Disaster Plan.

The mock drills shall be carried out after informing the critical personnel so that there are no critical incidents during evacuation and response. Initial mock drills shall be carried out after informing the employees.

Mock Drills shall be carried in Day time & Night time [Beyond 2200 hrs] alternatively once every six months.

A Mock drill report shall be prepared

23/25

Disaster Plan Emergency Telephone Numbers

Government Office Tel no

Dy. Chief Inspector of Factories 2451716

Electrical Inspector 2454970

District Collector 2220590 / 1077

JMFC Magistrate 2451400

Dy. Chief Controller of Explosives 2441588

New Mangalore Port Trust 2407341

Karnataka State Pollution Control Board 2406586

Labour Office, Kankanady, Mangalore 2437479

Dix Shipping Company 2408453

Police Station 100

Fire Brigade 101

NMPT Fire Service 2407488

Hospital KMC Hospital, Attavara 2445858

City Hospital 2217901

A.J. Hospital 2225533

Padmavathi Hospital, Surathkal 2476600 to 03

Blood Bank (Venlock Hospital) 2410701

Ambulance 102 / 108

KMC (Ambulance) 2444777

24/25

Disaster Plan DO

1. PAY ATTENTION TO ALL INSTRUCTIONS. THEY MAY SAVE YOUR LIFE.

2. REPORT TO YOUR TEAM LEADER TO CARRY OUT YOUR DUTIES. YOU MAY SAVE SOMEONES LIFE

3. CONDUCT VISITORS IN YOUR AREA TO SAFE ASSEMBLY POINT

4. FIRE FIGHTERS TO FIGHT THE FIRE

5. FIRST AIDERS TO ADMINISTER FIRST AID TO INJURED

6. REMAIN CALM DON’T

1. DO NOT PANIC

2. DO NOT TALK TO OUTSIDERS

3. DO NOT SPREAD RUMOURS. YOU WILL CREATE PANIC

4. DO NOT RUSH TO EMERGENCY SITE. YOU WILL DISTURB OTHERS

5. DO NOT LOAD COMMUNICATION NETWORK WITH UNNECESSARY CALLS

6. DO NOT GO AWAY TILL EMERGENCY IS OVER OR INSTRUCTIONS TO GO ARE GIVEN

7. DO NOT USE ELEVATOR / LIFT IN CASE OF EMERGENCY EVACUATION

Site Layout with High Risk Areas Marked Enclosed

25/25

CORPORATE SAFETY, HEALTH AND ENVIRONMENTAL STANDARD

Document Number: ABG/CB/SHE 2032.10 Title : Standard on Safety in Jetty Operations Issue Date: 31.05.2017

Name and Title Date

Written By: Standard, Rules and Procedure Sub committee 22.03.2013 Owner: Corporate Safety 22.03.2013 Approved By: Safety Board

REVISION LOG

REVISION REASON FOR CHANGE(S): DATE: NO: 00 New document 22.03.2013 10 Revision (Port safety points) 31.05.2017 20 30 40

DOCUMENT MANAGEMENT

SHE document released from Central SHE Function shall be numbered as XXXX.YY. The first “X” shall be a numeric character and can vary from

1 to 4 indicating level of document .The first level document (starting from 1XXX) shall be SHE Policy / Principles etc. The second level document (starting from 2XXX) shall be corporate SHE standards; third level document (starting from 3XXX) shall be Corporate SHE procedure while forth level of document shall be represented as “4XXX” indicating forms and formats. The other three X ( XXX) shall be numeric character and will vary from 001 to 999 indicating document number. The first “Y” after dot sign (.) shall represent current revision status of document while second “Y” shall represent current page revision. Any changes in this document can be initiated from any individual as approved by SHE Board Standards, Rules and Procedure Subcomm ittee Chairman and shall be issued from office of Business Safety Head Office in consultation with SHE Board. The revised portion of the document shall be maintained in Italic and in red colour. .

Distribution: Safety Board Members, Unit Heads & Safety Website

Document No: ABG/CB/SHE 2032.10

(ABG Cement Business – Company Confidential Document) Title: Standard on Saf ety in Jetty Operations Issue Date: 31.05.2017 Document. No. ABG/CB/SHE 2032.10 Page 2 of 14

Cement Business Aditya Birla Group

Standard on Safety in Jetty Operations Table of Content

1.0 Purpose … 3 2.0 Scope 3 3.0 Reference 3 4.0 Location and activity 3 5.0 Responsibility 3 6.0 Procedure 3 7.0 Records 9 8.0 Abbreviations 9 Appendix 1: General Port Safety 10 Appendix 2: Shore-Ship Safety Check List 11 Appendix 3: Safe Berthing checklist 12 Appendix 4: Declaration of Security (DOS) 13 Appendix 5: Pre Arrival Notification of Security (PAN) 13 Appendix 6: Flow chart for Port emergency handling 13 Appendix 7: Drills and Training 14

Document No: ABG/CB/SHE 2032.10

ABG Cement Business – Company Confidential Document)

Title: Standard on Saf ety in Jetty Operations Issue Date: 31.05.2017 Document. No. ABG/CB/SHE 2032.10 Page 3 of 14

1.0 Purpose: To provide basic framework and specific requirement to ensure safety in Jetty operation across the UTCL sites wherever this facility exist. 2.0 Scope The standard will be applicable across all Jetties owned or having influence over the control by UltraTech Cement Ltd. As such the marine operations at the UTCL jetties encompass all water front operations. These include but are not limited to a. Providing safe alongside berths to work cargo or other activities; b. Berthing and un-berthing vessels; c. Keeping the port approaches safe for navigation i.e., free from navigational dangers; d. Control marine traffic to ensure that vessels maneuvering in port limits do not endanger themselves or endanger other ships; e. Promulgate of local navigational and weather warnings; f. Upkeep of navigational aids. g. Safe cargo operation. 3.0 Reference  SHE Policy, Safety principles  UTCL Safety Standards as applicable  R e f e r marine risk assessment no. UTCL/ RA/ MARINE – OPS/ 001034.  R e f e r aspect register and significant analysis. 4.0 Jetty Location and Activity  At Pipavav – Kovaya – Berthing – Unberthing Pilotage manoeuvre carried out by GPPL under GMB.  At Jafarbad – Berthing – Unberthing Pilotage manoeuvre carried out by UTCL itself Under GMB.  At Magdalla – Berthing – Unberthing Pilotage manoeuvre carried out by UTCL itself Under GMB.  At Ratnagiri – Berthing – Unberthing Pilotage manoeuvre carried out by UTCL under MMB.  At JNPT – Berthing – Unberthing pilotage manoeuvre carried out by JNPT  At NMPT – Berthing – Unberthing Pilotage manoeuvre carried out by NMPT  At Cochin- Berthing – Unberthing Pilotage manoeuvre carried out by CPT 5.0 Management Responsibilities 5.1 Primary Responsibility – In charge Port Facility 5.2 Secondary Responsibility – Jetty Cargo Officers (as applicable)

6.0 PROCEDURE 6.1 INTRODUCTION a. The marine operations involve various persons at different locations to work in tandem and in complete coordination, to safely execute a task. b. Marine operations are fraught with risks and hazards. c. Some of the hazards and risks are known and others are indeterminable or inestimable. d. The operation therefore requires a thorough knowledge of capabilities and limitations of equipment, understanding of operating environment, exploitation of individual professional expertise and implementation of set procedures. 6.2 Safety Regulations

Document No: ABG/CB/SHE 2032.10

ABG Cement Business – Company Confidential Document)

Title: Standard on Saf ety in Jetty Operations Issue Date: 31.05.2017 Document. No. ABG/CB/SHE 2032.10 Page 4 of 14 6.2.1 In order to ensure the safety and security of vessels working cargo at UTCL Jetty, Master, Pilots, Officers and the vessel’s crew are expected to be familiar and complying with the relevant provisions contained in the following publications: a. International guide for oil tanker and terminals b. Code of safe working practices c. Solid bulk code d. Code of practices for safe loading of bulk carriers e. IMDG code f. ISPS code g. SOLAS h. MARPOL

