DOCSLIB.ORG

Celebrating 60 Years

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Celebrating 60 Years Celebrating 60 Years NEW TITLES SPRING 2020 Get in touch... +44 (0)1392 790650 [email protected] www.davidandcharles.com catalogue_jacket2020.indd 1 30/01/2020 14:41 CONTENTS Frontlist ..........................................04 Art ............................................06 Knit & Crochet .............................12 Cross Stitch ................................18 Quilting & Sewing ........................20 Other Craft .................................30 Assisted Publishing ...........................36 Recently Published ...........................38 Dover .............................................50 Backlist ..........................................56 How to get in touch ..........................86 www.davidandcharles.com Catalogue.indd 1 29/01/2020 14:01 Catalogue.indd 2 29/01/2020 14:01 Our Autumn 2019 catalogue was incredibly well received and we’re excited to follow that up with our new titles for Spring 2020. This Spring, we have a great balance of perennially successful subjects alongside books that feature new ideas and trends. Long-standing D&C authors, Pam and Nicky Lintott, bring us Jelly Roll Quilts: The Classic Collection and we make a return to bag making with The Complete Bag Making Masterclass. Books such as Crochet Hacking, Macraweave and Dried Flowers pick up on the latest trends, while Cross Stitch for the Soul celebrates the strong link between crafting and mindfulness. Cat Knits is a fantastic book for the many million cat-loving knitters out there and I reserve a special mention for Magical Woodland Knits, a truly exquisite book with incredible projects and brilliant photography. The list sees us building on our success in practical art. 3000 Colour Mixing Recipes is a cornerstone book for all watercolour artists and DIY Watercolor Jungle is a follow up to our brilliantly successful 2019 book, DIY Watercolor Flowers. We’ve been overwhelmed by the support and encouragement for new David and Charles. Thank you to our authors, distributors, agents and all our business partners for your good wishes and enthusiasm for our new company. We’re all extremely proud of this Spring 2020 list and we look forward to working with you across all of the sales and marketing opportunities it presents. Thank you for your interest. James Woollam Managing Director Catalogue.indd 3 29/01/2020 14:01 Catalogue.indd 4 29/01/2020 14:01 FRONTLIST Catalogue.indd 5 29/01/2020 14:01 3000 COLOR MIXING RECIPES: WATERCOLOR 3000 COLOR MIXING RECIPES: WATERCOLOR Julie Collins A practical and inspirational manual that shows you a huge range of color mixes in watercolor. The aim of the book is to encourage you to get to know colors well and be motivated to explore and experiment with color. Use the book as a handy reference when you want to know how to mix a speciȴc color, or as a catalog of inspiration when seeking ideas to try in your work. The handy color viewing card included can be used to view each color swatch in isolation. This will help sharpen your perception of the color or allow you to pinpoint a speciȴc shade to use in your own work. How to use this book Please refer to How to Use This Book: 8LIVIEVIX[SWIGXMSRWSJGSPSVW[EXGLIWJSV]SYXSI\TPSVI'SPSV1M\MRK Color Mixing Recipes. Recipes, for color mixes made using two colors; and Diluting Colors, which explores tonal range by diluting a single color, either with water or with white Cadmium red madder Brown 0MKLXVIH TEMRXWTIGM½GEPP]XLIWIQMSTEUYI'LMRIWI[LMXI;MRWSV 2I[XSR´W QSWXTSTYPEV[LMXITEMRX8LIGSPSVWXVMTWHS[RXLIIHKISJIEGLPIJXLERH page are an approximate match to the mixes or dilutions on that spread, and [MPPLIPT]SYXSREZMKEXIUYMGOP]XS½RHXLIGSPSVW]SYEVIPSSOMRKJSVJVSQ yellow, red, blue and green through to browns, blacks and grays. Yellow ochre Yellow Color Mixing Recipes 8LIGSPSVQM\IWEVIQEHIYWMRKX[SGSPSVWEFEWIGSPSVWLS[RMREWUYEVIEXXLIPIJXLERHIHKI SJXLIWTVIEH % ERHEQM\MRKGSPSVWLS[RMREWUYEVIMRXLIVS[EXXLIXSTSJXLIWTVIEH & '30361-<-2+6)'-4)7 From these two colors, four mixes are made, using the colors in four different ratios (C). In mix 1, GSPSV&MWEHHIHXSGSPSV%EXEVEXMSSJ SJGSPSV& 1M\IWERHLEZIMRGVIEWMRKP] higher ratios of color B. Gold ochre A B C 1 2 3 4 Quinacridone KSPH )%68,=)003;78-4 When choosing your yellows, consider their opacity and transparency, as well as their color; for example, Raw WMIRREMWXVERWTEVIRX[LIVIEW=IPPS[SGLVIMWWIQMSTEUYI and Gold ochre semitransparent. See the difference when 6E[WMIRREMWQM\IH[MXL2ETPIW]IPPS[ERSTEUYIGSPSV Remember that your yellow will only look bright when 6E[WMIRRE =IPPS[SGLVI +SPHSGLVI 6E[WMIRREERH painted on top of pure white paper – any color underneath 2ETPIW]IPPS[ will affect your yellow. D 1 2 3 4 A 8LIFEWIGSPSVYWIHJSVXLIQM\IW B 8LIGSPSVEHHIHXSXLIFEWIGSPSV 1:4 1:2 3:4 1:1 C *SYVQM\IW WIIFS\IW¯JSVVEXMSW (25%) (50%) (75%) (100%) D Some pages include color tips with additional information 6 3000 COLOR MIXING RECIPES: WATERCOLOR Julie Collins Publication Date: May-20 | 9781446308196 | £9.99 | $12.99 210 mm x 148 mm | 144 pages | 6500 words Sales Rights: World 6 www.davidandcharles.com Catalogue.indd 6 29/01/2020 14:01 Warm Cool red Warm Cool blue red blue Warm and cool colors When you are learning about color mixing, a basic set of primary colors – Cadmium Winsor Winsor blue Winsor blue red, blue and yellow – is a good starting point (see About Color and Color VIH VIH red shade KVIIRWLEHI 1M\MRK 9WMRKNYWXXLVIIGSPSVWEWXLIFEWIJSVEPP]SYVGSPSVQM\IWMWZIV] useful for understanding how colors work, both separately and when mixed. With such a small range, you get to know the paints and the color mixes they create very intimately. Another aspect of color mixing that you can go on to explore is that of warm and cool colors. Quinacridone Opera French Cerulean In your painting, you will notice that warm colors tend to stand out and therefore come to the VIH VSWI YPXVEQEVMRI FPYI forefront of a picture, whereas cool colors tend to recede and look as if they are in the distance or background. By using warm and cool colors cleverly you can create a feeling of space in your pictures. We tend to think in broad categories, describing all reds as warm and all blues as cool, for example. Exploring with color mixes will help you develop a more sophisticated appreciation for GSPSV]SY[MPPWIIXLEXWSQIVIHWEVIMRJEGXGSSPERHWSQIFPYIWEVI[EVQ Scarlet Permanent Cerulean blue Indanthrene 8LIGLEVXSTTSWMXII\TPSVIWXLIMHIESJ[EVQERHGSSPVIHWERHFPYIWMRQSVIHIXEMP=SY[MPP PEOI VSWI VIHWLEHI FPYI WIIJSVI\EQTPIXLEX4IVQERIRXEPM^EVMRGVMQWSRMWEGSSPVIHEWMXMWWPMKLXP]FPYI[LIVIEW 7GEVPIXPEOIMWELSXVIHEWMXMWJEMVP]SVERKI*VIRGLYPXVEQEVMRIMWE[EVQFPYI[LIVIEW 'IVYPIERFPYIMWEGSSPFPYI8LMWOMRHSJORS[PIHKI¯[LMGLGERFIGSQIMRWXMRGXMZIEJXIV a while – is best learned through experimenting for yourself, using the mixes in this book as guidance. Cadmium Permanent Cobalt Phthalo WGEVPIX alizarin FPYI XYVUYSMWI GVMQWSR 11 Please refer to How to Use This Book: Color Mixing Recipes. Antwerp blue Antwerp blue Cerulean blue VIHWLEHI 1ERKERIWI FPYILYI Indanthrene FPYI '30361-<-2+6)'-4)7 French ultramarine Ultramarine green shade 667 Cobalt blue Cobalt blue Cobalt blue Cobalt blue HIIT 71 Catalogue.indd 7 29/01/2020 14:01 DIY WATERCOLOR JUNGLE DIY WATERCOLOR JUNGLE Marie Boudon Learn to paint tropical watercolor ȵowers and foliage in simple steps with this free and easy approach to watercolor painting for beginners. Marie Boudon’s beautifully presented creative course will get you