DOCSLIB.ORG

Uottawa Latex Thesis Template

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Uottawa Latex Thesis Template Intrinsically Disordered Proteins: Mechanics, Assemblies, and Structural Transitions by Mehran Bagheri Thesis submitted to the Faculty of Graduate and Postdoctoral Studies In partial fulfillment of the requirements For the Ph.D. degree in Physics Ottawa-Carleton Institute of Physics Department of Physics, Faculty of Science University of Ottawa Ottawa, Canada c Mehran Bagheri, Ottawa, Canada, 2017 Dedicated to my loving family. To my parents, Mahin and Mohammad whose deep devotion and sacrifice enable me to follow my dreams; To my brother, Majid, for his endless encouragement in furtherance of my dreams. To my beautiful wife, Niloofar, whose continual inspiration and support keep my dreams alive and eventually turn them to reality. ii Abstract Proteins are essential parts of living organisms that initiate and control almost all cellular processes. Despite the widely accepted belief that all functional proteins fold into stable and well-defined three-dimensional (3D) structures mandatory for protein activity, the existence of biologically functional disordered proteins has been increasingly recognized during past two decades. Proteins with inherent structural disorder, commonly known as intrinsically disordered proteins (IDPs), play many roles in a biological context. However, in contrast to their folded counterparts, they are dynamically unstructured and typically fluctuate among many conformations even while performing biological functions. In fact, it is this dynamical structural heterogeneity that that allows for IDPs to interact with other biological macro- molecules in unique ways. Moreover, while a majority of proteins in eukaryotic proteomes have been found to have intrinsically disordered regions (IDR), the mechanisms by which pro- tein disorder gives rise to biological functionality is still not well understood. Through a series of simulation studies on specific systems, this thesis probes several aspects of the emerging structure-function paradigm of IDPs, namely the mechanics, intermolecular assembly, and structural transitions occurring in these proteins. The lack of well-defined 3D structure in IDPs gives rise to distinct mechanical properties, the subject of the first study in the thesis on the elasticity of a elastomeric gluten-mimetic polypeptide with an intrinsically disordered character. This disordered polypeptide was shown to exhibit distinctively variable elastic response to a wide range of tensions, which a classical worm-like chain model failed to accurately describe, thus requiring a molecular-level analysis. IDPs are frequently involved in protein-protein interactions, the focus of the second study on the propensity of an IDR, the B domain in dynamin-related protein 1 (Dpr1), to self- assemble into dimer structures while remaining disordered in all solution conditions. Despite a hypothesized auto-inhibitory role for this domain in Dpr1 that was assumed to be trig- gered by an disordered-to-order transition, the B domains in solution showed no tendency iii iv to form ordered structures even in the presence of order promoting osmolytes. Instead, self-association in the presence of osmolyte was found to occur by favorable intermolecular intereactions between specific region on the surface of the B-domains. Other IDPs do undergo a disorder-to-order transition in response to environmental cues, in ways that are unique disordered proteins, the focus of the last study on intermolecular or- dering transitions in silk-like proteins. Factors such as protein sequence and physical tension were investigated, and results suggested that tyrosine residues in the key silk sequence mo- tifs promote templating of beta structure from disordered precursors and that elongational stresses preferentialy stabilize antiparallel beta-sheet order. Together, these three computa- tional studies provide insight into the nature of the structure-function mechanisms of IDPs. Acknowledgements First, and foremost, I would like to express my sincere gratitude to my advisor Dr. James L. Harden for the opportunity to work in his laboratory. It was a great privilege to have worked and learned under the mentorship of such a knowledgeable and ambitious scientist with a great personality. Thank you for showing me nothing but patience and unparalleled professionalism over several years. I would like to thank senior scientist Dr. Ebrahim Karimi, Dr. Andrew Pelling, and Dr. Bela Joos, for continual inspiration and stimulating conversations during my graduate study. I also thank all my kind-hearted and caring colleague in the physics department, particularly Rahil Golipour and Kristina Haase. Thank you to the welcoming staff of the physics depart- ment, namely Madeleine Thomas and Lisa Murphy. Last but not least, thank you to my beautiful wife who are the source of my everlasting drive