6.3 Facilities & Resources 6.3.1 The various facilities and resources available at the UTCL jetty are given in Integrated Management System Apex Manual. 6.3.2 The port control and cargo supervisor are manned round the clock by qualified personnel and the duty personnel are available at the terminal to oversee the marine operations. 6.4 Port Safety 6.4.1 Pilot age within port limits is compulsory. (This is not applicable for JFD and MGD Port as per GMB guideline/Notification) 6.4.2 No movements are to be undertaken without a licensed pilot on board and without express instructions from the port control. (This is not applicable for JFD and MGD Port as per GMB guideline/Notification) 6.4.3 The various guidelines to be followed to ensure the safety at port are given in Annexure 1 to this procedure 6.5 Marine Emergencies 6.5.1 The port control is manned round the clock by qualified personnel and keeps a watch on VHF Channel 16 or specific channel designated by Port. 6.5.2 Following emergency resources are available under port control a. Duty personnel at port control under control of Duty Marine Officer b. Tugs and mooring boats at 30 minutes notice; c. Mooring gang at 30 minutes notice; d. Fire services are stand by and ready for immediate use; e. Pilots on call at one hour notice to attend to any emergency or assist in operation 6.5.3 Marine emergencies can always be prevented or their affect reduced by taking adequate preventive measures. 6.5.4 Following emergencies have been identified and the actions to be taken for each of them have been detailed in the relevant Work Instructions as mentioned against each of them Nature of Emergency - Operation Job Instruction A Person fall into Sea MAR/ JI/ 003 Fire on Berth or on Board ship MAR/ JI/ 001 Weather Conditions MAR/ JI/ 002 Natural Disaster – Cyclone / Tsunami MAR/ JI/ 015 Machinery or Vehicle falling into the Sea MAR/ JI/ 006 Periodic Checks at Jetty MAR/ JI/ 007 Management of Navigation MAR/ JI/ 008 Collision or contact with Jetty or Port Structure MAR/ JI/ 004

Document No: ABG/CB/SHE 2032.10

ABG Cement Business – Company Confidential Document)

Title: Standard on Saf ety in Jetty Operations Issue Date: 31.05.2017 Document. No. ABG/CB/SHE 2032.10 Page 5 of 14 Stranding of Ship MAR/ JI/ 005 Civil Disturbance/ Labour Dispute MAR/ JI/ 012 Evacuation MAR/ JI/ 017 Failure of Total Power Supply MAR/ JI/ 021 A Foreign Flag Vessel whilst Casting Off Reports Steering Gear Breakdown when 150 M away from Berth (arrival of channel), MAR/ JI/ 027 Suspected One of the Crew Saboteur

Failure of mooring system MAR/ JI/ 029

Nature of Emergency - ISPS Bomb Threat MAR/ JI/ 009 Terrorist Threat MAR/ JI/ 010 Activation of Ship Security Alert System (Vessel at Berth) MAR/ JI/ 013 Activation of Ship Security Alert System (Vessel at Anchorage) MAR/ JI/ 014 Hostage Situation MAR/ JI/ 016 Patrolling Party Not Reporting for Past Two Hours MAR/ JI/ 018 Intruders Trying to Enter From Jetty Barrier MAR/ JI/ 019 Moored Vessel Under Attack Requests Assistance MAR/ JI/ 020 Perimeter Fence Found Breached MAR/ JI/ 022 Suspected Explosive Device Found at Jetty MAR/ JI/ 023 Threat to explode Hijacked Vessel at Jetty MAR/ JI/ 024 Unscheduled Merchant Vessel Detected by Joint Sea Patrol Heading MAR/ JI/ 025 Towards Anchorage, Not Responded When Challenged on VHF Blockage of Channel by Sinking Vessel with Potential for Large scale MAR/ JI/ 026 Pollution Intelligence indicates Vessel Ex-Dubai Carrying Stowaways. Intelligence further indicates Terrorists Trying to Infiltrate using Sea MAR/ JI/ 028 Routes

6.6 Periodic Checks 6.6.1 As a normal practice, periodic checks are taken up by marine officers/ jetty supervisors to ensure safe operations at the jetty. 6.6.2 A detailed description is given in work instruction MAR/ WI/ 007 – Periodic Checks at Jetty.

