Celebrating 60 Years
NEW TITLES SPRING 2020
Get in touch...
+44 (0)1392 790650 [email protected] www.davidandcharles.com
catalogue_jacket2020.indd 1 30/01/2020 14:41 CONTENTS
Frontlist ...... 04
Art ...... 06
Knit & Crochet ...... 12
Cross Stitch ...... 18
Quilting & Sewing ...... 20
Other Craft ...... 30
Assisted Publishing ...... 36
Recently Published ...... 38
Dover ...... 50
Backlist ...... 56
How to get in touch ...... 86
www.davidandcharles.com
Catalogue.indd 1 29/01/2020 14:01 Catalogue.indd 2 29/01/2020 14:01 Our Autumn 2019 catalogue was incredibly well received and we’re excited to follow that up with our new titles for Spring 2020.
This Spring, we have a great balance of perennially successful subjects alongside books that feature new ideas and trends. Long-standing D&C authors, Pam and Nicky Lintott, bring us Jelly Roll Quilts: The Classic Collection and we make a return to bag making with The Complete Bag Making Masterclass. Books such as Crochet Hacking, Macraweave and Dried Flowers pick up on the latest trends, while Cross Stitch for the Soul celebrates the strong link between crafting and mindfulness. Cat Knits is a fantastic book for the many million cat-loving knitters out there and I reserve a special mention for Magical Woodland Knits, a truly exquisite book with incredible projects and brilliant photography.
The list sees us building on our success in practical art. 3000 Colour Mixing Recipes is a cornerstone book for all watercolour artists and DIY Watercolor Jungle is a follow up to our brilliantly successful 2019 book, DIY Watercolor Flowers.
We’ve been overwhelmed by the support and encouragement for new David and Charles. Thank you to our authors, distributors, agents and all our business partners for your good wishes and enthusiasm for our new company. We’re all extremely proud of this Spring 2020 list and we look forward to working with you across all of the sales and marketing opportunities it presents.
Thank you for your interest.
James Woollam Managing Director
Catalogue.indd 3 29/01/2020 14:01 Catalogue.indd 4 29/01/2020 14:01 FRONTLIST
Catalogue.indd 5 29/01/2020 14:01 3000 COLOR MIXING RECIPES: WATERCOLOR
3000 COLOR MIXING RECIPES: WATERCOLOR Julie Collins
A practical and inspirational manual that shows you a huge range of color mixes in watercolor. The aim of the book is to encourage you to get to know colors well and be motivated to explore and experiment with color. Use the book as a handy reference when you want to know how to mix a speciȴc color, or as a catalog of inspiration when seeking ideas to try in your work. The handy color viewing card included can be used to view each color swatch in isolation. This will help sharpen your perception of the color or allow you to pinpoint a speciȴc shade to use in your own work.
How to use this book
Please refer to How to Use This Book: 8LIVIEVIX[SWIGXMSRWSJGSPSVW[EXGLIWJSV]SYXSI\TPSVI'SPSV1M\MRK Color Mixing Recipes. Recipes, for color mixes made using two colors; and Diluting Colors, which explores tonal range by diluting a single color, either with water or with white Cadmium red madder Brown 0MKLXVIH TEMRXWTIGM½GEPP]XLIWIQMSTEUYI'LMRIWI[LMXI;MRWSV 2I[XSR´W QSWXTSTYPEV[LMXITEMRX8LIGSPSVWXVMTWHS[RXLIIHKISJIEGLPIJXLERH page are an approximate match to the mixes or dilutions on that spread, and [MPPLIPT]SYXSREZMKEXIUYMGOP]XS½RHXLIGSPSVW]SYEVIPSSOMRKJSVJVSQ yellow, red, blue and green through to browns, blacks and grays. Yellow ochre Yellow Color Mixing Recipes 8LIGSPSVQM\IWEVIQEHIYWMRKX[SGSPSVWEFEWIGSPSVWLS[RMREWUYEVIEXXLIPIJXLERHIHKI SJXLIWTVIEH % ERHEQM\MRKGSPSVWLS[RMREWUYEVIMRXLIVS[EXXLIXSTSJXLIWTVIEH &
'30361-<-2+6)'-4)7 From these two colors, four mixes are made, using the colors in four different ratios (C). In mix 1, GSPSV&MWEHHIHXSGSPSV%EXEVEXMSSJ SJGSPSV& 1M\IWERHLEZIMRGVIEWMRKP] higher ratios of color B.
Gold ochre A B C 1 2 3 4 Quinacridone KSPH
)%68,=)003;78-4 When choosing your yellows, consider their opacity and transparency, as well as their color; for example, Raw WMIRREMWXVERWTEVIRX[LIVIEW=IPPS[SGLVIMWWIQMSTEUYI and Gold ochre semitransparent. See the difference when 6E[WMIRREMWQM\IH[MXL2ETPIW]IPPS[ERSTEUYIGSPSV Remember that your yellow will only look bright when 6E[WMIRRE =IPPS[SGLVI +SPHSGLVI 6E[WMIRREERH painted on top of pure white paper – any color underneath 2ETPIW]IPPS[ will affect your yellow.
D 1 2 3 4 A 8LIFEWIGSPSVYWIHJSVXLIQM\IW B 8LIGSPSVEHHIHXSXLIFEWIGSPSV 1:4 1:2 3:4 1:1 C *SYVQM\IW WIIFS\IW¯JSVVEXMSW (25%) (50%) (75%) (100%) D Some pages include color tips with additional information 6
3000 COLOR MIXING RECIPES: WATERCOLOR Julie Collins Publication Date: May-20 | 9781446308196 | £9.99 | $12.99 210 mm x 148 mm | 144 pages | 6500 words Sales Rights: World
6 www.davidandcharles.com
Catalogue.indd 6 29/01/2020 14:01 Warm Cool red Warm Cool blue red blue Warm and cool colors
When you are learning about color mixing, a basic set of primary colors – Cadmium Winsor Winsor blue Winsor blue red, blue and yellow – is a good starting point (see About Color and Color VIH VIH red shade KVIIRWLEHI 1M\MRK 9WMRKNYWXXLVIIGSPSVWEWXLIFEWIJSVEPP]SYVGSPSVQM\IWMWZIV] useful for understanding how colors work, both separately and when mixed. With such a small range, you get to know the paints and the color mixes they create very intimately.
Another aspect of color mixing that you can go on to explore is that of warm and cool colors. Quinacridone Opera French Cerulean In your painting, you will notice that warm colors tend to stand out and therefore come to the VIH VSWI YPXVEQEVMRI FPYI forefront of a picture, whereas cool colors tend to recede and look as if they are in the distance or background. By using warm and cool colors cleverly you can create a feeling of space in your pictures.
We tend to think in broad categories, describing all reds as warm and all blues as cool, for example. Exploring with color mixes will help you develop a more sophisticated appreciation for GSPSV]SY[MPPWIIXLEXWSQIVIHWEVIMRJEGXGSSPERHWSQIFPYIWEVI[EVQ Scarlet Permanent Cerulean blue Indanthrene 8LIGLEVXSTTSWMXII\TPSVIWXLIMHIESJ[EVQERHGSSPVIHWERHFPYIWMRQSVIHIXEMP=SY[MPP PEOI VSWI VIHWLEHI FPYI WIIJSVI\EQTPIXLEX4IVQERIRXEPM^EVMRGVMQWSRMWEGSSPVIHEWMXMWWPMKLXP]FPYI[LIVIEW 7GEVPIXPEOIMWELSXVIHEWMXMWJEMVP]SVERKI*VIRGLYPXVEQEVMRIMWE[EVQFPYI[LIVIEW 'IVYPIERFPYIMWEGSSPFPYI8LMWOMRHSJORS[PIHKI¯[LMGLGERFIGSQIMRWXMRGXMZIEJXIV a while – is best learned through experimenting for yourself, using the mixes in this book as guidance.
Cadmium Permanent Cobalt Phthalo WGEVPIX alizarin FPYI XYVUYSMWI GVMQWSR
11
Please refer to How to Use This Book: Color Mixing Recipes. Antwerp blue Antwerp blue Cerulean blue VIHWLEHI 1ERKERIWI FPYILYI Indanthrene FPYI '30361-<-2+6)'-4)7 French ultramarine Ultramarine green shade 667 Cobalt blue Cobalt blue Cobalt blue Cobalt blue HIIT
71
Catalogue.indd 7 29/01/2020 14:01 DIY WATERCOLOR JUNGLE
DIY WATERCOLOR JUNGLE Marie Boudon
Learn to paint tropical watercolor ȵowers and foliage in simple steps with this free and easy approach to watercolor painting for beginners. Marie Boudon’s beautifully presented creative course will get you started in this expressive and fun medium. Find out about the essential materials you need, learn about color mixing for an on-trend jungle palette, get expert tips on transparency, overlays and negative space, discover ideas for compositions and then work step- by-step through over 20 tutorials for jungle plants and ȵowers. From palm trees, monstera leaves and other jungle foliage, you’ll ȴnd easy exercises and inspiring ideas for jungle-themed art. Be inspired by Marie’s gorgeous ideas for presenting the ȴnished work as art pieces, journal pages, handmade stationery.
ExerciSe 3 1 EXPERIMENTING with Start in the same way as for exercise 2, with three similarly colored circles. Once everything has dried, instead of applying a uniform color, add a layer as a graduated wash over the second circle, using dark green and water (see page 29). For the third circle, add several overlays colors using the wet-in-wet technique.
THis LAYERING TECHNIQUE IS SIMILAR TO THE ONE FOR TRANSPARENCY. YOU’re going to PAINT SEVERAL LAYERS ON TOP OF EACH OTHER TO Start by doing a light sketch using a drawing pencil or watercolor pencil. Use the GET DIFFERENT EFFECTS THAT WILL ENHANCE YOUR CREATION. suggestion above to help you (deliberately accentuated). Remember that the leaves are rounded but not perfectly, and are often slightly pointed at the bottom. The stalk is attached not to the middle but more to the top of the leaf. The stalks fan out around ExerciSe 4 the main stem. For leaves pointing backwards, paint them as a sausage shape. Exercise 1 A second layer can allow you to add details. This is a technique I use very frequently. The pictures below show a simple banana leaf (one layer) and a more detailed leaf (two Select a color and paint a shape; I opted for an oval. Leave it to layers). The second layer also intensifies the color. dry, using a blow-dryer to speed things up. Add a layer of the same 2 color with virtually the same pigment concentration. Repeat this process four or five times. You will then realize the color density you can obtain through layering.
THE MAIN COLORS 1 layer 3 layers 5 layers
Exercise 2 Once again, select a color and paint four similar circles. Once everything is completely dry, paint a different colored layer over each circle (here I used Rose Madder Lake, Orange and Green Yellow). Observe the interesting shades you can create using layering. Start by painting all the leaves in a light green solution. Feel free to vary the mix slightly to add interest. Wait for everything to dry properly (use a blow-dryer to speed up the process).