for success and without whom I could not have made it this far. Thank you, everyone. v Statement of Originality To the best of my knowledge, I hereby declare that this thesis establish original work gener- ated during my Ph.D. studies under the supervision of Dr. James L. Harden, in the Centre for Interdisciplinary Nanophysics laboratories in the Department of Physics at the University of Ottawa. Chapter4 was published whereas Chapter2,3 and AppendixA,B are prepared for peer-reviewed scientific journals. I solely generated all simulations data and perform statistical analysis to develop com- putational results while Dr. James L. Harden contributed to the direction and editing of all manuscripts. Other researchers also contributed to this work performing experiments were acknowledged in each chapter. Dr. Ammon Posey and Dr. Blake Hill introduced B domain and TMAO osmolytes explain in Chapter3. Lin Yinan and Benjamin Partlow, who were Ph.D. Candidates at the time under the supervision of Dr. David Kaplan, provided all experimental results and contributed to writing the experimental portion of the manuscript in Chapter4 and AppendixA, respectively. Python package (AppendixB) was written and developed by me; while Emilie Fortin, undergraduate summer student, edited the code and scripted a graphical user interface for the package. vi Contents Abstract iii Acknowledgementsv Statement of Originality vi Contents vii List of Figuresx List of Tables xii 1 Introduction: Functional Protein Disorder1 1.1 Principles of Protein Structure and Function..................2 1.1.1 Amino acid sequence as protein signature................2 1.1.2 Description of protein structure.....................4 1.1.3 Folding kinetics and thermodynamics..................6 1.2 Appearance of Disordered Protein........................8 1.3 Disorder Advantageous in Function....................... 11 1.3.1 Structural ensemble and entropic chain................. 11 1.3.2 Disorder interaction and regulation of protein complex........ 12 1.4 Thesis overview.................................. 13 2 Mechanics of Intrinsically Disordered Proteins 16 2.1 Background: Lessons from Polymer Physics.................. 17 2.1.1 Ideal chain and entropic spring..................... 17 2.1.2 Polymer elasticity models: worm-like chain............... 20 2.1.3 Real polymer size in solution and scaling-law.............. 22 2.2 Introduction.................................... 25 2.3 Simulation and Analysis Methods........................ 27 2.3.1 Wheat-gluten mimetic polypeptide sequence.............. 27 2.3.2 Equilibration to a compact structure.................. 27 2.3.3 Force-extension measurements...................... 28 vii CONTENTS viii 2.3.4 General simulation details........................ 28 2.3.5 Structural analysis............................ 29 2.4 Results and Discussions............................. 30 2.4.1 Structural aspects of the compact state................. 30 2.4.2 Stretching the WGM polypeptide.................... 33 2.4.3 Structural aspects impacting WGM elasticity............. 36 2.5 Concluding Remarks............................... 39 2.6 Appendix..................................... 42 2.6.1 Modified worm-like chain model fit................... 42 2.6.2 Distribution of φ dihedral angles for proline.............. 43 3 Protein Complex & Functional Disorder 44 3.1 Introduction.................................... 45 3.2 Simulation and Analysis Methods........................ 48 3.2.1 General simulation details........................ 48 3.2.2 B domain equilibration.......................... 48 3.2.3 Steered MD to construct various dimer configurations......... 49 3.2.4 Binding energy calculation for dimer.................. 50 3.2.5 Description of analysis and methods.................. 51 3.3 Results and Discussions............................. 52 3.3.1 B domain has disordered structure................... 52 3.3.2 Molecular interaction of TMAO with B-domains............ 55 3.3.3 Inter-chain associations of the B domain................ 59 3.4 Concluding Remarks............................... 64 3.5 Appendices.................................... 65 3.5.1 Forcefield Examination for TMAO molecule.............. 65 4 Disorder to Order transition in IDPs 66 4.1 Introduction.................................... 67 4.2 Simulation and Analysis Methods........................ 71 4.2.1 General simulation details........................ 71 4.2.2 Equilibration of silk solution and tyrosine self-assembly........ 72 4.2.3 Stability of silk peptide in beta-sheet structure............ 72 4.3 Results and Discussions............................. 74 4.3.1 Tyrosine colocation in solution...................... 74 4.3.2 Tyrosine residues
Load more

Recommended publications
  • Mechanism of Resilin Elasticity