6.7 Weather Operating Parameters 6.7.1 The jetty is open to wind, sea, current, tidal flow and swell. 6.7.2 The operations, therefore, are greatly affected by weather. 6.7.3 The operating weather parameters will depend upon circumstances prevailing at that time such as the size of the ship, amount of freeboard, type of cargo, state of vessels moorings anchor and windlass, direction of wind, sea and swell and available weather forecast. 6.7.4 The terminal operator (Dry/ Liquid/ Container) will take into considerations of the vessel characteristics, and the berthing parameters in addition to the under mentioned guidelines in making a decision to continue or suspend operations at the marine terminal.

Document No: ABG/CB/SHE 2032.10

ABG Cement Business – Company Confidential Document)

Title: Standard on Saf ety in Jetty Operations Issue Date: 31.05.2017 Document. No. ABG/CB/SHE 2032.10 Page 6 of 14 6.7.5 In order to ensure safe berthing and un-berthing of vessel as well as safe working of the vessel, the weather conditions at the port shall be continuously monitored. 6.7.6 Job Instruction no. MAR/ JI/ 002 – Weather Conditions describes the limits for working of the vessel. 6.7.7 The port control / Jetty Cargo officer shall monitor weather on a continuous basis and a record of the daily weather shall be kept. 6.7.8 The data is to be analyzed and collated along with weather warnings received. 6.7.9 The marine terminal will inform the ships and Port Captain / Jetty Cargo officer of any impending bad weather so that precautionary measures can be taken. 6.8 Pilots Discretion 6.8.1 In case, the vessel Master still insists on the manoeuvre to be carried out, the pilot will inform In- charge Port Facility who would give further directions in the matter. 6.8.2 No pilot will carry out any manoeuvre, which he considers as unsafe either to the vessel or to the port’s facilities. 6.8.3 The pilot may be called later to elucidate the reasons for his decision or may have to submit a written explanation. 6.9 Special Precautions during Night Movements 6.9.1 Distances can be deceptive at night. Shore lights and dark areas can impair the vision and perception of the pilot. 6.9.2 In order to ensure conditions that are nearly fail safe, following additional measures are to be undertaken during night movements. a. The jetty area should be well illuminated b. It is to be doubly ensured that the jetty front is clear of all obstructions and that no work is going on under the jetty. c. The berth should be inspected and the bollards and jetty face should be cleared of any obstructions so that the vessels lines can be passed or cast-off unhindered. d. The mooring boats and tugs should be informed of the night movements’ well in advance so that they can ensure preparedness. e. The life buoys on the jetty should be checked for immediate deployment in case of a person falling in the sea. f. Gallery lights of the conveyor should remain on when berthing or un-berthing at UTCL berths. g. All transit lights are operational. h. All navigational channel marker buoys are operational. i. The mooring boat or pilot boat or tugs shall be secured properly at jetty 6.10 Manning of Harbour Crafts 6.10.1 The harbour crafts will be manned by duly certified crew. 6.10.2 Whenever there is a change in Master and/ or the Chief engineer or other crucial crew members, the manning contractor will ensure that the new crew member has familiarized themselves with the vessel, the job requirements and the area of operation. 6.10.3 There should be a reasonable overlap between incoming crew and outgoing crew to ensure proper handing over/ taking over. Manning contractor ensures compliance to this. 6.11 Transmissions on Berth 6.11.1 Operations of MF/ HF radio while alongside berth is prohibited and this being enforced by Marine officers/ jetty supervisors. 6.12 Immobilization 6.12.1 Repairs to engines of vessel alongside berth will normally not be permitted if it involves immobilization of engines.

Document No: ABG/CB/SHE 2032.10

ABG Cement Business – Company Confidential Document)

Title: Standard on Saf ety in Jetty Operations Issue Date: 31.05.2017 Document. No. ABG/CB/SHE 2032.10 Page 7 of 14 6.12.2 In exceptional cases when permission is granted, the port may depute additional resources like pilots, tugs, mooring boats, ropes with mooring gangs at the cost of the vessel. 6.13 Chipping/ Painting Job No chipping/ painting/ maintenance job on shipside is ordinarily permitted alongside berth

6.14 Ship-Shore Safety Check List 6.14.1 A relevant safety check, as enclosed as Appendix 02 shall be completed by jetty cargo supervisor along with the chief officer or Master of the ship before and during operations to ensure the safe cargo operations at UTCL jetty. 6.14.2 Any defects, non-compliance or infringement will be brought to the notice of the vessel for correction and repeated infringements may result in the stoppage of cargo and the removal of vessel from the berth. 6.14.3 All consequential charges and delays will be on vessel’s account. 6.14.4 Records of ship-shore safety check lists are being maintained in department-wise sop format 6.14.5 Shore / Ship Safety Check list: As per Appendix-02.