First layer Second layer
32 33 129
DIY WATERCOLOR JUNGLE Marie Boudon Publication Date: Apr-20 | 9781446308134 | £15.99 | $22.99 255 mm x 215 mm | 160 pages | 13000 words Sales Rights: World English Language
8 www.davidandcharles.com
Catalogue.indd 8 29/01/2020 14:01 Catalogue.indd 9 29/01/2020 14:01 WATERCOLOR WILD AND FREE
WATERCOLOR WILD AND FREE Natalia Skatula
Learn to paint cute animals and wildlife in this free-and-easy approach to watercolor. Artist Natalia Skatula has a beautiful, whimsical style that will charm readers through 12 simple step-by-step projects and over 100 worked examples. Beginning with an overview on materials and equipment, Natalia then covers the general techniques needed to achieve the paintings, along with her top-10 personal tips for success. Projects include a majestic whale, an adorable sloth, elephants, pandas, dogs, llamas, bears, foxes, rabbits and more, with a range of presentation ideas to inspire you to put your ȴnished work on display or gift it. The gallery of examples that follows includes plants, cats, beetles, birds, sea life, jungle creatures and fruits, giving you a treasure-trove of references for your painting
WATERCOLOR WILD AND FREE Natalia Skatula Publication Date: Aug-20 | 9781446308264 | £15.99 | $19.99 229 mm x 216mm | 128 pages | 10000 words Sales Rights: World English Language
10 www.davidandcharles.com
Catalogue.indd 10 29/01/2020 14:01 Catalogue.indd 11 29/01/2020 14:01 CROCHET HACKING
CROCHET HACKING Emma Friedlander-Collins
Breathe new life into unloved, unworn clothes with these incredible crochet hacks! From jazzing up a tired shirt with some colourful accents, to completely transforming unfashionable garments into on-trend items with crochet details, this unique book will make crocheters look at their wardrobe in a whole new light. Whether it’s repairing tears and holes or completely restyling a garment, these fun crochet ideas will keep unloved unworn garments out of landȴll and bring them back to life as your new wardrobe faves. With her unique approach and unusual designs, Emma Friedlander-Collins has established herself as an innovative crochet designer. She is passionate about sustainability and continually works to discover ways to use craft and making to create communities and inspire others.
CROCHET HACKING Emma Friedlander-Collins Publication Date: Jul-20 | 9781446308127 | £15.99 | $22.99 235 mm x 191 mm | 112 pages | 15000 words Sales Rights: World
12 www.davidandcharles.com
Catalogue.indd 12 29/01/2020 14:01 Catalogue.indd 13 29/01/2020 14:01 MAGICAL WOODLAND KNITS
MAGICAL WOODLAND KNITS Claire Garland
A magical collection of 12 knitting patterns for wonderfully lifelike animals and birds accompanied by the author’s sketches and studies of the natural world. Choose your favourite animal or bird whether it’s a squirrel, owl, badger, wolf, fox, rabbit and even a baby fawn. The patterns are cleverly designed with the same markings and colours as their real life counterparts, making them irresistible. The striking photography enhances ‘wildness’ of the animals and captures the magic of spotting a wild animal in their natural habitat.
ATTACHING THE SECONDARY WINGS
Make sure you have the correct wing for the side of body (i.e. left wing for owl’s left side, and right wing for owl’s right side). Working with one wing at a time: :LWK56RIZLQJIDFLQJXSßWWKHFDVWRQHGJHIURPZLQJWR the breast, halfway between the head cast-on edge and the start of the primary wing. Whip stitch to join along that cast-on edge. Follow the line where the wing naturally sits over the back (mantle). Whip stitch to join along the shaped row ends and short row ends to join inside edge of wing to mantle. Stop VWLWFKLQJDWWKHEHJLQQLQJRIWKHßUVWVWULSH Arrange the front edge of the wing so that it sits a little back from the edge of the primary wing. Whip stitch the row end onto the primary wing. Stop stitching at the beginning of the ßUVWVWULSH This seam will cause the wing to rise up a little. This is as intended.
FINISHING DETAILS FOR THE WINGS
When both wings have been sewn on, overlap the tips of the wings very slightly and whip stitch to join from the tips to the beginning of the last stripe.
Co mm on Pheasant TALONS If using wire legs, brush them with glue then wrap double lengths yarn FDURXQGDQGDURXQGWKHZLUHOHJVßQDOO\SXVK the wire legs (talons) into the body at the ‘knitted legs’ and {phasianus colchicus} whip stitch covered wire legs to knitted legs to secure in place. If you don’t want to use wire legs you can create yarn legs to tie over a branch. Work a running stitch around the cast-off edge of the legs and pull up to close the seam. Then with double lengths yarn F stitch each of four claws into the fastened off The mystery and myth surrounding the poor pheasant edge of each leg, to use to tie onto a branch do not bode that well. It appears it’s much maligned, BLACK DASHED FEATHER MARKINGS in fact in some accounts “The pheasant is a symbol With short lengths yarn I, work random duplicate stitches over of ill omen and is believed to turn into an oyster or one half a stitch here and there over the breast. It’s up to you a snake during the winter months” but then again, how many or how few to do, all owls are different. if it were to turn into an oyster then you may well 7KHRZOZLOOEHQHßWIURPFDUHIXOVFXOSWLQJ>VHH+RZWRXVHWKLV book] to enhance its shape. UHDSWKHUHZDUGVRIßQGLQJDSHDUORUWZR
Barn Owl | 89 40 | Common Pheasant
MAGICAL WOODLAND KNITS Claire Garland Publication Date: Apr-20 | 9781446308103 | £16.99 | $24.99 273 mm x 210 mm | 128 pages | 20000 words Sales Rights: World | Rights Sold: Russian
14 www.davidandcharles.com
Catalogue.indd 14 29/01/2020 14:01 Catalogue.indd 15 29/01/2020 14:01 CAT KNITS
CAT KNITS Marna Gilligan
The ultimate cat lover’s collection of knitting patterns for garments and accessories. If you love cats and yarn you will want this collection of 16 quirky designs all based around the theme of cats. It includes four garments graded for 16 dierent sizes, as well as cat-themed accessories including a wrap, shawl, scarf, cowl, capelet, mittens and hats. The patterns are divided up into four chapters, each with a dierent style of cat-themed design similar to Marna’s well- known ‘Sinister Catdigan’ pattern.
CAT KNITS Marna Gilligan Publication Date: Mar-20 | 9781446307540 | £16.99 | $24.99 273 mm x 210 mm | 128 pages | 20000 words Sales Rights: World
16 www.davidandcharles.com
Catalogue.indd 16 29/01/2020 14:02 Catalogue.indd 17 29/01/2020 14:02 CROSS STITCH FOR THE SOUL
CROSS STITCH FOR THE SOUL Emma Congdon
A collection of beautifully designed motivational and inspirational quotes rendered in easy cross-stitching techniques that will raise the spirits, both during the making process and beyond, as treasured pictures on the wall. Designed by leading cross stitch designer Emma Congdon, aka Stitchrovia, whose modern styling appeals to crafters of all ages and abilities, these inspiring quotes will provide comfort, motivation and an all-round positive spin on life, reminding us that we are brave, strong and have the power to make our own futures; one stitch at a time!
DMC Stranded cotton 60 50 40 30 20 10 100 Cross Stitch 818 976
166
561 90 3816
3733 352 3782 eing friendly, generous and 581 considerate towards others – it’s just 80 3813 kind. A good deed means you’re not 34 only helping someone in need, you’re also giving yourself a boost knowing Backstitch 976 that you’ve done something selfless. 166 70 It doesn’t matter how big or small the 561 gesture is, it’ll give you a wonderfully 34 B B rewarding feeling and put a spring in 3733 your step. 60
50 s 40 Info Shopping List Stitch count: 100 x 124 • 1 skein of each DMC Stitched size (on 14-count 30 stranded cotton (floss) Aida or 28-count linen): listed in the chart key 18.1 x 22.5cm (7 x 8 in) ⅛ ¾ • White Aida or linen, at least 24 x 39cm (9⅝ x 15¼in) 20 10 - 42 - Model stitched by Hayley Wellock - 14 -
CROSS STITCH FOR THE SOUL Emma Congdon Publication Date: Apr-20 | 9781446308080 | £16.99 | $24.99 273 mm x 210 mm | 112 pages | 5000 words Sales Rights: World
18 www.davidandcharles.com
Catalogue.indd 18 29/01/2020 14:02 Catalogue.indd 19 29/01/2020 14:02 JELLY ROLL QUILTS: THE CLASSIC COLLECTION
JELLY ROLL QUILTS: THE CLASSIC COLLECTION Pam Lintott|Nicky Lintott
A collection of 12 quilt patterns for classic quilts made using jelly rolls. Pam and Nicky bring their expertise to classic quilt designs with Jelly Roll Quilts: The Classic Collection. Learn how to make all your favourite quilts and blocks quickly and easily with this brand new collection of jelly roll quilt patterns. Jelly rolls are a fantastic short cut to patchwork and quilting: you can avoid (some) of the hours of cutting and preparation required for making a quilt and go straight to the fun bit, the sewing!
14 SORTING THE FABRICS MAKING THE QUILT 15 38
Choose thirty-four jelly roll strips for 1 Working with squares 7 Repeat with all remaining squares the quilt. These need to be darker and rectangles cut from and rectangles from the same jelly than your background fabric. The the same jelly roll strip, sew roll to make three quarter-blocks from 21 Continue to sew the blocks togetherFig 23to remaining six strips can be used for a a 1¹⁄2in x 2¹⁄2in background one jelly roll strip. form rows 1 to 4, referring to the diagram for scrappy binding if desired. rectangle to a 2¹⁄2in jelly roll placement. Pin at every seam intersection Setting square. Press in the direction to ensure a perfect match. Press away triangle Row 1 shown in the diagram. from block A so that your seams will nest together nicely when sewing the rows CUTTING INSTRUCTIONS together. Create row five using three Row 2 TIP block B and two block D with a setting triangle at both ends. If you are using different Referring to the diagram, Jelly roll strips background fabrics, you Corner Row 3 continue to sew rows six and triangle can choose how scrappy an Cut each of the thirty-four jelly roll seven using blocks B and effect you want to create. Row 4 strips into the following (and keep the D with setting triangles at We chose our background pieces together). both ends. Press away from rectangles randomly and 8 Repeat with all thirty-four jelly roll block B. ► Three 2¹⁄2in squares. tried not to have the same strips to make a total of one hundred fabrics next to each other. quarter-blocks. ► Three 2¹⁄2in x 3¹⁄2in rectangles.
► Three 2¹⁄2in x 5¹⁄2in rectangles. Sashing row 22 Sew the rows of the quilt Row 5 together, pinning at every seam Background fabric 2 Sew a 1¹⁄2in x 3¹⁄2in 9 Choose four quarter-blocks and intersection and inserting the extra background rectangle to the sew together as shown to create Cut fifty 1¹⁄2in strips across the width long sashing unit strip between rows right-hand side of the unit. one block, pinning at the seam of the fabric (or, if using nine long 4 and 5. Be prepared to reposition a Row 6 Press as shown. intersections to ensure a perfect quarters, cut each long quarter into six seam if necessary so they are pressed in match. Press the work. Repeat to 1¹⁄2in strips). You need fifty 1¹⁄2in strips in alternate directions when sewn together. make twenty-five blocks. total. Subcut each of the fifty strips as Lastly, sew the corner triangles in place. Row 7 follows. 3 Sew a 2¹⁄2in x 3¹⁄2in jelly ► Two 1¹⁄2in x 6¹⁄2in. roll rectangle to the unit as ► Two 1¹⁄2in x 5¹⁄2in. shown and press. ► Two 1¹⁄2in x 3¹⁄2in. ► Two 1¹⁄2in x 2¹⁄2in.