    ARTICLE Received 24 Oct 2011 | Accepted 11 Jul 2012 | Published 14 Aug 2012 DOI: 10.1038/ncomms2004 Mechanism of resilin elasticity Guokui Qin1,*, Xiao Hu1,*, Peggy Cebe2 & David L. Kaplan1 Resilin is critical in the flight and jumping systems of insects as a polymeric rubber-like protein with outstanding elasticity. However, insight into the underlying molecular mechanisms responsible for resilin elasticity remains undefined. Here we report the structure and function of resilin from Drosophila CG15920. A reversible beta-turn transition was identified in the peptide encoded by exon III and for full-length resilin during energy input and release, features that correlate to the rapid deformation of resilin during functions in vivo. Micellar structures and nanoporous patterns formed after beta-turn structures were present via changes in either the thermal or the mechanical inputs. A model is proposed to explain the super elasticity and energy conversion mechanisms of resilin, providing important insight into structure–function relationships for this protein. Furthermore, this model offers a view of elastomeric proteins in general where beta-turn-related structures serve as fundamental units of the structure and elasticity. 1 Department of Biomedical Engineering, Tufts University, Medford, Massachusetts 02155, USA. 2 Department of Physics and Astronomy, Tufts University, Medford, Massachusetts 02155, USA. *These authors contributed equally to this work. Correspondence and requests for materials should be addressed to D.L.K. (email: [email protected]).
    [Show full text]
  • The Α-Helix Forms Within a Continuous Strech of the Polypeptide Chain
    The α-helix forms within a continuous strech of the polypeptide chain N-term prototypical φ = -57 ° ψ = -47 ° 5.4 Å rise, 3.6 aa/turn ∴ 1.5 Å/aa C-term α-Helices have a dipole moment, due to unbonded and aligned N-H and C=O groups β-Sheets contain extended (β-strand) segments from separate regions of a protein prototypical φ = -139 °, ψ = +135 ° prototypical φ = -119 °, ψ = +113 ° (6.5Å repeat length in parallel sheet) Antiparallel β-sheets may be formed by closer regions of sequence than parallel Beta turn Figure 6-13 The stability of helices and sheets depends on their sequence of amino acids • Intrinsic propensity of an amino acid to adopt a helical or extended (strand) conformation The stability of helices and sheets depends on their sequence of amino acids • Intrinsic propensity of an amino acid to adopt a helical or extended (strand) conformation The stability of helices and sheets depends on their sequence of amino acids • Intrinsic propensity of an amino acid to adopt a helical or extended (strand) conformation • Interactions between adjacent R-groups – Ionic attraction or repulsion – Steric hindrance of adjacent bulky groups Helix wheel The stability of helices and sheets depends on their sequence of amino acids • Intrinsic propensity of an amino acid to adopt a helical or extended (strand) conformation • Interactions between adjacent R-groups – Ionic attraction or repulsion – Steric hindrance of adjacent bulky groups • Occurrence of proline and glycine • Interactions between ends of helix and aa R-groups His Glu N-term C-term
    [Show full text]
  • Synthesis and Nmr Studies of a Β-Turn Mimetic Molecular
    SYNTHESIS AND NMR STUDIES OF A β-TURN MIMETIC MOLECULAR TORSION BALANCE by Melissa Ann Liberatore B.S. Chemistry, Lehigh University, 2006 Submitted to the Graduate Faculty of the Kenneth P. Dietrich School of Arts and Sciences in partial fulfillment of the requirements for the degree of Doctor of Philosophy University of Pittsburgh 2012 UNIVERSITY OF PITTSBURGH DIETRICH SCHOOL OF ARTS AND SCIENCES This dissertation was presented by Melissa Ann Liberatore It was defended on July 23, 2012 and approved by Professor Dennis Curran, Department of Chemistry Professor Michael Trakselis, Department of Chemistry Professor Judith Klein-Seetharaman, Department of Structural Biology Dissertation Advisor: Professor Craig Wilcox, Department of Chemistry ii Copyright © by Melissa Ann Liberatore 2012 iii SYNTHESIS AND NMR STUDIES OF A β-TURN MIMETIC MOLECULAR TORSION BALANCE Melissa Ann Liberatore, PhD University of Pittsburgh, 2012 The attainment of precise measurements of the molecular forces that influence protein folding is important in order to further understand peptide dynamics and stability. A hybrid synthetic- natural peptide motif, combining an o,o,o’-trisubstituted biphenyl with an (ortho-tolyl)-amide, was synthesized in multiple formats and studied by NMR to probe the effects of amino acid substitutions on antiparallel beta-sheet configuration and stability. The potential of this “molecular torsion balance” as a beta-turn mimic was demonstrated by quantifying the rotational barriers about several axes. The free-energy rotational barrier of the aryl-aryl bond was found to be 35.7 kcal mol-1 at 418 K in hexanes. EXSY analysis was also used to measure barriers about -1 -1 the N-aryl (20.9 kcal mol at 343 K in toluene-d8) and N-CO bonds (17.2 kcal mol at 298 K in chloroform-d).