6.15 Hot Work/ Cold Work (Refer UTCL Safety Standard on Hot Job Doc # ABG/CB/SHE 2021.00 & PTW Doc # ABG/CB/SHE 3005.00) 6.15.1 No hot work is permitted without the consent of the port facility In charge. 6.15.2 Wherever hot work permission is granted a permit system is to be followed to ensure safety. The permit is subject to verification by personnel from HSE/ Fire / Marine Department. 6.15.3 Hot work permission will not be granted in case of following: a. Vessel having dangerous goods on board; b. If vessel does not have proper or sufficient fire fighting appliances; c. On closed hatch covers having combustible cargoes under it; d. Near the vents of diesel/ oil tank; e. If a vessel has an excessive trim and has violated the port’s safety rules and regulations; f. If due to some reason port’s fire fighting appliances are engaged in any other emergency; g. If the vessel is not ready to move under its own power; h. During strong winds and bad weather or any other reason which may pose any danger to the ship/ ports, and i. Not in the same hold from which a cargo is being worked. 6.16 Anchorages 6.16.1 The duty officer at marine control will advise specific anchoring positions to each vessel approaching the port and anchoring in the port area. 6.16.2 The information on the anchor position of each ship should be readily available in the port controls in their designated with Chart no. 6.16.3 Vessel carrying dangerous cargo should be anchored in a position where they are safe and do not endanger other ships and port facilities. 6.16.4 The minimum distance between the anchoring positions of two vessels carrying dangerous cargo should be one mile. 6.17 Wrecks 6.17.1 The port water is free of any known wrecks. 6.17.2 However if at any point in time, wrecks occur or are detected in port waters, the same

Document No: ABG/CB/SHE 2032.10

ABG Cement Business – Company Confidential Document)

Title: Standard on Saf ety in Jetty Operations Issue Date: 31.05.2017 Document. No. ABG/CB/SHE 2032.10 Page 8 of 14 shall be promulgated, marked and depending upon the risk, removed. 6.17.3 P o r t shall make arrangements to raise resources to carry out wreck removal, destruction or marking as appropriate. 6.18 Bythematery Charts and Dredging 6.18.1 There may be a possibility of dredging activity going on in the port area. 6.18.2 The port facility shall maintain latest bythematery charts depending on the siltation rate at the port

6.19 Routine Inspection of Jetty structures 6.19.1 The jetty structures, under deck constructions like pile and the muffs, and fenders should be examined at least once in six months to detect any damage. Maintenance will be looked after by Civil / Mech II department. An Extra mooring line (Providing in case of emergency) should be checked once in six months. This activity along with repairs of any defect will be carried out by Mech. Department or concern dept. 6.20 NAVIGATIONAL AIDS 6.20.1 The navigational aids in port are maintained in good state. 6.20.2 Any change in the status of the navigational aids is to be informed to the pilots, port crafts and regular users of harbour waters immediately. 6.20.3 In case of a permanent or a quasi-permanent change, the port shall have the information promulgated by the National Hydro-graphic Office as notice to mariners. 6.20.4 The position of buoys and floating marks are checked on a regular basis. 6.20.5 Navigational aids have uninterrupted source of power supply. 6.20.6 Navigational aids should be augmented depending upon the traffic levels and increased perceived risks. 6.20.7 Management of navigation is detailed in the work instruction MAR/ WI/ 008 – Management of Navigation. All above observation are reported to State/Concerned PPL authority.

6.21 Ship-shore safe access/gangway 6.21.1 It is the prime responsibility of the ship to provide safe access between ship and shore on arrival in the port. 6.21.2 However due to port infrastructure/other obstructions if the ship’s gangway can’t be used then port facility shall have arrangement to provide safe access between ship and shore 6.22 Reviewing Change in Ports Berthing Policies 6.22.1 Whenever there is a need to accept larger and deep draft vessels with respect to depths and under keel clearance available in approaches and alongside berths than earlier accepted, the ports marine assets and resources are assessed to ensure that the new change does not endanger the port facilities. 6.22.2 Survey of waters is done monthly to ensure that the vessels safely navigate and approach the berth and remain at the berth. An evaluation of port’s tugs and mooring equipment’s power is done when to be required and verified that the safe working limits are not exceeded.