Binding fabric 4 Sew a 2¹⁄2in x 5¹⁄2in jelly QUILTING AND FINISHING roll rectangle to the unit as If you are not using the spare jelly shown and press. 23 Your quilt top is now complete. roll strips to make a scrappy binding, Make a quilt sandwich of the quilt cut seven 2¹⁄2in wide strips across the top, the wadding (batting) and the width of the binding fabric. backing. Quilt as desired and then bind to finish. 5 Sew a 1¹⁄2in x 5¹⁄2in background rectangle to the unit as shown and press.
6 Sew a 1¹⁄2in x 6¹⁄2in background rectangle to the unit as shown and press.
JELLY ROLL QUILTS: THE CLASSIC COLLECTION Pam Lintott|Nicky Lintott Publication Date: May-20 | 9781446308097 | £16.99 | $24.99 273 mm x 210 mm | 128 pages | 20000 words Sales Rights: World
See page 70 for more Pam and Nicky Lintott titles
20 www.davidandcharles.com
Catalogue.indd 20 29/01/2020 14:02 Catalogue.indd 21 29/01/2020 14:02 ANITA CATITA’S SEWN TOY TREASURES
ANITA CATITA’S SEWN TOY TREASURES Sandra Reis
Step into the world of Anita Catita and prepare to be charmed by the array of beautiful toy patterns to sew. Choose from gorgeous dolls, including rag dolls, ballerinas, pirates, kokeshi and fairies, and adorable animals including cats, rabbits, ducks, reindeer, bears and sheep. All the toys are made using easy sewing techniques and full-size pattern pieces are included. Featuring lovely styled photographs and beautiful fabric choices, reminiscent of early Tilda titles, this debut collection from Anita Catita is sure to make an impact on sewers
ANITA CATITA’S SEWN TOY TREASURES Sandra Reis Publication Date: Aug-20 | 9781446308288 | £12.99 | $16.99 273 mm x 210 mm | 80 pages | 12000 words Sales Rights: World English Language
22 www.davidandcharles.com
Catalogue.indd 22 29/01/2020 14:02 Catalogue.indd 23 29/01/2020 14:02 THE COMPLETE BAG MAKING MASTERCLASS
THE COMPLETE BAG MAKING MASTERCLASS Samantha Hussey
Bag pattern designer, Mrs H, has created a collection of the latest bag making techniques, based on her popular weekend retreats, to create the ultimate reference book. Due to developments in hardware bag making techniques have changed rapidly and Mrs H shows readers of all abilities how to sew quicker and better with her bag making masterclass. There are variations for each of the techniques so readers can choose the method that best suits their abilities and build their skills up to the more advanced techniques.
POCKETS / CORE SKILLS / 21 THE EXPLORER CARRY-ON / 123
SLIP POCKETS Place one rolled handle over the main body panel that 11has the passport pocket attached. Place the bottom raw edges on the bottom raw edge of the main body (G) and SIMPLE SLIP POCKET DIVIDED SLIP POCKET position them 9cm (31⁄2in.) from the centre mark. There should 2 be 18cm (7in.) between them; this will hide the raw edges of the A simple slip pocket is a great addition to any bag. You can To make a divided slip pocket, follow steps passport pocket. Topstitch them in place: start 1.5mm (1⁄16in.) customize it to fit the bag perfectly, holding whatever you 1–4 of the Simple Slip Pocket. Once you’re from the bottom, then stitch up for 28cm (11in.), across the top need. ready to sew it to the lining, add some extra and down the second side. topstitching to make this practical pocket For a simple slip pocket, lay out the lining pattern piece for the even more useful. Add two rivets (see Hardware and Bling: Rivets) to the bag you are making to determine what size and shape to cut. 12 , ("1ĥ centre of each side of the handle, placing them 1.5cm (5⁄8in.) Top tip It’s best not to have a slip pocket too close to the top or the Using a chalk marker and a ruler, mark 5 above and 1.2cm (1⁄2in.) below the stitching line. Attach the ƙ ƚ base of the bag, so aim for the finished pocket to end at least lines on the slip pocket to determine where second rolled handle to the second main body panel in the the divisions will be sewn. As a rough guide, 2.5cm (1in) from the base and 5cm (2in) from the top – except same way, adding one rivet to each side. Reinforce the stitching at both in clutch bags, where everything is near the base! 2.5cm (1in) from the edge forms a great pen 11 slot, while 11.5cm (41⁄2in) is ideal for most smart Construct and attach the second full-width slip pocket top edges by backstitching: If you’re making a bag with boxed corners or darts, measure phones or a pack of pocket tissues. (H)13 to the right side of the second main body panel (G). This it’s an awful hassle to reinforce the width of the lining panel inside the finished corners. As will be tacked (basted) over the rolled handles. after your bag is completed! for height, around about 15cm (6in) is the deepest pocket Start with the needle at one top corner that is practical. Consider what the pocket will be used for 6edge of the slip pocket, backstitch to reinforce In this section you’ll learn how to and adjust as necessary. For example, if you’re going to be the start, and then sew down the side. FINISHING THE BAG create pockets, from the simplest slip carrying a book in the pocket, you’ll want to make the pocket Continue along the bottom to the first division deeper than usual. line. With the needle still in the fabric, lift the Along each long edge of the exterior base gusset (E), pocket to complex zipped dividers. presser foot and pivot the fabric through 90 14make three holes for the bag feet (see Hardware and Bling: If you prefer to use paper pattern pieces, draw the pocket degrees. Sew up the division line to the top, Bag Feet): place the first one directly above the centre mark, Using the techniques shown here, you on scrap paper before you cut. Don’t forget to add the seam backstitch a couple of stitches, then return to 2.5cm (1in.) from the edge, and the other two 20cm (8in.) either allowance! For bag making, 1cm (3⁄8in) is a perfect seam can add pockets to any bag pattern the top. With the needle still in the fabric, lift side of it. Make matching holes in the foam core board, 1cm allowance; if you’d like to use this, then cut the pocket to the presser foot and pivot 180 degrees. Sew (3⁄8in.) from each edge. your desired final width + 2cm (3⁄4in). For the height, make life you wish, customizing your bag to back down the line to the bottom, pivot 90 easy for yourself and cut the pocket to twice the desired final Fold the long raw edges of the side tabs (D) in to the degrees and continue. Repeat this as many suit your own needs. Don’t forget that height + 2cm (3⁄4in). 15 centre15 and press in place. Topstitch along each folded edge times as is needed to divide the pocket fully. 3mm (1⁄8in.) from the edge. Fold each side tab through a you can layer pockets on top of one Once you’ve decided on the final size of your pocket, cut triangle ring and stitch across as close as possible to the ring one1 piece of pocket fabric and one piece of medium-weight another: as long as they’re each joined 6 to secure. Place each tab on the base gusset (E), with the raw interfacing, then fuse the interfacing to the wrong side of the REINFORCED SLIP POCKET edge of the tabs overhanging the short edge of the gusset by securely to the lining panel, you can pocket fabric (see Tools and Materials: Interfacing). Don’t If you’re concerned that the weight of the 1.5cm (5⁄8in.), then tack (baste) in place. create any configuration you choose! forget to add interfacing to the lining panel before you attach 7 any pockets. contents will put undue stress on the bag Construct the zip gusset, using zip gussets (F) and base lining, it’s easy to add reinforcements to the Top tip 16gusset (E) with the 66cm (26in) #5 zip (see Zip Closures: Fold the pocket panel in half, right sides together, then sew 2 top corners. Simply insert a rivet into each If you’ve chosen to add piping to the Gusset). Top tip around the three open edges, leaving a turning gap in one top corner (see Corners: Reinforcing). You’ll bag, pull the lining gusset out of the ƚ edge (see Core Skills: Turning Gaps). need to add some bulk behind the lining for way and apply the piping all the way the rivet, so cut some scraps of foam stabilizer Attach each main body (G) panel to the relevant gusset Clip the corners (see Core Skills: Reducing Bulk) and turn around the outer gusset now. approximately 1.5cm (5⁄8in) square and pop 17edge. Attach the lining panels first, then the outer panels. Sew Make sure you stitch directly 3the pocket right side out. Turn under the turning gap seam them onto the rivet post on the wrong side of the seam allowances together at the top to ensure that the on previous stitching for allowance and press well. Topstitch along the folded edge, the lining before adding the cap. You shouldn’t lining doesn’t sag into the bag when it’s full. Turn right side out a super-neat finish. 3mm (1⁄8in) from the edge. need more than two per rivet. through the gap in the zip pocket (K). Place the pocket on the lining panel at whichever distance Reach through the turning gap in the zip pocket (K) and 4you determined when making your template, then topstitch 18insert the foam core board base. Topstitch the turning gap it in place around the sides and bottom, again stitching 3mm closed. (1⁄8in) from the edge. This will also close the turning gap. Finally, make the adjustable strap (B); see Handles: 19Adjustable Strap. Clip the strap onto the triangle rings and you’re good to go!
7 17
THE COMPLETE BAG MAKING MASTERCLASS Samantha Hussey Publication Date: Jun-20 | 9781446308110 | £16.99 | $24.99 273 mm x 210 mm | 144 pages | 20000 words Sales Rights: World
24 www.davidandcharles.com
Catalogue.indd 24 29/01/2020 14:02 Catalogue.indd 25 29/01/2020 14:02 HOUSE OF PINHEIRO’S WORK TO WEEKEND WARDROBE HOUSE OF PINHEIRO’S WORK TO WEEKEND WARDROBE Rachel Pinheiro
Revitalise your wardrobe with this capsule collection from sewing expert Rachel from the House of Pinheiro. The collection includes the perfect separates to take you through the working week to the weekend. Rachel includes a main pattern for every day of week and then oers variations for how to dress it up for a meeting or down for the weekend. There will also be advice on how to change the look of the pieces through fabric choices and styling tips, as well as a techniques section featuring Rachel’s tips on how to get the best ȴt for your body type. Garments include on trend staples such as a jumpsuit, kimono dress and a trench coat. Rachel reinvents these basics to create an exciting collection of 7 patterns, which can be used to create numerous dierent outȴts.
FABRIC REQUIRED • 1.6m (xyd) of 150cm (60in) wide fabric
SUGGESTED FABRICS Fabrics with drape will give this dress fluidity, while firmer fabrics will hold pleats and create bolder shapes. Recommended fabrics include lightweight to medium weight woven fabrics: cotton, poplin, voile, rayon, viscose, silk, crepe de chine, cupro, georgette, linen, chambray, shirting and lightweight wool.
SUPPLIES AND NOTIONS • Basic sewing kit: sewing machine, scissors, seam ripper, basting needle, thread, pins, Monday tape measure, tracing wheel and tracing paper or chalk
• 60cm (24in) lightweight fusible interfacing for the unlined version (all sizes)
#worktoWKNDMonday • Coordinating thread
• 56cm (22in) invisible zipper
• Stabiliser tape or interfacing strips (1cm/3⁄8in wide)
• Invisible zipper presser foot
WORK / Tuesday / 63
HOUSE OF PINHEIRO’S WORK TO WEEKEND WARDROBE Rachel Pinheiro Publication Date: Jan-20 | 9781446307335 | £22.99 | $29.99 273 mm x 210 mm | 128 pages | 30000 words Sales Rights: World
26 www.davidandcharles.com
Catalogue.indd 26 29/01/2020 14:02 Catalogue.indd 27 29/01/2020 14:02 LUNA LAPIN
LUNA LAPIN: MAKING NEW FRIENDS Sarah Peel
Learn to make Luna Lapin’s friends and their exquisite wardrobes. This collection of sewing patterns features ȴve of Luna’s best friends (as well as Luna herself) along with their clothes including Hugh the Hound, Daisy the Sheep, Ramsey the Ram, Rowan the Squirrel and Hedgehog
LUNA LAPIN: MAKING NEW FRIENDS Sarah Peel Publication Date: Aug-20 | 9781446308240 | £15.99 | $22.99 273 mm x 210 mm | 144 pages | 35000 words Sales Rights: World
www.davidandcharles.com
Catalogue.indd 28 29/01/2020 14:02 Best MAKING LUNA LAPIN Seller Sarah Peel
Welcome to the elegant world of Luna Lapin, a quiet and kind rabbit with impeccable taste. You can sew your own felt rabbit along with her exquisite wardrobe including 20 garments and accessories. These adorable sewing patterns will appeal to the child in all of us and make beautiful heirloom gifts to treasure.