started in this expressive and fun medium. Find out about the essential materials you need, learn about color mixing for an on-trend jungle palette, get expert tips on transparency, overlays and negative space, discover ideas for compositions and then work step- by-step through over 20 tutorials for jungle plants and ȵowers. From palm trees, monstera leaves and other jungle foliage, you’ll ȴnd easy exercises and inspiring ideas for jungle-themed art. Be inspired by Marie’s gorgeous ideas for presenting the ȴnished work as art pieces, journal pages, handmade stationery. ExerciSe 3 1 EXPERIMENTING with Start in the same way as for exercise 2, with three similarly colored circles. Once everything has dried, instead of applying a uniform color, add a layer as a graduated wash over the second circle, using dark green and water (see page 29). For the third circle, add several overlays colors using the wet-in-wet technique. THis LAYERING TECHNIQUE IS SIMILAR TO THE ONE FOR TRANSPARENCY. YOU’re going to PAINT SEVERAL LAYERS ON TOP OF EACH OTHER TO Start by doing a light sketch using a drawing pencil or watercolor pencil. Use the GET DIFFERENT EFFECTS THAT WILL ENHANCE YOUR CREATION. suggestion above to help you (deliberately accentuated). Remember that the leaves are rounded but not perfectly, and are often slightly pointed at the bottom. The stalk is attached not to the middle but more to the top of the leaf. The stalks fan out around ExerciSe 4 the main stem. For leaves pointing backwards, paint them as a sausage shape. Exercise 1 A second layer can allow you to add details. This is a technique I use very frequently. The pictures below show a simple banana leaf (one layer) and a more detailed leaf (two Select a color and paint a shape; I opted for an oval. Leave it to layers). The second layer also intensifies the color. dry, using a blow-dryer to speed things up. Add a layer of the same 2 color with virtually the same pigment concentration. Repeat this process four or five times. You will then realize the color density you can obtain through layering. THE MAIN COLORS 1 layer 3 layers 5 layers Exercise 2
Load more

Recommended publications
  • Knitting 4D Garments with Elasticity Controlled for Body Motion
    Knitting 4D Garments with Elasticity Controlled for Body Motion ZISHUN LIU, Delft University of Technology, The Netherlands / Centre for Perceptual and Interactive Intelligence (CPII) Limited, Hong Kong, China XINGJIAN HAN, Boston University, USA YUCHEN ZHANG, Centre for Perceptual and Interactive Intelligence (CPII) Limited, Hong Kong, China XIANGJIA CHEN, Centre for Perceptual and Interactive Intelligence (CPII) Limited, Hong Kong, China YU-KUN LAI, Cardiff University, United Kingdom EUGENI L. DOUBROVSKI, Delft University of Technology, The Netherlands EMILY WHITING, Boston University, USA CHARLIE C. L. WANG, The University of Manchester, United Kingdom (a) (b) (c) max 0.0 Fig. 1. During the body motion of swinging arms, a perfect-fit 3D garment can have: (a) large stress when using firm materials – leading to uncomfortable pressure or (b) large sliding when using soft materials – resulting in unwanted wrinkles. Both factors are considered in an integrated way onaknitwear with optimized distribution of elasticity as a 4D garment (c) that minimizes the stress and controls the maximal sliding during body motion. Stresses and displacements are visualized as color maps and black arrows respectively, where the maximal stress is 40.75kPa. Our work enables a computational framework for designing 4D garments and automatically fabricating them on digital knitting machines. A knitwear as 4D garment is physically fabricated byknitting different ‘percentages’ of firm and soft yarns in different regions. We make the regions of different elasticity visible by using firm yarns in light-blueandsoft yarns in white. Sliding trajectories on physical specimens are evaluated by a vision-based method and displayed as black curves. In this paper, we present a new computational pipeline for designing and for a garment by physics-based computation, the optimized elasticity on the fabricating 4D garments as knitwear that considers comfort during body garment is then converted into instructions for a digital knitting machine by movement.