Document No: ABG/CB/SHE 2032.10

ABG Cement Business – Company Confidential Document)

Title: Standard on Saf ety in Jetty Operations Issue Date: 31.05.2017 Document. No. ABG/CB/SHE 2032.10 Page 9 of 14

7.0 RECORDS

IMS DESCRIPTION RETENTION RECORD TIME Ship-Shore Safety Check List Three Years Declaration of Security (DOS) Three Years Pre Arrival Notification of Security (PAN) Three Years Safety Berthing Check List One Year Safety Un-Berthing Check List One Year

8.0 ABBREVIATION

IMDG Code International Maritime danger goods ISPS Code Icnotdeern ational Ship & port security code SOLAS Safety of life at sea MARPOL Marine pollution VHF Very high frequency MF Medium frequency HF High frequency WI Work instruction UTCL Ultra tech cement ltd. GMB G ujarat Maritime Board MMB M aharashtra Maritime Board

Document No: ABG/CB/SHE 2032.10

ABG Cement Business – Company Confidential Document)

Title: Standard on Saf ety in Jetty Operations Issue Date: 31.05.2017 Document. No. ABG/CB/SHE 2032.10 Page 10 of 14

Appendix – 1 GENERAL PORT SAFETY

Every person will ensure that all work in port is carried out with due diligence and caution and with an eye for safety. While carrying out the operations, following safety guidelines are to be complied with: a. Every place of work with its access should always be in safe condition without risks to life, health and environment; b. No work is performed nor passage of goods permitted under a swinging load or a running conveyor belt; c. When a working area is to be kept free of traffic, portable barrier is setup; d. Safety precautions peculiar to the material should be complied with when handling dangerous goods; e. Gangway where provided shall be properly rigged/ secured with safety nets and sufficiently illuminated. It should be of sufficient length so as not to be vertical/ f. Astlel epwo drkiuringn gareas high andtide ;ac cess points as well as liquid cargo manifold and gangway must be properly illuminated during the hours of darkness; g. All persons in the working area shall wear safety shoes, hand gloves and helmets or safety apparels appropriate to the nature of work; h. Any spillage likely to cause slippery surface should be attended to and rendered i. Ashar am rlesules ;the winch/ crane operator shall have a clear view of the cargo working area; j. There should be one winch operator guided by a signal man for each single loading winch; k. All Ship Loader, lifting gears, loose gears and accessories should be visually tested prior being put to use. l. Underwater activities, lowering of lifeboat in water, pleasure boat and small craft alongside the vessel and radio transmissions are strictly prohibited; m. Vessel using Jetty of UTCL for loading/ discharging of cargo are not allowed to discharge dirty ballast, garbage, oil, etc. in the sea waters and strictly adhere to MARPOL requirements; n. All vessels to make sure that no discharge from vessel should fall on jetty.

Document No: ABG/CB/SHE 2032.10

ABG Cement Business – Company Confidential Document)

Title: Standard on Safety in Jetty Operations Issue Date: 31.05.2017 Document. No. ABG/CB/SHE 2032.10 Page 11 of 14