Publication Date: Oct-16 9781446306253 £15.99 | $22.99 276 mm x 210 mm | 144 pages Sales Rights: World Rights Sold: France, Russia, Spain
SEWING LUNA LAPIN’S FRIENDS Sarah Peel
Learn to make Luna Lapin’s friends and their exquisite wardrobes. This collection of sewing patterns features four of Luna’s best friends and their clothes including Reynard the Fox, Clementine the Cat, Freddie the Badger and Wilhelmina the Wood Mouse!
Publication Date: Aug-18 9781446307014 £15.99 | $22.99 273 mm x 210 mm | 144 pages Sales Rights: World Rights Sold: Russia
www.davidandcharles.com
Catalogue.indd 29 29/01/2020 14:02 MACRAWEAVE
MACRAWEAVE Amy Mullins | Marnia Ryan-Raison
Discover the latest ȴbre art trend, macraweave, a combination of macrame and weaving. Learn to create stunning woven wall hangings and inject a dose of ‘bohemian luxe’ to your living space. Macraweave combines the crafts of macrame knotting with weaving to create eye-catching projects that really pop with texture and colour. There are 18 projects to choose from including woven wall hangings, a table runner, plant hangers and cushions as well as accessories including jewellery, a belt and a scarf. All the instructions and projects will be illustrated with step-by-step photography.
Materials • 17.75m (703⁄4ft) of 2mm (3⁄32in) twisted cotton string • 9.6m (32ft) of 1mm (1⁄32in) cotton yarn in colour 1 • 4.8m (16ft) of 1mm (1⁄32in) cotton yarn in colour 2 • Tapestry needle with blunt tip
Techniques • Overhand Knot • Plaiting • Reverse Lark’s Head Knot Collar • Double Half Hitch • Square Knot Button • Soumak Weave Necklace • Tabby Weave • Weaving Finishing Technique • Fraying
Preparation This fl attering necklace has been designed to fall on the collarbone and is guaranteed to • Cut 3 x 1m (31⁄4ft) lengths of 2mm steal the show. Created using multi-layered (3⁄32in) twisted cotton string yarn in earthy tones woven through natural • Cut 36 x 40cm (153⁄4in) lengths of cotton, it is fi nished with the new edition square 2mm (3⁄32in) twisted cotton string knot button and a long fray. A must-have • Cut 1 x 35cm (133⁄4in) length of 2mm accessory that will have you turning heads (3⁄32in) twisted cotton string whatever the event. • Cut 4 x 2.4m (8ft) lengths of 1mm (1⁄32in) colour 1 cotton yarn • Cut 2 x 2.4m (8ft) lengths of 1mm (1⁄32in) colour 2 cotton yarn
64 | Collar Necklace Collar Necklace | 65 Woven Wheel Mirror | 97
MACRAWEAVE Amy Mullins|Marnia Ryan-Raison Publication Date: Mar-20 | 9781446308059 | £15.99 | $22.99 273 mm x 210 mm | 128 pages | 20000 words Sales Rights: World
30 www.davidandcharles.com
Catalogue.indd 30 29/01/2020 14:02 Catalogue.indd 31 29/01/2020 14:02 DRIED FLOWERS
DRIED FLOWERS Morgane Illes|Hervé Goluza
If the thought of dried ȵower arrangements is conjuring up images of stuy decor that hasn’t seen the light of day in decades, think again.
Preserved ȵoral arrangements are cool again, and not only are they beautiful, they’ll also last inȴnitely longer than fresh ȵowers. This gorgeous book oers a new approach to ȵower arranging with dried botanicals, exploring ways to preserve ȵowers; beauty forever through drying and pressing, and then presents a catalogue of 30 ȵowers that are interesting for colour, texture and sculptural appeal in arrangements.
15 step-by-step projects give you creative ideas for displaying dried ȵowers including bouquets, wreaths, wall hangings, wall art, ȵower crowns and buttonholes for weddings, terrariums, candles and more.
DRIED FLOWERS Morgane Illes|Hervé Goluza Publication Date: Mar-20 | 9781446308141 | £12.99 | $16.99 210 mm x 148 mm | 144 pages | 7000 words Sales Rights: World
32 www.davidandcharles.com
Catalogue.indd 32 29/01/2020 14:03 Catalogue.indd 33 29/01/2020 14:03 MANDY’S MAGICAL CHRISTMAS
AVAILABLE AS PRINT ON DEMAND
MANDY’S MAGICAL CHRISTMAS Mandy Shaw
Nobody does a handmade Christmas like Mandy Shaw! Learn how to decorate your home with unique and personal touches with this gorgeous collection of sewing patterns from the Queen of Christmas Craft. Featuring Mandy’s signature redwork designs and cute folk-inspired characters, this charming book brings Mandy’s best-loved Christmas projects together into one volume. With inspiring lifestyle photography, step-by-step instructions and full-size templates, you’ll learn to sew wreaths, garlands, pennants, hanging decorations and more, and bring some of Mandy’s sparkle to your own magical Christmas.
Christmas Wreath
This door wreath is made from a simple wire base decorated with fabric rags and felt stars and hearts. It’s a great way to use up those linen leftovers from a year’s worth of stitching projects. My children help with the tearing up of the fabric and the tying of the knots. The hearts and stars take just a couple of evenings to complete. The wreath would look great on any internal door, or use it to decorate the feature wall in the living room. For coordinated Christmas decorations, make heart garlands and hanging stars for the tree.
You will need • 1.5m (1¾yd) 120cm (42in) wide dress-weight cotton fabric
• Wire coat hanger shaped into a circle
• Two 33cm x 40.5cm (13in x 16in) pieces of white felt
• Coton à broder: red and taupe, one skein each
• 7VS`LZ[LYZ[\ѝUN Making the wreath base • 23cm x 15cm (9in x 6in) red felt 1*\[Vќ[OLZLS]LKNLLKNLZVM[OLMHIYPJ:UPWHSVUN[OLLKNLVM[OL • Three small pearl buttons fabric every 4cm (1½in) and tear into strips. Put one strip aside. • Twelve small red heart buttons
Finished size: wreath diameter approx. 30.5cm (12in) Some fabrics tear better down or across the grain. Experiment to ÄUK^OPJOKPYLJ[PVUPZILZ[MVY[OL fabric you are working with.
You can use any fabric leftovers if you don’t mind a more hotch-
potch look. 27\SSVќ[OLZ[YH`[OYLHKZHUKJ\[[OLYLTHPUPUNZ[YPWZPU[VJT (5in) lengths. This is a crucial measurement – too long a strip will result in limp rags, too short a strip will result in no rags at all. Stack the strips up and cut through a load at one time. The last thing you want to do is to cut them too neatly.
12 | Christmas Wreath
MANDY’S MAGICAL CHRISTMAS Mandy Shaw Publication Date: Jul-20 | 9781446308189 | £9.99 | $12.99 216 mm x 216 mm | 64 pages |9000 words Sales Rights: World
34 www.davidandcharles.com
Catalogue.indd 34 29/01/2020 14:03 COMING AUTUMN 2020...
STITCH 50 DOGS
STITCH 50 DOGS Alison Reid
Set tails wagging with this canine collection of easy sewing patterns for adorable dog designs, all made using simple hand-sewing techniques. Featuring the most popular and distinctive breeds, each pooch pattern comes with step-by- step instructions and full-size templates, making them paws- itively perfect for all abilities. The ȴnished little pups would make cute brooches, bag charms and home accessories that will make your dog-loving friends drool!
Publication Date: Sep-20 | 9781446308233 | £14.99 | $19.99 229 mm x 216 mm | 128 pages | 7000 words Sales Rights: World
SUBURBAN SKETCHING
SUBURBAN SKETCHING Jen Russell-Smith
Urban sketching is a rising phenomenon but to many beginning artists feels rather intimidating. Not everyone has regular access to interesting urban spaces, and for most the fear of being watched sketching in busy public spaces is frankly terrifying! But living in suburbia or even in rural areas doesn’t mean you can get enjoyment from sketching the world around you. In this accessible guide, largely self- taught artist Jen Russell-Smith takes beginners by the hand and breaks down the barriers we face around sketching, and shows you how to begin with quick, loose sketches building your conȴdence and skills to draw spontaneously. With simple exercises and step-by-step tutorials, Jen shows you how to sketch the places around you from life, and those further aȴeld from photos, using simple watercolour techniques to add vibrancy to your work.
Publication Date: Oct-20 | 9781446308202 | £15.99 | $22.99 235 mm x 191 mm | 128 pages | 15000 words Sales Rights: World
35 www.davidandcharles.com
Catalogue.indd 35 29/01/2020 14:03 ASSISTED PUBLISHING WITH DAVID AND CHARLES
Our assisted publishing service allows authors who have self-published to reach the global distribution available to our traditionally published books. It is anticipated most books will come from existing David and Charles authors. Books are sold through GBS distribution in the UK and Ingram Two Rivers in the USA. This model can also be applied to other projects that don't fall into the established commissioning process.
The English language edition of these titles can be ordered as normal. If you are interested in foreign language rights, please contact Sam Vallance, [email protected].
If you are interested in ȴ nding out more about Assisted Publishing, please contact James Woollam, [email protected].
BEN THE TRACTOR Lisa Singleton | Molly Finnegan
An exclusive storybook for the Ben Moon Testimonial Year. Follow the adventure of Ben the Tractor and his friends. On a stormy day at Windy Ridge Farm a tree has fallen on the train line. Jack the train can’t pass and Farmer Woodburn needs Ben’s help to clear the line. Will Ben be able to save the day?
Publication Date: Nov-19 | 9781446308219 | £7.00 | $9.00 216 mm x 216 mm | 34 pages Sales Rights: World
Catalogue.indd 36 29/01/2020 14:03 MANDY SHAW’S RED & WHITE CHRISTMAS Mandy Shaw
Stylishly themed in red and white, Mandy’s Christmas projects will inspire you to pick up your needle and thread and stitch yourself a very Merry Christmas. The 10 stunning projects range from quick but eective tree decorations to a gorgeous quilt and all the 25 patterns and motifs you need are included full-size.
Publication Date: Mar-20 | 9780995750913 | £12.99 | $16.99 297 mm x 210 mm | 64 pages Sales Rights: World
SAY IT WITH A STITCH Mandy Shaw
Oering a giddying number of mix-and-match options, this collection of Mandy Shaw’s stitcheries with sentiments is a must-have for lovers of her irresistibly charming style. The book includes 10 complete projects plus 20 stitch designs, nine borders and ȴve complete alphabets to allow you to create literally hundreds of ideas.