    [Show full text]
  • Duke University Dissertation Template
    Order and Disorder in Protein Biomaterial Design by Stefan Daniel Roberts Department of Biomedical Engineering Duke University Date:_______________________ Approved: ___________________________ Ashutosh Chilkoti, Supervisor ___________________________ Joel Collier ___________________________ Brenton Hoffman ___________________________ Terrence Oas ___________________________ Rohit Pappu Dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Department of Biomedical Engineering in the Graduate School of Duke University 2018 ABSTRACT Order and Disorder in Protein Biomaterial Design by Stefan Daniel Roberts Department of Biomedical Engineering Duke University Date:_______________________ Approved: ___________________________ Ashutosh Chilkoti, Supervisor ___________________________ Joel Collier ___________________________ Brenton Hoffman ___________________________ Terrence Oas ___________________________ Rohit Pappu An abstract of a dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Department of Biomedical Engineering in the Graduate School of Duke University 2018 Copyright by Stefan Daniel Roberts 2018 Abstract Crystalline and amorphous materials have been extensively studied for their interesting properties, but they comprise a very small portion of the total materials space. The properties of most materials are a consequence of the interactions between their ordered and disordered components. This phenomenon is especially
    [Show full text]
  • Fibrillar Self-Assembly of a Chimeric Elastin-Resilin Inspired Engineered Polypeptide
    nanomaterials Article Fibrillar Self-Assembly of a Chimeric Elastin-Resilin Inspired Engineered Polypeptide Angelo Bracalello 1, Valeria Secchi 2,* , Roberta Mastrantonio 2, Antonietta Pepe 1, Tiziana Persichini 2, Giovanna Iucci 2 , Brigida Bochicchio 1,* and Chiara Battocchio 2,* 1 Department of Sciences, University of Basilicata, Via Ateneo Lucano, 10, 85100 Potenza, Italy; [email protected] (A.B.); [email protected] (A.P.) 2 Department of Sciences, University of Roma Tre, Via della Vasca Navale, 79, 00146 Rome, Italy; [email protected] (R.M.); [email protected] (T.P.); [email protected] (G.I.) * Correspondence: [email protected] (V.S.); [email protected] (B.B.); [email protected] (C.B.); Tel.: +39-06-5733-3400 (C.B.) Received: 2 October 2019; Accepted: 11 November 2019; Published: 14 November 2019 Abstract: In the field of tissue engineering, recombinant protein-based biomaterials made up of block polypeptides with tunable properties arising from the functionalities of the individual domains are appealing candidates for the construction of medical devices. In this work, we focused our attention on the preparation and structural characterization of nanofibers from a chimeric-polypeptide-containing resilin and elastin domain, designed on purpose to enhance its cell-binding ability by introducing a specific fibronectin-derived Arg-Gly-Asp (RGD) sequence. The polypeptide ability to self-assemble was investigated. The molecular and supramolecular structure was characterized by Scanning Electronic Microscopy (SEM) and Atomic Force Microscopy (AFM), circular dichroism, state-of-the-art synchrotron radiation-induced techniques X-ray photoelectron spectroscopy (XPS) and near-edge X-ray absorption fine structure spectroscopy (NEXAFS).