Appendix – 2 SHORE / SHIP SAFETY CHECK LIST FOR LOADING/DISCHARGING OF DRY BULK CARRIERS Doc # ABG/CB/SHE 4042.00 The Master and the Port Capt of the terminal or their representative should complete the C.L. jointly as per IMO’S guidelines. Date: Ship Name: Loading: Unloading: Port: Pipavav, India. Terminal : UTCL Jetty, Arrival Draft : F A M Name of the Ship’s Agent: Cal. Dep. Draft : F A M The master is responsible at all the times for the safe loading and unloading of his ship. The details of which should be confirmed in the form of loading/unloading plans No ACTION REQUIRED PORT SHIP Is the depth of water at the berth and the said draught adequate for the cargo operations? 1 (Departure draft not to Exceed 11 mtr Maximum & OR ALSO DWT NOT TO EXCEED 45,000 MT) Available depth of water on berth 11.2 mtrs & Max Air Draft clinker/cement- 12.0 M/9.5 M. Are mooring arrangements adequate for all local effects of tide/current, Weather, traffic and craft? 2 (KEEP SHIP ALONGSIDE AT ALL TIMES) 3 In emergency, is the ship able to leave the berth any time? Is there safe access between the ship and the wharf? 4 Ship to provide Safe access at all times (GANGWAY WITH SAFETY NET). Is the agreed ship / Terminal communications system operative? Language: English. Radio Channels: VHF CH-71 5 Communication method: VHF / Mobile phone : Port Capt. Cargo supervisor, Cargo Control Room Are the liaison contact person during operations positively identified? Ship contact persons: Master/Chief officer/Duty Officer. 6 Shore contact persons: Port Captain/Cargo Supervisor/ Cargo Control room. Location: Captains Office/Jetty. 7 Are adequate crew on board and adequate staff in the terminal for emergency? 8 Have any bunkering operations been advised and agreed upon? NO NO 9 Has the procedure for reporting and recording damage from Cargo operations Been agreed? 10 Is the atmosphere safe in holds and enclosed spaces to which access may be required? 11 Have the cargo handling capacity and any limits of travel for loading /unloading been passed to the ship /terminals? Unloading: 1000 TPH Max. Loading: CEMENT Max 600-800 TPH & CLINKER Max 1600-1700 TPH. BELT CARGO Cement/clinker discuss & agreed= MT 12 Has a loading / unloading plan calculated for all stages of loading/de-ballasting or unloading/ballasting? Have the holds to be worked been properly identified in the loading / unloading plan, showing the sequence of work and tonnage of 13 cargo to be transferred each time the hold is worked? Do both ship and terminal understand and accept that if the ballast program becomes out step with the cargo operation, it will be 14 necessary to suspend cargo operation until the ballast operation has caught up? Master to request to stop Loading operations in writing. Have the procedure to adjust the final trim of the loading has been decided and Agreed? 15 No manual trimming possible at this terminal. Has the terminal been advised of the time required for the ship to prepare for sea? This being tidal ports, the ship is required to sail 16 soonest on completion of cargo work. Ship should batten down/secured all hatches/cranes on completion except the holds required for trimming purpose. 17 In case of emergency, ship to sound whistle signal to attract attention & contact Loader operator / Cargo Supervisor. Ship at Every stage to load cargo as per draft, carry out interim draft survey religiously, & not to depend upon belt Weigher / Shore 18 figures. (THE SHORE FIGURE IS ONLY AN INDICATIVE). 19 Hot work & M/E immoblisation in exceptional cases on written request well in advance from the port. 20 Ship's staff to wear proper PPE to go on shore for official/personal reasons. CAUTION: The onus for overloading will always be with the ship. Be careful for loading to departure draft or load line only, as there may not be space to get the over loaded cargo off loaded. PROPERTIES OF CARGO: Moisture content: less then 1% 3 3 3 ngle of repose: CLINKER 34 deg, Bulk Cement: OPC 32 deg, & PPC 22 deg. THE ABOVE HAS BEEN AGREED & WELL UNDERSTOOD. Time : Date: For Ship : For UTCL, Site terminal : Rank : Master/Chief Officer Position: Port Captain Page 1 of 1 ABG/CB/SHE 4042.00

Document No: ABG/CB/SHE 2032.10

ABG Cement Business – Company Confidential Document)

Title: Standard on Safety in Jetty Operations Issue Date: 31.05.2017 Document. No. ABG/CB/SHE 2032.10 Page 12 of 14