Publication Date: Mar-20 | 9780995750920 | £14.99 | $19.99 297 mm x 210 mm | 80 pages Sales Rights: World
STITCH INTO SPRING Mandy Shaw
Put some spring in your stitching with three gorgeous designs from Mandy Shaw. The projects are perfect for celebrating Easter and welcoming spring and are designed to help you choose fabrics and embellishments with conȴdence. The book includes full instructions, top tips and full-size templates which make each project a breeze.
Publication Date: Mar-20 | 9780995750906 | £9.99 | $12.99 297 mm x 210 mm | 24 pages Sales Rights: World
Catalogue.indd 37 29/01/2020 14:03 Catalogue.indd 38 29/01/2020 14:03 RECENTLY PUBLISHED
Catalogue.indd 39 29/01/2020 14:03 KNIT LIKE A LATVIAN: SOCKS Ieva Ozolina
A collection of 50 patterns for traditional Latvian knee length, ankle and footless socks, made easy for knitters of all abilities. Knitted socks have played an important part in traditional Latvian culture: like knitted mittens they were traditionally given out to guests at Latvian weddings and little girls are still taught to knit at school from an early age. The sock patterns include traditional Latvian design motifs and the text refers to some of the folk traditions surrounding knitted mittens in Latvia (for example, if you include the sun motif it is thought that the socks will oer extra warmth to the wearer).
Publication Date: Dec-19 9781446307496 £15.99 | $22.99 273 mm x 210 mm | 128 pages Sales Rights: World Rights Sold: Czech Republic, Finland, France, Germany, Norway
MODERN CROCHET BIBLE Sarah Shrimpton
The Modern Crochet Bible is the deȴnitive guide to all the crochet stitches and techniques needed to create stunning contemporary crochet projects. There has been a huge swell in the number of people trying crochet in the last decade and this has helped to drive the modern crochet movement. Crocheters today are using traditional crochet techniques such as ȴlet but adding their own twist to make it modern. There are also brand new techniques such as corner to corner crochet and colour pooling, as well as lots of exciting new colour change yarns to inspire the modern crocheter.
Publication Date: Dec-19 9781446307502 £17.99 | $24.99 273 mm x 210 mm | 152 pages Sales Rights: World Rights Sold: Czech Republic, Russia
40 www.davidandcharles.com
Catalogue.indd 40 29/01/2020 14:03 3D GRANNY SQUARES Celine Semaan|Sharna Moore|Caitie Moore
Crocheters of all abilities will love this collection of fun granny square motifs with a 3D element. Granny squares are incredibly popular amongst crocheters because they are portable and can be used to create larger projects like blankets and afghans. They are also suitable for beginners: lots of crafters new to crochet start o with a granny square. This title by Australian designer, Celine Semaan, takes a fresh look at the humble granny square by introducing a 3D element to all the designs. The 100 squares are divided up into categories for animals, food and drink and other motifs so readers can choose their favourites whether it’s a beautiful ȵower, a cherry pie or a jellyȴsh. Ten projects show readers how they can use the squares to make beautiful gifts for friends and family.
Publication Date: Dec-19 9781446307434 £15.99 | $22.99 273 mm x 210 mm | 128 pages Sales Rights: World Rights Sold: Germany, Denmark
41 www.davidandcharles.com
Catalogue.indd 41 29/01/2020 14:03 RAFFIA CROCHET Wool and the Gang
An inspirational collection of crochet ideas from DIY fashion brand Wool and the Gang, with projects hats, bags and accessories. All of the projects will be made using Wool and the Gang’s range of raɝa yarn – Ra-Ra Raɝa – which is available in ȴve natural shades. General crochet techniques will be featured at the end of the book accompanied by clear illustrations, plus additional ideas to embellish your crochet makes with embroidery using raɝa.
Publication Date: Apr-19 9781446307489 £12.99 | $17.99 273 mm x 210 mm | 72 pages Sales Rights: World Rights Sold: Denmark, France, South Korea
KAWAII CROCHET Melissa Bradley
Hook up a rainbow of kawaii goodness with this super-cute collection of 40 amigurumi patterns from modern crochet designer Melissa Bradley of Yarn Blossom Boutique. From three adorable peas in a pod, to a winking fortune cookie, these 40 fun and easy amigurumi makes will bring the Japanese culture of cuteness into readers’ hands and hearts.
Publication Date: Dec-19 9781446307533 £15.99 | $22.99 203 mm x 203 mm | 120 pages Sales Rights: World Rights Sold: Denmark, Germany, Taiwan, France
42 www.davidandcharles.com
Catalogue.indd 42 29/01/2020 14:03 BEGINNER’S GUIDE TO COLOURWORK KNITTING Ella Austin
This is a step-by-step guide to knitting with colour for readers with a basic knowledge of knitting who would love to stitch beautiful colourwork projects that they might think are too complex for them. The author covers the key colourwork knitting techniques including stripes; slip stitch/mosaic; stranded and intarsia via simple projects designed to be accessible for knitters with no previous colourwork experience. Within each project there is a separate ‘Colourwork Tutorial’ feature so readers can build up their skills. These tutorials will be illustrated with step-by-step photography to help the reader as they make and learn.
Publication Date: Mar-19 9781446307281 £15.99 | $22.99 273 mm x 210 mm | 128 pages Sales Rights: World Rights Sold: Russia
Best KNITTED ANIMAL FRIENDS Seller Louise Crowther
Knitters will love this new collection of knitted toy patterns from the author of My Knitted Doll, Louise Crowther. Louise brings her unique style of coordinated knitwear with cute colourwork details to this collection of brand new knitting patterns for animal toys. There are a total of 13 knitted animals – each with their own unique personality and style. The animals all have the same basic body, with a few colour variations and tail additions, so the clothes can be mixed and matched between them to create endless outȴt possibilities. Readers can choose your favourite animals and outȴts and have fun making the perfect gift for their friends and family.
Publication Date: Mar-19 9781446307311 £15.99 | $24.99 273 mm x 210 mm | 128 pages Sales Rights: World Rights Sold: Belgium, Denmark, France, Germany, Russia, South Korea
43 www.davidandcharles.com
Catalogue.indd 43 29/01/2020 14:03 MODERN QUILT BIBLE Elizabeth Betts
The modern quilt movement continues to grow and the Modern Quilt Bible is the ultimate reference guide to patchwork and quilting techniques. Author of Beginner’s Guide to Quilting, Liz Betts, explains over 100 techniques and design ideas used by designers to create eye- catching modern quilts and shows how to do each technique in a step-by-step tutorial. Techniques covered include improv piecing, free motion quilting, playing with scale, curved piecing and much more. The Modern Quilt Bible also features quilts from the world’s best modern quilt designers showing how the techniques can be used to get stunning results.
Publication Date: Dec-19 9781446307465 £19.99 | $24.99 273 mm x 210 mm | 160 pages Sales Rights: World
NAUTICAL QUILTS Lynette Anderson
A brand new collection of beautiful quilted and stitched projects by internationally-renowned designer, Lynette Anderson. Lynette brings her distinctive style of patchwork mixed with exquisite hand embroidery and applique to the theme of nautical quilts–a subject that was inspired by her own family history and her grandfather’s career in the navy. This collection of projects celebrating the sea includes large and small quilted projects so there is something for everyone. Choose from full-sized quilts, a needlework roll, pillows, bags and wall hangings, all illustrated with step-by-step artworks and instructions.
Publication Date: Apr-19 9781446307274 £15.99 | $24.99 273 mm x 210 mm | 128 pages Sales Rights: World
See page 71 for more Lynette Anderson titles
44 www.davidandcharles.com
Catalogue.indd 44 29/01/2020 14:03 THE ULTIMATE KOGIN COLLECTION Susan Briscoe
Discover the beautiful Japanese pattern darning technique kogin and how it can be used to create stunning stitched and quilted projects. Kogin is a variation of the popular Japanese embroidery technique sashiko and is rapidly becoming as popular as its ‘big sister’. Japanese embroidery expert, Susan Briscoe, has compiled a collection of over 230 pattern charts - kogin is a counted embroidery technique - and 12 accompanying projects to create The Ultimate Kogin Collection, following on from her previous title The Ultimate Sashiko Sourcebook.
Publication Date: Jun-19 9781446307328 £16.99 | $24.99 273 mm x 210 mm | 128 pages Sales Rights: World Rights Sold: China, Spain
45 www.davidandcharles.com
Catalogue.indd 45 29/01/2020 14:03 50 FAT QUARTER TOYS Ame Verso
A celebration of handmade toys, featuring fabulous stued animals, handmade baby gifts and more – all made using fat quarter cuts of fabric – the most popular way that sewers buy fabric. Continuing the series from 50 Fat Quarter Makes, this fun collection features beautiful styled photography, step-by-step diagrams and templates for over 50 handmade toys, with patterns provided by top international talents. All the toys are made using simple sewing techniques alongside patchwork, appliqué and embroidery.
Publication Date: Nov-19 9781446307427 £16.99 | $24.99 273 mm x 210 mm | 144 pages Sales Rights: World Rights Sold: Russia, France
GINGERMELON’S EMBROIDERED ANIMALS Shelly Down
An exquisite collection of embroidered animal dolls, brought to you by top toy sewing designer Gingermelon. These stunning animal dolls are easy to sew and then embellish with simple hand embroidery stitches to beautiful eect. The dolls and their cute outȴts all use small amounts of fabric, so are great for using up scraps. With step-by step instructions and full guidance on the embroidery stitches and full-size pattern pieces to trace from the page, this super-accessible book will help readers make future heirlooms that will stay in the family for generations.
Publication Date: Jun-19 9781446307304 £15.99 | $24.99 273 mm x 210 mm | 128 pages Sales Rights: World Rights Sold: France, Russia
46 www.davidandcharles.com
Catalogue.indd 46 29/01/2020 14:03 MODERN SUGAR FLOWERS VOLUME 2 Jacqueline Butler
Modern Sugar Flower Volume 2 shows cake decorators step-by-step how to create modern and sophisticated, stylized sugar ȵowers, and use them to create beautiful arrangements on wedding and celebration cakes. The book includes instructions and step-by-step photographs for how to create over 20 new sugar ȵowers in various stages of bloom, as well as ȵower buds and leaves, using a simple color palette of green and white plus pastels. Readers will then learn how to use the foundation ȵowers in combination with ȴller ȵowers to create six contemporary cake designs. Several dierent arranging techniques will be covered including working on cake toppers that are attached to the cake after they are completed.
Publication Date: Nov-19 9781446307298 £19.99 | $26.99 273 mm x 210 mm | 144 pages Sales Rights: World
47 www.davidandcharles.com
Catalogue.indd 47 29/01/2020 14:03 JOURNAL WITH PURPOSE Helen Colebrook
The ultimate reference for journaling, packed with over 1000 motifs that readers can use to decorate and enhance their dot journal or bullet journal pages. Readers can copy or trace direct from the page, or follow one of the quick exercises to improve their skills. Featuring all the journal elements a reader could wish for – banners, arrows, dividers, scrolls, icons, borders and alphabets – this amazing value book will be a constant source of inspiration for journaling and an ‘instant ȴx’ for people who ȴnd the more artistic side of journaling a challenge.