    [Show full text]
  • Wool Wind Or Intarsia
    WOOLWIND/INTARSIA This technique is used to knit blocks of different colours, avoiding the extra bulk of Fair Isle knitting. When using this method, you will need a separate ball for each section of colour. The colour twist method involves twisting the different coloured yarns over each other to prevent holes. Twist the colour to be used underneath and to the right of the colour just used. Always change colours on the wrong side of the work so colour change does not show on right side. CASTINGCASTING ON A ONSEAM A SEAM STITCH STITCH CASTING ON A SEAM ST When casting on a seam st, do not inc by knitting into front and back of stitch. Make a loop with yarn as shown and slip onto left hand needle as indicated by arrows, pulling up stitch firmly, then work as first stitch of next row. KNITTING UP STITCHES 1 2 3 4 Insert needle through One stitch knitted up. Repeat step 1 as many All stitches knitted up fabric one whole stitch times as required, ready to begin 1st row in from the edge, wrap spacing the number of or round. yarn around needle (as stitches evenly along the for knitting) and draw piece of knitting. through fabric. FRINGES Wind yarn round a piece of cardboard of required width and cut along one edge. With right side facing, using crochet hook and two or more strands of yarn (diagrams show three strands), fold yarn in half and draw loop through a stitch on item (diagrams A and B), draw ends through this loop (diagram C) and pull tightly to form knot.
    [Show full text]
  • KNITTING Definition Statement Relationship Between Large Subject
    D04B KNITTING Definition statement This subclass/group covers: weft knitting machines are covered by D04B 7/00 to D04B 13/00, details of, or auxiliary devices incorporated in such machines are covered by D04B 15/00 and articles made by such machines are covered by D04B 1/00 warp knitting machines are covered by D04B 23/00 to D04B 25/00, details of, or auxiliary devices incorporated in such machines are covered by D04B 27/00 and articles made by such machines are covered by D04B 21/00 details of, or auxiliary devices incorporated in knitting machines not limited to a specific kind of knitting machine are covered by D04B 35/00 miscellaneous knitting machines and articles made by such machines are covered by D04B 39/00 hand knitting equipment is covered by D04B 3/00, D04B 5/00 and D04B 33/00 auxiliary apparatuses or devices for use with knitting machines are covered by D04B 37/00 or for hand knitting equipment are covered by D04B 17/00, D04B 19/00 and D04B 31/00 Relationship between large subject matter areas The difference between the subclass D04B and B32B5 is as follows:layered products including knitted products as such should be classified in B32B5 only; layered products formed by a knitting process featuring specified patterns or information on the composition of the knit article should be classified in D04B. Note that such products may comprise additional coated faces. References relevant to classification in this subclass This subclass/group does not cover: Layered products (i.e. laminates) B32B 5/00 including knitted articles 1 Knitted products of unspecified A41A61F structure or composition, e.g.