    [Show full text]
  • Pi-Pi Contacts Are an Overlooked Protein Feature Relevant to Phase
    RESEARCH ARTICLE Pi-Pi contacts are an overlooked protein feature relevant to phase separation Robert McCoy Vernon1, Paul Andrew Chong1, Brian Tsang1,2, Tae Hun Kim1, Alaji Bah1†, Patrick Farber1‡, Hong Lin1, Julie Deborah Forman-Kay1,2* 1Program in Molecular Medicine, Hospital for Sick Children, Toronto, Canada; 2Department of Biochemistry, University of Toronto, Toronto, Canada Abstract Protein phase separation is implicated in formation of membraneless organelles, signaling puncta and the nuclear pore. Multivalent interactions of modular binding domains and their target motifs can drive phase separation. However, forces promoting the more common phase separation of intrinsically disordered regions are less understood, with suggested roles for multivalent cation-pi, pi-pi, and charge interactions and the hydrophobic effect. Known phase- separating proteins are enriched in pi-orbital containing residues and thus we analyzed pi- interactions in folded proteins. We found that pi-pi interactions involving non-aromatic groups are widespread, underestimated by force-fields used in structure calculations and correlated with solvation and lack of regular secondary structure, properties associated with disordered regions. We present a phase separation predictive algorithm based on pi interaction frequency, highlighting proteins involved in biomaterials and RNA processing. DOI: https://doi.org/10.7554/eLife.31486.001 *For correspondence: [email protected] Introduction † Present address: Department Protein phase separation has important implications for cellular organization and signaling of Biochemistry and Molecular (Mitrea and Kriwacki, 2016; Brangwynne et al., 2009; Su et al., 2016), RNA processing Biology, SUNY Upstate Medical University, New York, United (Sfakianos et al., 2016), biological materials (Yeo et al., 2011) and pathological aggregation States; ‡Zymeworks, Vancouver, (Taylor et al., 2016).
    [Show full text]
  • Using Molecular Constraints and Unnatural Amino Acids to Manipulate and Interrogate Protein Structure, Dynamics, and Self- Assembly
    University of Pennsylvania ScholarlyCommons Publicly Accessible Penn Dissertations 2016 Using Molecular Constraints and Unnatural Amino Acids to Manipulate and Interrogate Protein Structure, Dynamics, and Self- Assembly Beatrice Markiewicz University of Pennsylvania, [email protected] Follow this and additional works at: https://repository.upenn.edu/edissertations Part of the Biophysics Commons, and the Physical Chemistry Commons Recommended Citation Markiewicz, Beatrice, "Using Molecular Constraints and Unnatural Amino Acids to Manipulate and Interrogate Protein Structure, Dynamics, and Self-Assembly" (2016). Publicly Accessible Penn Dissertations. 1879. https://repository.upenn.edu/edissertations/1879 This paper is posted at ScholarlyCommons. https://repository.upenn.edu/edissertations/1879 For more information, please contact [email protected]. Using Molecular Constraints and Unnatural Amino Acids to Manipulate and Interrogate Protein Structure, Dynamics, and Self-Assembly Abstract Protein molecules can undergo a wide variety of conformational transitions occurring over a series of time and distance scales, ranging from large-scale structural reorganizations required for folding to more localized and subtle motions required for function. Furthermore, the dynamics and mechanisms of such motions and transitions delicately depend on many factors and, as a result, it is not always easy, or even possible, to use existing experimental techniques to arrive at a molecular level understanding of the conformational event of interest. Therefore, this thesis aims to develop and utilize non-natural chemical modification strategies, namely molecular cross-linkers and unnatural amino acids as site-specific spectroscopic probes, in combination with various spectroscopic methods to examine, in great detail, certain aspects of protein folding and functional dynamics, and to manipulate protein self-assemblies.