Appendix 3 Safe Berthing Checklist Doc # ABG/CB/SHE 4042.00

No POINTS REQUIRED TO BE CHECKED / CONFIRMED(At least, 2 hours before berthing) YES/ NO/ NA Remarks Check all bollards, clear from previous cargo (spillages) for berthing of the next ship? 01 To check seaside jetty deck clear from working persons & Equipment’s. 02 Check the Walkie-Talkie & communication? 03 Confirmed the Vessel berthing schedule/programme from the port captain? 04 Has the ship’s agent tendered pilot memo to port control for berthing of the next ship? Check from Divine shipping about receipt of all documents for this ship & quantity of cargo to be 05 loaded as per shipping bill? 06 Check the POB timings from port control? 07 Have the following personnel been informed: a) Jetty CCR for change of loading chute (Clinker or Cement) b) UTCL’s protective agent. c) Owners/Charters protective agent for arranging custom & immigration formalities. d) Shippers/Charterers / Receiver surveyor. 08 Check that GPPL’s mooring gang arrives at our jetty & their boarding arrangement. Ensure mooring gang, cargo supervisor wear all required PPE (safety helmet, shoes, gloves, life jacket, 09 dust mask, goggles.) Check/get that vessel positioned in such a way that the Mid ship draft is visible and not behind rubber 10 fender and availability of gangway 11 Co-ordinate with pilot to “position the ship” for loading / discharging location. AFTER BERTHING OF THE SHIP Gangway (with safety net) between ship and shore is in proper place for safe access. 12 ( “No operation without proper gangway”) 13 Q.C.(Lab) Clearance – Initial Cargo, Grade and Qty 14 Communicate CCR for the readiness of S/L or HOPPER for loading/discharging. 15 Supervise all ballast tanks sounded properly & density taken appropriately 16 Check all hatches are opened and cranes positioned on sea side or readiness of cement loading point 17 Check custom clearance time before commencement of cargo 18 Has the shore/ship check list understood and signed & stamped by Master or Ch. Officer. 19 Have the following documents been collected from the ship: a) Loading sequences ( 4 copy from Master / Ch. Officer stamp & sign) 1 for CCR, 1 for S/L, 1 for cargo supervisor, 1 for record b) Ship / Shore check list (2 copy, one copy return back after sign of port captain) c) Declaration of Security (2 copy, one copy return back after sign of port captain) d) Ship particulars e) Vessel Data Sheet f) Ballast water reporting form g) PAN ( Pre Arrival Notification), Crew list h) ISSC & SSO certificate I) DWT Calculation & Voyage abstract 20 Monitor the loading/discharging sequences are being followed as per the plan 21 To give Vessel feedback form to the Master/Ch. officer of the vessel? Calculate the ETC on regular basis, if ETC @ the tide, co-ordinate operation closely to depart the vessel 22 in same tide, & Appraise Port captain regularly.

Document No: ABG/CB/SHE 2032.10

ABG Cement Business – Company Confidential Document)

Title: Standard on Safety in Jetty Operations Issue Date: 31.05.2017 Document. No. ABG/CB/SHE 2032.10 Page 13 of 14

Appendix – 4 Declaration of Security

In line with local requirement

Appendix – 5 Pre-Arrival Notification of Security (PANS)

In line with local requirement

Appendix – 6 Example of Flow Chart for Port Facility’s Emergency handling

Port Facility Emergency

CONTROLLER

MAIN SITE Dy. MAIN SITE SAFETY OFFICER SECURITY CONTROLLER CONTROLLER Fire Guards

INCIDENT CONTROLLER MEDICAL OFFICER

EMERGENCY CONTROL CENTRE (ECC) at Factory Main Gate LOCAL ECC

State / Concerned PPL’s CONTROL ROOM ON VHF Ch

Date Approved by:

Document No: ABG/CB/SHE 2032.10

ABG Cement Business – Company Confidential Document)

Title: Standard on Safety in Jetty Operations Issue Date: 31.05.2017 Document. No. ABG/CB/SHE 2032.10 Page 14 of 14

Appendix –7 Example: Port Facilities Emergency's – Drill Planner

EXECUTE MONTH DRILLS PLANNED IN THE MONTH REMARKS DATE January Failure of total power supply at night February Oil Spill & Fire Drill, An empty truck made forced entry and disappeared March inside the port premises. April May An empty car lying parked near a main sub-station for last 3 days. June Oil Spill & Fire Drill, Patrol party not reporting back for last 2 hours. July August September Oil Spill & Fire Drill, Moored vessel under attack requests assistance. October Perimeter fencing found breached, or Intruders attempting to penetrate November the perimeter barrier. December Oil Spill & Fire Drill, Bomb threat received by telephone.

Remarks: At least two drills to be conducted once in three months in first year & then one drill in three months with various scenarios.

Document No: ABG/CB/SHE 2032.10

ABG Cement Business – Company Confidential Document)