    [Show full text]
  • 2-Day Pre-Festival Workshops Spinning 101: Learn to Spin Or Refresh Your Skills with Maggie Casey Wednesday and Thursday, May 4 & 5, 9 A.M
    2-Day Pre-Festival Workshops Spinning 101: Learn to Spin or Refresh Your Skills with Maggie Casey Wednesday and Thursday, May 4 & 5, 9 a.m. - 4 p.m., Howard County Farm Heritage Museum (across from the Howard County Fairgrounds) Spider Woman taught the Navajo to spin with spindles of lightning and turquoise. Gandhi encouraged the people of India to spin every day for meditation and economic freedom. Rumpelstiltskin spun straw into gold and Sleeping Beauty pricked her finger on her spindle and fell into a deep sleep. History and fable are full of tales of spinning and its effect on the people who do it. If you have always wanted to spin, have taught yourself a little, or haven’t spun for a while, this workshop will be just what you need to gain confidence and skill. We will start with a beautiful fleece, learn to card, spin, ply and set the twist. Then we will spin woolen and worsted yarns, some commercially prepared fibers and discuss wheel maintenance. Spinning straw into gold may be beyond our reach, but beautiful yarn is not! Skill level: Beginner. Students should bring: Working spinning wheel and all its parts, lazy kate and at least 3 bobbins, wool hand cards. JC01 Class fee: $200. Materials fee: $20. Fiber Preparation with Robin Russo Wednesday and Thursday, May 4 & 5, 9 a.m. - 4 p.m., Bingo Hall Well prepared fibers spin easily into beautiful yarns. This class covers both drum-carding and combing of fine, medium and coarse wools; color blending; luxury fiber preparation, and separation of guard hair from undercoat.
    [Show full text]
  • Saturday, November 17
    Saturday, November 17 FLAWLESS FINISHING (minimal homework) 10 a.m. to noon Learn to professionally assemble your knitwear. In this class, you will use your prepared swatches to learn Keith's tricks behind five different seams. We will also learn the correct way to pick up stitches across both the top and sides of our knitting. Be amazed as the magic unfolds and walk away with the proficient skills to finish your knitwear professionally for years to come. Skills covered include joining horizontal color stripes, lining up seams, joining raglan seams, proper sweater decreasing, sleeve increases, picking up stitches around a neckline, and weaving in tails. Materials needed: Darning needle, scissors, 2 colors of worsted weight yarn, size 7 or 8 straight or circular knitting needles, scrap paper, pen. HOMEWORK: Swatch 1: (Please make two) With a light colored worsted weight yarn and US # 7 or 8 knitting needle, cast on 14 stitches and work in garter stitch (knit every row) for 4 inches. Bind off all stitches. Swatch 2: (Please make 2) With a light coloredworsted weight yarn and US #7 or #8 knitting needle, cast on 16 stitches and work in stockinet stitch (Row 1: Knit, Row 2: Purl) for 4 inches. Bind off all stitches. FIXING MISTAKES WITH KEITH, THE PERFECTIONIST! 1 to 3 p.m. Have you ever taken that large “GASP” while ripping your knitting? Have no fear! this class we will first purposely make mistakes. By doing so, we can see how mistakes are created and then deconstruct our knitting to resolve all problems! Learn different ways to rip back your knitting, add lifelines, recognize twisted stitches, pick up dropped stitches in multiple stitch patterns including stockinette stitch, seed stitch, garter stitch and lace.