Publication Date: Nov-19 9781446307472 £14.99 | $19.99 235 mm x 191 mm | 128 pages Sales Rights: World Rights Sold: China, Russia, Sweden, Spain
BOTANICAL BAKING Juliet Sear
Learn how to perfect the prettiest trend in cake decorating – using edible ȵowers and herbs to decorate your cakes and bakes – with this impossibly beautiful guide from celebrity baker Juliet Sear. Learn what ȵowers are edible and great for ȵavour, how to use, preserve, store and apply them including pressing, drying and crystallising ȵowers and petals. Then follow Juliet step- by-step as she creates over 30 beautiful botanical cakes that showcase edible ȵowers and herbs, including more top trends such as a confetti cake, a cupcake wreath, ȵoral chocolate bark, a semi-naked cake, caketails and more.
Publication Date: Apr-19 9781446307397 £16.99 | $24.99 250 mm x 190 mm | 144 pages Sales Rights: World
48 www.davidandcharles.com
Catalogue.indd 48 29/01/2020 14:03 DIY WATERCOLOR FLOWERS Marie Boudon
Learn to paint beautiful watercolor ȵowers in simple steps with this free and easy approach to watercolor painting for beginners. Marie Boudon’s beautifully presented creative course will give you a good grounding in this new-to-you medium and teach you all you need to know to get started with painting ȵowers in watercolor. Find out about paper, brushes and paints, color mixing, wet and dry techniques, blending and gradients, contrast and even how to digitize your work. Then learn to paint roses, peonies, carnations, dahlias, anemones, poppies, leaves, details and textures and how to bring all of these together into beautiful compositions which make lovely art pieces, journal pages, handmade stationery and greetings cards, inspirational quote frames, personalized gifts and more.
Publication Date: Mar-19 9781446307359 £15.99 | $22.99 255 mm x 215 mm | 160 pages Sales Rights: World English
49 www.davidandcharles.com
Catalogue.indd 49 29/01/2020 14:03 DOVER PUBLISHING
Dover publishes into a wealth of categories, including art, craft, colouring and ȴ ction, with over 9,000 titles available to order. If you’re not familiar with the Dover list please contact a member of the team who would be happy to provide a list of titles that would be suitable for your business.
CRAFT TITLES
ADORABLE FRUITS & VEGETABLES TO CROCHET Marie Clesse
Add some zest to your kitchen décor with these fun- to-make crocheted ornaments. Suitable for crafters at all skill levels, 24 appealing projects include a banana, complete with a crocheted “skin” that allows you to peel and remove the fruit; a full lemon and one that’s cut in half; a pea pod, complete with little removable peas; and other charming fruits and vegetables. Each project features detailed instructions and is accompanied by full-colour photos of the ȴnished item
Publication Date: May-20 9780486842776 £11.49
Catalogue.indd 50 29/01/2020 14:03 PRINTMAKING 3D PAPER CRAFT Christine Medley Yoko Ganaha | Piggy Tsujioka Publication Date: Apr-20 Publication Date: Jun-20 9780486837192 9780486842769 £17.49 £16.99
WREATHS FOR EVERY QUILTER’S COMPLETE SEASON GUIDE Stacey McArthur Marianne Fons & Liz Porter Publication Date: Apr-20 Publication Date: Jan-20 9780486837444 9780486839974 £15.49 £18.99
CUDDLY CROCHET EASY ORIGAMI CRITTERS John Montroll Megan Kreiner Publication Date: Feb-20 Available 9780486272986 9780486833958 £3.99 £15.49
ART OF STONE TRADITIONAL PAINTING PATCHWORK QUILT F. Sehnaz Bac PATTERNS WITH PLASTIC TEMPLATES Available 9780486808932 Rita Weiss £15.49 Available 9780486249841 £9.99
ORIGAMI DINOSAURS EASY ORIGAMI FOR BEGINNERS ANIMALS John Montroll John Montroll Available Available 9780486498195 9780486781624 £4.49 £4.49
Catalogue.indd 51 29/01/2020 14:03 LITTLE ACTIVITY TITLES
COLOR & LEARN EASY ITALIAN PHRASE Available 9780486803593 £1.99
SPOT THE DIFFERENCES PUZZLE FUN Available 9780486438412 £1.99
PICASSO: 16 ART STICKERS Available 9780486410760 £1.99
COLOR & LEARN EASY FRENCH PHRASES Available 9780486803616 £1.99
MY FIRST CROSSWORD PUZZLE BOOK Anna Pomaska Available 9780486262994 £1.99
Minimum order quantities apply to spinners. Please contact your rep for more information
Catalogue.indd 52 29/01/2020 14:03 COLOURING / CREATIVE HAVEN TITLES
CREATIVE HAVEN CREATIVE HAVEN BLISSFUL NATURE BY THE SEA COL COL BK BY NUMBERS Jessica Mazurkiewicz George Toufexis Publication Date: Apr -20 Publication Date: Jun-20 9780486841755 9780486840468 £4.49 £7.49
CREATIVE HAVEN CREATIVE HAVEN COUNTRY GARDENS PLAYFUL PET TALK COL BK COL BK Teresa Goodridge Jo Taylor Publication Date: Apr-20 Publication Date: Aug-20 9780486840451 9780486842554 £4.49 £4.49
CREATIVE HAVEN HOORAH FOR SHAKESPEARE COL BK UNICORNS COL BK Marty Noble Kathy Voerg Publication Date: Aug-20 Publication Date: Aug-20 9780486841786 9780486842455 £4.49 £3.99
TITANTIC COLORING SPOT-THE- BOOK DIFFERENCES AROUND Peter F. Copeland THE WORLD Available Tony J. Tallarico 9780486297569 Available £2.99 978048647304 £3.99
CREATIVE HAVEN CREATIVE HAVEN COUNTRY CHARM KITTENS COL BK COL BK Majorie Sarnat Teresa Goodridge Available Available 9780486812670 9780486821689 £4.49 £4.49
Catalogue.indd 53 29/01/2020 14:03 ART TITLES
THE QUICK POSE MASTERING DRAWING Erin Meads THE HUMAN FIGURE Publication Date: May-20 Jack Faragasso 9780486841366 Publication Date: Aug-20 £22.99 9780486841243 £18.99
MODERN PICTORIAL THE BOOK OF PERSPECTIVE WILDFLOWERS T. Heaton Cooper The National Geographic Publication Date: May-20 Society 9780486842721 Publication Date: Aug-20 £6.99 9780486840949 £18.99
WITH PEN AND INK MASTERING Publication Date: Jul-20 COPPERPLATE 9780486841922 CALLIGRAPHY £9.49 Eleanor Winters Available 9780486409511 £12.99
CONSTRUCTIVE PERSPECTIVE MADE ANATOMY EASY George B. Bridgman Ernest R. Norling Publication Date: Feb-00 Available 9780486211046 9780486404738 £7.49 £8.49
ART FORMS IN THE PRACTICE & NATURE SCIENCE OF DRAWING Ernst Haekel Harold Speed Available Available 9780486229874 9780486228709 £11.99 £12.99
Catalogue.indd 54 29/01/2020 14:03 THRIFT TITLES
DAVID COPPERFIELD Charles Dickens 9780486841335 £7.49
SKETCHES BY BOZ Charles Dickens 9780486843353 £7.49
THE MOONSTONE 9780486841830 £5.49
NO THOROUGHFARE Charles Dickens & Wilkie Collins 9780486842196 £4.49
DOLLS HOUSE Publication Date: Jan-00 9780486270623 £1.99
Minimum order quantities apply to spinners. Please contact your rep for more information
Catalogue.indd 55 29/01/2020 14:03 Catalogue.indd 56 29/01/2020 14:03 BACKLIST
Catalogue.indd 57 29/01/2020 14:03 Knitting & Crochet
CORNER TO CORNER CROCHET ANIMAL RUGS CROCHET Ira Rott Jess Coppom Publication Date: Aug-18 Publication Date: Oct-18 9781446307007 9781446307144 £15.99 | $22.99 £15.99 | $22.99 273 mm x 210 mm | 144 pages 273 mm x 210 mm | 128 pages Sales Rights: World Sales Rights: World Rights Sold: Estonia, Russia, Rights Sold: Italy, Russia, Spain South Korea
KNITTED ANIMAL SOCKS KNIT LIKE A LATVIAN Lauren Riker Ieva Ozolina Publication Date: Feb-18 Publication Date: Feb-18 9781446307151 9781446306727 £9.99 | $12.99 £15.99 | $22.99 273 mm x 210 mm | 48 pages 273 mm x 210 mm | 128 pages Sales Rights: World Sales Rights: World Rights Sold: France Rights Sold: Denmark, Estonia, Finland, Germany, Japan, Latvia, Netherlands, Russia,
LALYLALA’S BEETLES, LITTLE HAPPY CIRCUS BUGS AND BUTTERFLIES Tine Nielsen Lydia Tresselt Publication Date: Oct-17 Publication Date: Oct-17 9781446306789 9781446306666 £14.99 | $22.99 £16.99 | $24.99 235 mm x 210 mm | 112 pages 235 mm x 210 mm | 128 pages Sales Rights: World Sales Rights: World Rights Sold: China, Denmark, Germany, France, Netherlands, Taiwan
Best SNUGGLE AND PLAY Best TUNISIAN CROCHET Seller Seller CROCHET WORKSHOP Carolina Guzman Benitez Michelle Robinson Publication Date: Sep-17 Publication Date: Sep-17 9781446306659 9781446306611 £15.99 | $23.99 £16.99 | $24.99 273 mm x 210 mm | 128 pages 235 mm x 210 mm | 144 pages Sales Rights: World Sales Rights: World Rights Sold: Germany, Hungary Rights Sold: Germany, Italy, Netherlands
Best SUPERSIZE CROCHET Seller MY KNITTED DOLL Sarah Shrimpton Louise Crowther Publication Date: May-17 Publication Date: Oct-16 9781446306598 9781446306352 £14.99 | $21.99 £15.99 | $24.99 276 mm x 210 mm | 112 pages 276 mm x 210 mm | 128 pages Sales Rights: World Sales Rights: World Rights Sold: Finland, Germany, Rights Sold: Belgium, France, Netherlands, Russia Germany, Italy, South Korea, Spain
58 www.davidandcharles.com
Catalogue.indd 58 29/01/2020 14:03 Knitting & Crochet
MY CROCHET DOLL SIMPLE KNITS BLANKETS Isabelle Kessedjian & THROWS Publication Date: Jan-14 Claire Crompton 9781446304242 Publication Date: Dec-12 £12.99 | $19.99 9781446303085 276 mm x 210 mm | 96 pages £6.99 | $10.99 Sales Rights: World English 276 mm x 210 mm | 32 pages Language Sales Rights: World Rights Sold: Belgium, Romania
SIMPLE KNITS BAGS KNITTED TOY TRAVELS Claire Crompton Laura Long Publication Date: Dec-12 Publication Date: Apr-12 9781446303023 9781446301463 £6.99 | $10.99 £14.99 | $23.99 276 mm x 210 mm | 32 pages 276 mm x 210 mm | 128 pages Sales Rights: World Sales Rights: World Rights Sold: Finland, Romania Rights Sold: Finland, Germany, Netherlands
BEAUTIFUL BOTANICAL STITCH LONDON KNITS Lauren O’Farrell Nora J. Bellows Publication Date: Sep-11 Publication Date: Mar-12 9780715338674 9781446302439 £14.99 | $22.99 £14.99 | $23.80 220 mm x 215 mm | 128 pages 210 mm x 250 mm | 176 pages Sales Rights: World Sales Rights: World English Rights Sold: Germany Language
200 CROCHET FLOWERS, STITCH LIBRARY EMBELLISHMENTS & Claire Crompton TRIMS Publication Date: Oct-10 Claire Crompton 9780715337769 Publication Date: Jun-11 £14.99 | $22.99 9780715338438 279 mm x 216 mm | 144 pages £14.99 | $22.99 Sales Rights: World 276 mm x 210 mm | 128 pages Rights Sold: China Sales Rights: World Rights Sold: Belgium, China, Estonia, Finland, Romania
THE KNITTING AND 200 KNITTED BLOCKS CROCHET BIBLE Jan Eaton Claire Crompton|Sue Whiting Publication Date: Jul-05 Publication Date: Mar-09 9780715322352 9780715332801 £12.99 | £19.99 | $24.99 222 mm x 222 mm | 128 pages 280 mm x 20 mm | 320 pages Sales Rights: World English Sales Rights: World Language
59 www.davidandcharles.com
Catalogue.indd 59 29/01/2020 14:03 Knitting & Crochet
Best BEGINNER’S GUIDE TO CROCHET Seller Sarah Shrimpton
Beginner’s Guide to Crochet comprehensively teaches all the basic crochet techniques, skills and stitches to get someone started. Each new technique is explained with accompanying photographs and diagrams and is followed directly with a project using those skills. The 20 projects include a cafetiere cosy, trellis scarf, teddy bear, a tablet cosy and of course, no crochet book would be complete without the staple granny blanket. Plus a section dedicated to ‘extreme crochet’, using t-shirt yarn to create larger-than-life crocheted creations. There is a distinctly modern feel to the projects and the author’s chatty, informal style takes readers’ on their journey from newbie to fully-ȵedged crocheter with ease.