    [Show full text]
  • Elastin-Like Polypeptides As Models of Intrinsically Disordered Proteins ⇑ Stefan Roberts 1, Michael Dzuricky ,1, Ashutosh Chilkoti
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Elsevier - Publisher Connector FEBS Letters 589 (2015) 2477–2486 journal homepage: www.FEBSLetters.org Review Elastin-like polypeptides as models of intrinsically disordered proteins ⇑ Stefan Roberts 1, Michael Dzuricky ,1, Ashutosh Chilkoti Duke University, Durham, NC, United States article info abstract Article history: Elastin-like polypeptides (ELPs) are a class of stimuli-responsive biopolymers inspired by the intrin- Received 13 July 2015 sically disordered domains of tropoelastin that are composed of repeats of the VPGXG pentapeptide Revised 18 August 2015 motif, where X is a ‘‘guest residue”. They undergo a reversible, thermally triggered lower critical Accepted 19 August 2015 solution temperature (LCST) phase transition, which has been utilized for a variety of applications Available online 29 August 2015 including protein purification, affinity capture, immunoassays, and drug delivery. ELPs have been Edited by Wilhelm Just extensively studied as protein polymers and as biomaterials, but their relationship to other disordered proteins has heretofore not been established. The biophysical properties of ELPs that lend them their unique material behavior are similar to the properties of many intrinsically Keywords: Elastin-like polypeptide disordered proteins (IDP). Their low sequence complexity, phase behavior, and elastic properties Intrinsically disordered protein make them an interesting ‘‘minimal” artificial IDP, and the study of ELPs can hence provide insights Phase transition into the behavior of other more complex IDPs. Motivated by this emerging realization of the Biopolymer similarities between ELPs and IDPs, this review discusses the biophysical properties of ELPs, their Tandem repeat biomedical utility, and their relationship to other disordered polypeptide sequences.
    [Show full text]
  • The Structure of Small Beta Barrels
    bioRxiv preprint doi: https://doi.org/10.1101/140376; this version posted May 22, 2017. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. The Structure of Small Beta Barrels Philippe Youkharibache*, Stella Veretnik1, Qingliang Li, Philip E. Bourne*1 National Center for Biotechnology Information, The National Library of Medicine, The National Institutes of Health, Bethesda Maryland 20894 USA. *To whom correspondence should be addressed at [email protected] and [email protected] 1 Current address: Department of Biomedical Engineering, The University of Virginia, Charlottesville VA 22908 USA. 1 bioRxiv preprint doi: https://doi.org/10.1101/140376; this version posted May 22, 2017. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. Abstract The small beta barrel is a protein structural domain, highly conserved throughout evolution and hence exhibits a broad diversity of functions. Here we undertake a comprehensive review of the structural features of this domain. We begin with what characterizes the structure and the variable nomenclature that has been used to describe it. We then go on to explore the anatomy of the structure and how functional diversity is achieved, including through establishing a variety of multimeric states, which, if misformed, contribute to disease states.
    [Show full text]
  • Dynamics in Folded and Unfolded Peptides and Proteins Measured by Triplet-Triplet Energy Transfer
    Fakultät für Chemie Lehrstuhl für Biophysikalische Chemie Dynamics in Folded and Unfolded Peptides and Proteins Measured by Triplet-Triplet Energy Transfer Natalie D. Merk Vollständiger Abdruck der von der Fakultät für Chemie der Technischen Universität München zur Erlangung des akademischen Grades eines Doktors der Naturwissenschaften genehmigten Dissertation. Vorsitzender: Univ.-Prof. Dr. Aymelt Itzen Prüfer der Dissertation: 1. Univ.-Prof. Dr. Thomas Kiefhaber (Martin-Luther-Universität Halle-Wittenberg) 2. Univ.