    [Show full text]
  • Stripes and Dots
    Stripes and Dots By Allison Griffith Finished Measurements 19” around x 6” tall (approximate) Notions Yarn Stitch Holders Knit Picks Wool of the Andes Sport (100% Stitch Marker Peruvian Highland Wool, 137 yards) MC: Mink Scissors Heather, C1: White, C2: Bramble Heather, C3: Yarn needle Hollyberry, C4: Caution, C5: Saffron, C6: Thirst Heather, less than 1 ball each. Gauge 24 sts and 30 rows=4” in color work pattern Needles US 4 DPNs and 16” circular needles Worked flat from the bottom up, this pattern begins with a small amount of ribbing. After increasing to the full stitch count, stripes (including Fair Isle dots) are worked for the body, while intarsia techniques are used to work a neat contrasting edge on either side (to create the opening for the handle). The opening for a spout is worked in a similar fashion to the thumb on a mitten, holding some stitches in reserve to be picked up later. Once the body of the tea cozy is completed, the top is worked in the Stripes and Dots ©On the Needles 2016 round, decreasing in the same manner as a basic hat. The stitches held for the spout are then picked up and worked in a simple ribbing to create a cuff. The bottom of the handle opening is sewn up before blocking and the addition of a pompom. Directions Body With circular needle and MC, CO 106. Work back and forth. Row 1: P2 (K2, P2) across. Row 2: K2 (P2, K2) across. Repeat rows 1 and 2 until 5 rows have been completed.
    [Show full text]
  • Sensor-Based Garments That Enable the Use of Bioimpedance Technology: Towards Personalized Healthcare Monitoring
    Sensor-Based Garments that Enable the Use of Bioimpedance Technology: Towards Personalized Healthcare Monitoring. JUAN CARLOS MÁRQUEZ RUIZ Doctoral Thesis Stockholm, Sweden, January 2013 ISSN 1653-3836 TRITA-STH Report 2012:6 ISRN/KTH/STH /2012:6-SE ISBN 978-91-7501-603-0 School of Engineering, University of Borås & School of Technology and Health, KTH Borås Stockholm Sweden Sweden ©Juan Carlos Márquez Ruiz, January 2013 ii ABSTRACT Functional garments for physiological sensing purposes have been utilized in several disciplines i.e. sports, firefighting, military and medical. In most of the cases textile electrodes (Textrodes) embedded in the garment are employed to monitor vital signs and other physiological measurements. Electrical Bioimpedance (EBI) is a non-invasive and effective technology that can be used for detection and supervision of different health conditions. In some specific applications such as body composition assessment EBIS has shown encouraging results proving good degree of effectiveness and reliability. In a similar way Impedance Cardiography (ICG) is another modality of EBI primarily concerned with the determination of Stroke Volume SV, indices of contractility, and other aspects of hemodynamics. EBI technology in the previously mentioned modalities can benefit from a integration with a garment; however, a successful implementation of EBI technology depends on the good performance of textile electrodes. The main weakness of Textrodes is a deficient skin-electrode interface which produces a high degree of sensitivity to signal disturbances. This sensitivity can be reduced with a suitable selection of the electrode material and an intelligent and ergonomic garment design that ensures an effective skin-electrode contact area.
    [Show full text]
  • Optional Short Row Shaping for Flax and Flax Light
    optional short row shaping for Flax and Flax Light a little fit adjustment ♥ by Tin Can Knits Learn to knit with Alexa and Emily! The Flax and Flax Light sweaters are part of The Simple Collection, a learn to knit series with excellent free patterns and clear tutorials. From your first scarf, to mittens, socks, and sweaters, learn everything you need to know to make modern seamless knits for all of your loved ones. Check out the whole collection here. This PDF is designed for use alongside the Flax and Flax Light patterns. To get these free sweater patterns click here. what are short rows? where will these short rows go?: Short rows are rows that don’t go all the way to the For the Flax and Flax Light sweaters the instructions end of the round or row; they stop short. Working a below place the short rows at the bottom of the yoke, series of these short rows creates a wedge of fabric. just before splitting for body and sleeves. All of the Here, this extra wedge of fabric is located at the back raglan increases have been completed and you will of the sweater. The result is that the back neck of the have worked even until the yoke has reached full sweater sits higher than the front. depth. You will have just completed a round 2. should I add short rows to my Flax or Flax Light sweater? The answer is: it’s totally optional! Emily and Eric are wearing their Flax sweaters without short rows, Francine is wearing hers with short rows.