Publication Date: Apr-15 9781446305232 £14.99 | $22.99 276 mm x 205 mm | 128 pages Sales Rights: World Rights Sold: Russia, Spain
CROCHET HOME CROCHET YOUR Emma Lamb CHRISTMAS BAUBLES Publication Date: Sep-15 9781446304853 Publication Date: Sep-15 £14.99 | $24.99 9781446305799 235 mm x 210 mm | 144 pages £7.99 | $10.99 Sales Rights: World 263 mm x 193 mm | 48 pages Rights Sold: Belgium, Denmark, Sales Rights: World Russia, South Africa, South Rights Sold: Belgium, Denmark, Korea Estonia, Spain
EDWARD’S MENAGERIE: HOOKED! BIRDS Michelle Delprat|Cécile Kerry Lord Delprat|Sylvie Delprat Publication Date: Sep-15 Publication Date: Mar-15 9781446306024 9781446305751 £15.99 | $22.99 £12.99 | $19.99 276 mm x 210 mm | 128 pages 276 mm x 210 mm | 96 pages Sales Rights: World Sales Rights: World English Rights Sold: Czech Republic, Language Denmark, Finland, France, Germany, Netherlands, Russia, Spain
60 www.davidandcharles.com
Catalogue.indd 60 29/01/2020 14:03 Knitting & Crochet
200 CROCHET BLOCKS THE KNITTER’S BIBLE FOR BLANKETS, THROWS Claire Crompton AND AFGHANS Publication Date: Oct-04 Jan Eaton 9780715317990 Publication Date: Jan-05 £16.99 | $22.99 9780715321416 279 mm x 216 mm | 160 pages £12.99 Sales Rights: World 222 mm x 222 mm | 128 pages Rights Sold: Argentina, China, Sales Rights: English Language Croatia, Czech Republic, UK, Eire and Europe only Denmark, Estonia, France, Germany, Poland, Romania, Russia, Slovenia, Spain, Turkey
PATCHWORK CROCHET VINTAGE KNITS FOR Kristel Salgarollo HIM & HER Publication Date: Nov-14 Ame England 9781446305331 Publication Date: Nov-14 £12.99 9781446305171 276 mm x 210 mm | 96 pages £14.99 | $22.99 Sales Rights: World English 225 mm x 195 mm | 128 pages Language Sales Rights: World English Language
FAUX TAXIDERMY KNITS MY CROCHET ANIMALS Louise Walker Isabelle Kessedjian Publication Date: Sep-14 Publication Date: Apr-15 9781446304532 9781446305928 £14.99 | $22.99 £12.99 | $19.99 225 mm x 175 mm | 128 pages 276 mm x 210 mm | 96 pages Sales Rights: World Sales Rights: World English Rights Sold: China Language
Best EDWARD’S MENAGERIE Seller Kerry Lord
An adorable collection of over 40 cute and snuggly crochet animals to stitch – ideal as gifts for babies and children or just to make for fun! Fall in love and crochet this diverse range of cuddly creatures including: Seamus the Alpaca, Clarence the Bat, Bridget the Elephant, Rufus the Lion, Claudia the Saddleback Pig and many more – once you’ve made one you’ll want to stitch the whole menagerie!
Publication Date: Aug-14 9781446304785 £15.99 | $22.99 276 mm x 205 mm | 128 pages Sales Rights: World Rights Sold: China, Denmark, Estonia, Finland, France, Germany, Hungary, Italy, Netherlands, Norway, Russia, Slovenia, South Korea, Spain, Sweden
61 www.davidandcharles.com
Catalogue.indd 61 29/01/2020 14:03 Knotting & Cross Stitch
THE KNOTTING & THE NEW CROSS BRAIDING BIBLE STITCHER’S BIBLE Dorothy Wood Jane Greeno Publication Date: Aug-14 Publication Date: Aug-10 9781446303948 9780715337714 £16.99 | $24.99 £14.99 276 mm x 210 mm | 160 pages 235 mm x 155 mm | 224 pages Sales Rights: World Sales Rights: World Rights Sold: Croatia, France, Rights Sold: China Germany, Portugal
CROSS STITCH ANTIQUE I LOVE CROSS STYLE SAMPLERS STITCH – CHRISTMAS Jane Greeno COUNTDOWN Publication Date: Oct-14 Various 9781446304495 Publication Date: Mar-13 £14.99 | $24.99 9781446303344 276 mm x 210 mm | 144 pages £6.99 | $10.99 Sales Rights: World 276 mm x 210 mm | 32 pages Sales Rights: World
Best Seller MACRAMÉ FOR BEGINNERS AND BEYOND Amy Mullins | Marnia Ryan-Raison
Discover a fresh, new take on the traditional craft of macramé, a craft that was incredibly popular in the seventies, and which is currently enjoying a renaissance. Macramé projects are the best way to bring the current trend for luxe, boho interiors into your home. This title includes very on trend macramé projects for inside and outside the home. Choose from 12 dierent projects with an ‘easy’ and ‘more advanced’ version for each so you can develop your skills as you go.
Publication Date: Sep-17 9781446306635 £14.99 | $23.99 273 mm x 210 mm | 128 pages Sales Rights: World Rights Sold: China, Finland, France, Germany, Netherlands, South Korea
62 www.davidandcharles.com
Catalogue.indd 62 29/01/2020 14:03 Embroidery & Sewing
BIG EMBROIDERY 200 EMBROIDERED Nancy Nicholson FLOWERS Publication Date: Oct-18 Kristen Gula 9781446307137 Publication Date: Jun-18 £15.99 | $24.99 9781446306758 229 mm x 216 mm | 128 pages £15.99 | $24.99 Sales Rights: World 229 mm x 216 mm | 144 pages Rights Sold: Finland Sales Rights: World Rights Sold: Germany, Japan
Best HOOP-LA! Seller MODERN FOLK Kirsty Neale EMBROIDERY Publication Date: Aug-13 Nancy Nicholson 9781446302989 Publication Date: Nov-16 £14.99 | $22.99 9781446306291 220 mm x 215 mm | 128 pages £14.99 | $22.99 Sales Rights: World 235 mm x 210 mm | 128 pages Rights Sold: Belgium, China, Sales Rights: World France, Germany, Italy, South Rights Sold: Finland, France, Korea, Taiwan, Thailand Slovenia, Spain
QUICK AND CLEVER SCARVES AND WRAPS FELTING Jill Denton Ellen Kharade Publication Date: Dec-08 Publication Date: Apr-08 9780715330036 9780715327166 £12.99 £12.99 | $19.99 260 mm x 210 mm | 128 pages 276 mm x 210 mm | 128 pages Sales Rights: English Language Sales Rights: World UK, Eire and Europe only Rights Sold: Hungary, Netherlands
DIY KIDS’ DRESS UP WABI-SABI SEWING Jessica Near Karen Lewis Publication Date: May-18 Publication Date: Aug-18 9781446306772 9781446307090 £14.99 | $22.99 £15.99 | $24.99 273 mm x 210 mm | 128 pages 273 mm x 210 mm | 128 pages Sales Rights: World Sales Rights: World Rights Sold: Belgium Rights Sold: Spain
Best Seller MY FELT DOLL SEW LUXE LEATHER Shelly Down Rosanna Gethin Publication Date: Oct-15 Publication Date: May-18 9781446305768 9781446306765 £15.99 | $24.99 £14.99 | $22.99 276 mm x 210 mm | 128 pages 229 mm x 216 mm | 128 pages Sales Rights: World Sales Rights: World Rights Sold: France, South Korea, Taiwan
63 www.davidandcharles.com
Catalogue.indd 63 29/01/2020 14:03 Embroidery & Sewing
SEW YOUR OWN THE BEGINNERS GUIDE ACTIVEWEAR TO DRESSMAKING Melissa Fehr Wendy Ward Publication Date: Jan-18 Publication Date: Nov-14 9781446306703 9781446304945 £16.99 | $24.99 £19.99 | $27.99 273 mm x 210 mm | 128 pages 276 mm x 210 mm | 128 pages Sales Rights: World Sales Rights: World Rights Sold: Germany Rights Sold: Italy, Romania
LITTLE LADY LIBERTY THE DRESSMAKING Alice Caroline TECHNIQUE BIBLE Publication Date: Mar-15 Lorna Knight 9781446304952 Publication Date: Sep-14 £15.99 9781446304921 276 mm x 210 mm | 128 pages £15.99 | $27.99 Sales Rights: World 195 mm x 145 mm | 272 pages Rights Sold: France, Germany Sales Rights: World
FABRIC MANIPULATION SEW FANTASY TOYS Ruth Singer Melanie McNeice Publication Date: Jun-13 Publication Date: Sep-15 9781446302477 9781446306000 £15.99 | $27.99 £14.99 | $19.99 273 mm x 210 mm | 176 pages 276 mm x 210 mm | 96 pages Sales Rights: World Sales Rights: World Rights Sold: Germany Rights Sold: Germany, Spain
HOW TO PRINT FABRIC 50 FAT QUARTER MAKES Zeena Shah|Kirstie Allsopp Jo Avery|Elizabeth Betts|Ali Publication Date: Oct-15 Burdon|Jessie Fincham|Louise 9781446305973 Horler|Kevin Kosbab|Emily £14.99 | $22.99 Levey|Kaye Prince|Prudence 225 mm x 175 mm | 128 pages Rogers|Cynthia Shaer|Lisa Sales Rights: World Fordham Rights Sold: Germany Publication Date: May-15 9781446305911 £15.99 | $24.99 276 mm x 210 mm | 144 pages Sales Rights: World Rights Sold: France, South Africa HOW TO MAKE CHRISTMAS WREATHS AND GARLANDS Mandy Shaw Publication Date: Jul-15 9781446306208 £9.99 | $12.99 263 mm x 193 mm | 48 pages Sales Rights: World
64 www.davidandcharles.com
Catalogue.indd 64 29/01/2020 14:03 Embroidery & Sewing
RETRO MAMA SCRAP FUN OF THE FAIR HAPPY SEWING Melanie McNeice Kim Kruzich Publication Date: Oct-14 Publication Date: Apr-15 9781446305195 9781446305218 £7.99 | $12.99 £14.99 | $22.99 276 mm x 210 mm | 48 pages 276 mm x 210 mm | 128 pages Sales Rights: World Sales Rights: World Rights Sold: Estonia, Spain