-Prof. Dr. Michael Groll Die Dissertation würde am 09.02.2015 bei der Technischen Universität München eingereicht und durch die Fakultät für Chemie am 05.03.2015 angenommen. ii Content Introduction 1 1.1 Proteins 1 1.2 Protein folding 1 1.2.1 The unfolded state of proteins 2 1.2.2 The native state of proteins 5 1.2.3 Protein stability 6 1.2.4 Barriers in protein folding 7 1.2.5 The effect of friction on protein folding kinetics 10 1.3 Triplet-triplet energy transfer as suitable tool to study protein folding 12 1.3.1 Loop formation in polypeptide chains measured by TTET 14 1.4 Turns in peptides and proteins 19 1.4.1 The role of β-turns in protein folding 20 1.5 Carp β-parvalbumin as an appropriate model to study protein folding by TTET 23 1.5.1 Site-specific modification of proteins via incorporation of unnatural amino acids and click chemistry 25 Aim of Research 29 Material and Methods 33 3.1 Used materials 33 3.2 Solid-phase peptide synthesis (SPPS) 33 3.3 Peptide modification 34 3.3.1 Introduction of chromophores for triplet-triplet
    [Show full text]
  • Supplementary Materials: Understanding Insulin
    Supplementary Materials: Understanding Insulin Endocrinology in Decapod Crustacea: Molecular Modelling Characterization of an Insulin-Binding Protein and Insulin-Like Peptides in the Eastern Spiny Lobster, Sagmariasus verreauxi Figure S1: Modelling criteria for (a) Sv-IGFBP; (b) Cq-IGFBP_N’; (c) Sv-IAG; (d) Sv-ILP1; (e) Sv-ILP2. In Alpha helix (Hh) each case the trimmed modelled sequence is given 310 helix (Gg) (subscript numbering in brackets indicating the native Pi helix (Ii) amino acid position) with the following associated details Beta bridge (Bb) listed: (i) model templates; (ii) input sequence alignments; Extended strand (Ee) (iii) secondary structure predictions and resulting Beta turn (Tt) additional restraints (implemented due to deviation from Bend region (Ss) the chosen template), also shown in sequence in red bold; Random coil (Cc) and (iv) defined bonds and any additional refinement. Removed in refinement (strike) Key as shown, colouration as previously described. (a) Sv-IGFBP (21)1QDVVTECGECDRSNCPEVKTCLGGKVQDACGCCEVCALGLGQRCDSQDSGDSTDYGSCGEYLVCRTRTDTG GTDEATCVCENPDPVCGSDGITYSTLCHLLQETTEKPDVFVAVRGPCKGVPVIKSKPEDKIRPLGSILVLDCEAA GYPVPEITWELNRPDGSTMKLPGDDSSFAVQVRGGPEDHMVTGWVQIMRITKKSLGIYTCVATNTEGETRVSATV ALKEHGEKEDSMNKL236(256) (i) Model template selections Insulin-binding + kazal domains: HTRA1 (3TJQ_A) Immunoglobulin domain: Myosin light chain kinase (2CQV_A) (ii) Input sequence alignments Sv-IGFBP 1 QDVVTECG-ECDRSNCPEV-KTCLGGKVQDACGCCEVCALGLGQRCDSQDSGDSTDYGSCGEYLVCRTRT 68 3TJQ_A 13 FQGSAGCPDRCEPARCPPQPEHCEGGRARDACGCCEVCGAPEGAACGLQ-------EGPCGEGLQCVVPF
    [Show full text]
  • From Sequence to Structure
    1 From Sequence to Structure The genomics revolution is providing gene sequences in exponentially increasing numbers. Converting this sequence information into functional information for the gene products coded by these sequences is the challenge for post-genomic biology. The first step in this process will often be the interpretation of a protein sequence in terms of the three- dimensional structure into which it folds. This chapter summarizes the basic concepts that underlie the relationship between sequence and structure and provides an overview of the architecture of proteins. 1-0 Overview: Protein Function and Architecture 1-1 Amino Acids 1-2 Genes and Proteins 1-3 The Peptide Bond 1-4 Bonds that Stabilize Folded Proteins 1-5 Importance and Determinants of Secondary Structure 1-6 Properties of the Alpha Helix 1-7 Properties of the Beta Sheet 1-8 Prediction of Secondary Structure 1-9 Folding 1-10 Tertiary Structure 1-11 Membrane Protein Structure 1-12 Protein Stability: Weak Interactions and Flexibility 1-13 Protein Stability: Post-Translational Modifications 1-14 The Protein Domain 1-15 The Universe of Protein Structures 1-16 Protein Motifs 1-17 Alpha Domains and Beta Domains 1-18 Alpha/Beta, Alpha+Beta and Cross-Linked Domains 1-19 Quaternary Structure: General Principles 1-20 Quaternary Structure: Intermolecular Interfaces 1-21 Quaternary Structure: Geometry 1-22 Protein Flexibility 1-0 Overview: Protein Function and Architecture Binding TATA binding protein Myoglobin Specific recognition of other molecules is central to protein function. The molecule that is bound (the ligand) can be as small as the oxygen molecule that coordinates to the heme group of myoglobin, or as large as the specific DNA sequence (called the TATA box) that is bound—and distorted—by the TATA binding protein.
    [Show full text]