    [Show full text]
  • Free Knitting Pattern Lion Brandоаwooleaseоаthick & Quick
    Free Knitting Pattern Lion Brand® Wool­Ease® Thick & Quick® Simple Stylish Top Pattern Number: L30220 This simple vest is a lot more detailed than you think with the short row collar and bobbled trim. Free Knitting Pattern from Lion Brand Yarn Lion Brand® Wool­Ease® Thick & Quick® Simple Stylish Top Pattern Number: L30220 SKILL LEVEL: Experienced (Level 5) SIZE: XS, Small, Medium, Large, 1X, 2X, 3X Finished Measurement at Lower Edge 32 (36, 40, 44, 48, 52, 56) in. (81.5 (91.5, 101.5, 112, 122, 132, 142) cm) Finished Back Length 21 (21 1/2, 22 1/2, 23 1/2, 24 1/2, 25, 25 1/2) in. (53.5 (54.5, 57, 59.5, 62, 63.5, 65) cm) Note: Pattern is written for smallest size with changes for larger sizes in parentheses. When only one number is given, it applies to all sizes. To follow pattern more easily, circle all numbers pertaining to your size before beginning. CORRECTIONS: None as of Oct 4, 2016. To check for later updates, click here. MATERIALS • 640­402 Lion Brand Wool­ Ease Thick & Quick Yarn: Wheat 5 6, 6, 7, 8, 9, 9 Balls • Lion Brand Knitting *Wool­Ease Thick & Quick (Article #640). Solids, Heathers, Twists, Prints, Stripes: 80% Acrylic, 20% Needles­ Size 13 [9 mm] Wool; • Lion Brand Crochet Hook ­ for Wheat & Wood: 86% Acrylic; 10% Wool; 4% Rayon; Size E­4 (3.5 mm) buttonloop Oatmeal & Barley & Grey Marble: 82% Acrylic; 10% Wool; 8% Rayon; • Lion Brand Split Ring Stitch Metallics: 79% Acrylic, 20% Wool, 1% Metallic Poly; Markers package size: Solids, Heathers, Twists, Tweeds: 6 • Lion Brand Large­Eye Blunt oz./170g (106 yd/97 m) Prints, Stripes: 5 oz./140g (87 yd/80 m) Needles (Set of 6) Metallics: 5 oz./140g (92 yd/84 m) • Additional Materials Circular knitting needle size 11 (8 mm), 40 in.
    [Show full text]
  • Fitted & Fabulous Issue Tkga
    CAST ONTHE EDUCATIONAL FITTED & JOURNAL FOR KNITTERS WWW.TKGA.COM FABULOUS FEB–APRIL 2015 HAPPY ISSUE ANNIVERSARY STITCHES TKGA MADE SIMPLE 18 KNITS FOR SPRING 2015 MICHELLE TKGA HUNTER Conference SHARES SAN DIEGO HER CALLING! KNITTING HERO ANNIVERSARY CAPE CELEBRATE 30 YEARS IN STYLE! NO. 8 Deutschland 4,90 € · BeNeLux 5,90 € · Italien 5,50 € www.lanagrossa.de Österreich 5,40 € · Schweiz CHF 7.50 AUSGABE 49 Deutschland € 7,- · Österreich € 7,50 · Schweiz CHF 10,- www.lanagrossa.de LOOKBOOK SPRING/SUMMER 2O15 Modern Luxury! Trend-Looks, für jede Gelegenheit! Die Fashionmission 50008 Summer Green-Glamour Die schönsten Looks und Trends. Von puristisch bis glamourös. Von lässig bis elegant. Modern im Design und nachhaltig im Material! Darks 4 191635 304901 Zeitlos. Modern. Edel. Linea Pura, a luxury and pure ber division of Lana Grossa continues to bring us new yarns and beautiful pat- NATURAL SELECTION! terns to complement each ber. Cot- tons, Linens, Wools and more....all pure The Lana Grossa “Filati” book is the luxury bers and “pure-glamour.” knitting fashion journal from one of the oldest and most well established knit- Designs from sweater sets to shells, ting companies in the world. This is the T-shirts, Tops, Cardigans and Accesso- The newest publication from Lana rst book available in U.S.A. in over ries. Fashions for Men and Woman. Grossa is “The Lookbook.” Direct from 3 years. The patterns are all in English the fashion runway showing all of the featuring the most current Lana Grossa Linea Pura Book #8 $15.00 newest garments in the newest collec- yarns for Spring/Summer.
    [Show full text]
  • Intarsia in the Round – 3 Ways
    Sand and Sea Guild March 2018 – program by Jill Borders Knitting Intarsia in the Round – 3 ways 1. “festive knitting” or Armenian Knitting The first way to knit an intarsia motif in the round… is to not use intarsia! Carry your contrasting yarn around the circumference of your knitting, capturing the long float at regular intervals. You will get some color blips showing through the fabric and there is the risk of pulling your carrying yarn too tightly along the back and causing the fabric to pull in or pucker. Knitting Daily video: https://www.youtube.com/watch?v=C3mWoHIVVlo See also Meg Swansen and Mary Thomas 2. Short rows method of Intarsia in the Round The most common version of intarsia in the round, is to continue to work flat, but use short row techniques to connect the rows into a tube. You will still need to work back and forth. There will be a visible turning “seam”, but otherwise straight-forward. Intarsia in the Round video by Julia Farwell-Clay: https://www.youtube.com/watch?v=v2Iu8fkoBuc Another: http://www.oharethey.com/blog/intarsia-in-the-round-techniques You can do a similar technique for garter stitch in the round with no purling: https://www.youtube.com/watch?v=45p2jKYUmlc 3. The Most Seamless TeChnique (but most Confusing!) This way of knitting in the round, still involves purling on the back side, but the seam is at the edge of a color block and is practically invisible. The method can be confusing at first and your yarn can get tangled with mistakes, but the final result is the best.
    [Show full text]
  • Improvisational Knitting Cannot Anticipatewhatwillhappennext
    Improvisational Knitting: A Tutorial My love for color, short rows, and log cabin construction coupled with my fascination with the quilts of Gee’s Bend and Nancy Crow have inspired my improvisational knitting. Curiosity and a sense of humor are the only prerequisites for learning this style of knitting. Once you understand — and are comfortable — with the techniques please abandon my instructions and let your own creativity take over. Working improvisationally is liberating and exhilarating, as you cannot anticipate what will happen next. Improvisational Knitting Improvisational © nonaKnits • All Rights Reserved • nonaknits.typepad.com Improvisational Knitting: Basic Techniques Improvisational knitting is based on several techniques: garter stitch, short rows, log cabin construction, and intarsia. Garter Stitch: Garter stitch creates a proportionally square fabric; a fabric in which the same number of stitches and rows are required to fill an inch. Creating a proportionally square fabric is critical since we will be knitting in all directions. Short Rows: Short rows allow you to turn — often arbitrarily — in the middle of a row and to knit wonky, non-rectangular shapes. Although there are several ways to work a short row, I prefer the YO short row for improvisational knitting since it is quick and easy to work. To work a YO short row: • When you reach a turning point: turn, YO, and begin knitting. The YO is easy to work. After you turn the yarn will be in front, move the yarn to the back OVER the right needle as you begin to knit the next stitch. • At some later point, you’ll encounter the YO and the gap created when you previously turned.
    [Show full text]