SIMPLY REDWORK MODERN VINTAGE GIFTS Mandy Shaw Helen Philipps Publication Date: Sep-14 Publication Date: Oct-15 9781446305027 9781446305980 £15.99 | $22.99 £14.99 | $22.99 276 mm x 210 mm | 128 pages 276 mm x 210 mm | 128 pages Sales Rights: World Sales Rights: World Rights Sold: South Korea
SEW CUTE TO CUDDLE SEW CUTE TO CARRY Mariska Vos-Bolman Melanie McNeice Publication Date: Sep-14 Publication Date: Jul-14 9781446304860 9781446304181 £14.99 | $22.99 £16.99 | $24.99 276 mm x 210 mm | 128 pages 276 mm x 210 mm | 128 pages Sales Rights: World Sales Rights: World Rights Sold: France, Germany, Rights Sold: Germany, Italy, Russia, Spain Spain, South Korea
MY RAG DOLL SNUG AS A BUG Corinne Crasbercu Melanie McNeice Publication Date: May-14 Publication Date: Sep-13 9781446304846 9781446303825 £15.99 | $22.99 £7.99 | $12.99 276 mm x 210 mm | 160 pages 276 mm x 210 mm | 48 pages Sales Rights: World Sales Rights: World Rights Sold: Spain
STRAY SOCK SEWING Dan Ta|Are Wei Publication Date: Sep-08 9780715330166 £11.99 254 mm x 203 mm | 144 pages Sales Rights: World
65 www.davidandcharles.com
Catalogue.indd 65 29/01/2020 14:03 Embroidery & Sewing
IDEAS FOR CHRISTMAS A BAG FOR ALL REASONS Mandy Shaw|Barri Sue Lisa Lam Gaudet|Helen Philipps|Marion Publication Date: May-12 Elliot|Dorothy Wood|Alice 9781446301852 Butcher|Ginny Farquhar £17.99 255 mm x 203 mm | 176 pages Publication Date: Aug-13 Sales Rights: World 9781446303887 Rights Sold: Austria, Czech £6.99 Republic, Netherlands 170 mm x 170 mm | 128 pages Sales Rights: World
FREEHAND MACHINE MARTHA STEWART’S EMBROIDERY CRAFTS FOR ALL Poppy Trery OCCASIONS Martha Stewart Publication Date: Jul-12 9781446301869 Publication Date: Oct-11 £14.99 | $22.99 9781446301760 276 mm x 210 mm | 128 pages £19.99 | $30.91 Sales Rights: World 233 mm x 187 mm | 368 pages Rights Sold: Finland, Germany, Sales Rights: English Language Italy UK, Eire and Europe only
STITCH AT HOME SEWN TOY TALES Mandy Shaw Melly & Me Publication Date: Apr-12 Publication Date: Jul-11 9781446301685 9780715338452 £14.99 £14.99 | $22.99 220 mm x 215 mm | 128 pages 276 mm x 210 mm | 128 pages Sales Rights: World Sales Rights: World Rights Sold: China, Finland, Rights Sold: China, Finland, Netherlands France, Germany, Hungary, Netherlands, Russia, South Africa, Spain
STITCH WITH LOVE THE BAG MAKING BIBLE Mandy Shaw Lisa Lam|Amy Butler Publication Date: Apr-11 Publication Date: Sep-10 9780715338490 9780715336243 £14.99 | $22.99 £16.99 | $24.99 220 mm x 215 mm | 128 pages 276 mm x 210 mm | 160 pages Sales Rights: World Sales Rights: World Rights Sold: China, Finland, Rights Sold: Austria, China, France, Netherlands Czech Republic, Finland
66 www.davidandcharles.com
Catalogue.indd 66 29/01/2020 14:03 Embroidery & Sewing
21 SENSATIONAL THE BEGINNER’S GUIDE PATCHWORK BAGS TO UPHOLSTERY Susan Briscoe Vicky Grubb Publication Date: Nov-07 Publication Date: Jul-15 9780715324646 9781446305324 £15.99 | $23.99 £15.99 | $24.99 280 mm x 210 mm | 121 pages 276 mm x 210 mm | 128 pages Sales Rights: World Sales Rights: World Rights Sold: Australia, Czech Rights Sold: Germany, Italy Republic, Estonia, Germany, Netherlands, Spain
MAKING CUSHIONS THE ULTIMATE SASHIKO AND PILLOWS SOURCEBOOK Nina Granlund Sæther Susan Briscoe Publication Date: Feb-14 Publication Date: May-05 9781446304259 9780715318478 £15.99 | $24.99 £15.99 276 mm x 210 mm | 144 pages 273 mm x 210 mm | 128 pages Sales Rights: World English Sales Rights: World Language Rights Sold: China, Czech Republic, Denmark, Estonia, France, Germany, Hungary, Netherlands, Spain
HANDMADE MAKE ME I’M YOURS... SCANDINAVIAN PARTY CHRISTMAS Various Hege Barnholt Publication Date: Jul-12 Publication Date: Jul-13 9781446302309 9781446303610 £9.99 | $14.99 £16.99 | $24.99 170 mm x 170 mm | 128 pages 276 mm x 210 mm | 160 pages Sales Rights: World Sales Rights: World English Rights Sold: Portugal Language excluding Scandinavia and Germany
67 www.davidandcharles.com
Catalogue.indd 67 29/01/2020 14:03 QUILTS FROM TILDA’S STUDIO Tone Finnanger
This unique collection of Tilda quilt patterns and co-ordinating pillows is a great addition to the Tilda library. The designs include beautiful photographs of the ȴnished quilts plus in-depth step-by-step instructions, with diagrams to guide readers every step of the way. Featuring the latest Tilda fabrics and patterns, this stunning collection will not disappoint Tilda fans new and old.
Publication Date: Oct-19 9781446307441 £16.99 | $24.99 273 mm x 210 mm | 144 pages Sales Rights: World Rights Sold: Spain
TILDA SUNSHINE TILDA HOT CHOCOLATE SEWING SEWING Tone Finnanger Tone Finnanger Publication Date: Mar-18 Publication Date: Sep-18 9781446307021 9781446307267 £12.99 | $17.99 £16.99 | $24.99 273 mm x 210 mm | 80 pages 273 mm x 210 mm | 144 pages Sales Rights: World Sales Rights: World Rights Sold: Italy, Spain Rights Sold: Czech Republic, Hungary, Russia, Spain
TILDA’S SEASONAL TILDA SEWING IDEAS COLLECTION BY HEART Tone Finnanger Tone Finnanger Publication Date: May-17 Publication Date: Sep-17 9781446306680 9781446306710 £14.99 | $21.99 £16.99 | $24.99 276 mm x 210 mm | 144 pages 273 mm x 210 mm | 144 pages Sales Rights: World Sales Rights: World Rights Sold: Czech Republic Rights Sold: France, Hungary, Italy, Spain
Catalogue.indd 68 29/01/2020 14:03 CRAFTING TILDA’S TILDA’S TOY BOX FRIENDS Tone Finnanger Tone Finnanger Publication Date: Oct-15 Publication Date: Feb-10 9781446306154 9780715336663 £16.99 | $24.99 £8.99 | $12.99 225 mm x 210 mm | 144 pages 279 mm x 216 mm | 64 pages Sales Rights: World Sales Rights: World Rights Sold: Brazil, China, Rights Sold: China, France, Czech Republic, France, Hungary, Italy, Russia, Spain, Hungary, Italy, Poland, Russia, South Korea, Taiwan Spain, South Korea
TILDA HOMEMADE TILDA’S WINTER AND HAPPY DELIGHTS Tone Finnanger Tone Finnanger Publication Date: Oct-14 Publication Date: Dec-13 9781446305904 9781446304006 £15.99 | $22.99 £8.99 | $12.99 276 mm x 210 mm | 144 pages 276 mm x 210 mm | 48 pages Sales Rights: World Sales Rights: World Rights Sold: Brazil, China, Rights Sold: France, France, Hungary, Italy, Russia, Hungary, Italy, Russia, Spain, Spain, South Korea South Korea
CRAFTING CHRISTMAS SEW PRETTY GIFTS HOMESTYLE Tone Finnanger Tone Finnanger Publication Date: Sep-06 Publication Date: Sep-07 9780715325506 9780715327494 £8.99 | $12.99 £12.99 | $22.99 279 mm x 216 mm | 96 pages 279 mm x 216 mm | 144 pages Sales Rights: World Sales Rights: World Rights Sold: China, France, Rights Sold: China, Czech Hungary, Italy, Poland, Russia, Republic, France, Hungary, Spain, South Korea Italy, Netherlands, Poland, Russia, Slovenia, Spain, Taiwan, Thailand
CRAFTING SPRINGTIME GIFTS Tone Finnanger Publication Date: Feb-06 9780715322901 £7.99 279 mm x 216 mm | 80 pages Sales Rights: World Rights Sold: China, France, Hungary, Italy, Russia, Spain
Catalogue.indd 69 29/01/2020 14:03 Quilting - Pam & Nicky Lintott
NEW WAYS WITH JELLY ROLL QUILTS JELLY ROLLS IN A WEEKEND Pam Lintott|Nicky Lintott Pam Lintott|Nicky Lintott Publication Date: Sep-14 Publication Date: Apr-17 9781446304761 9781446306574 £16.99 | $24.99 £15.99 | $24.99 276 mm x 210 mm | 128 pages 276 mm x 210 mm | 128 pages Sales Rights: World Sales Rights: World Rights Sold: Germany
QUICK QUILTS JELLY ROLL SAMPLER WITH RULERS QUILTS Pam Lintott|Nicky Lintott Pam Lintott|Nicky Lintott Publication Date: Mar-14 Publication Date: May-11 9781446304693 9780715338445 £15.99 | $24.99 £15.99 | $24.99 276 mm x 210 mm | 128 pages 276 mm x 210 mm | 128 pages Sales Rights: World Sales Rights: World Rights Sold: Netherlands
DESSERT ROLL QUILTS LAYER CAKE, JELLY ROLL Pam Lintott|Nicky Lintott AND CHARM QUILTS Publication Date: May-13 Pam Lintott|Nicky Lintott 9781446303542 Publication Date: May-09 £16.99 | $24.99 9780715332085 276 mm x 210 mm | 128 pages £15.99 | $24.99 Sales Rights: World 276 mm x 210 mm | 128 pages Sales Rights: World Rights Sold: Netherlands
TWO FROM ONE JELLY ANTIQUE TO HEIRLOOM ROLL QUILTS JELLY ROLL QUILTS Pam Lintott|Nicky Lintott Pam Lintott|Nicky Lintott Publication Date: Jul-10 Publication Date: Aug-12 9780715337561 9781446301821 £14.99 | $24.99 £16.99 | $24.99 277 mm x 212 mm | 128 pages 276 mm x 210 mm | 128 pages Sales Rights: World Sales Rights: World Rights Sold: Netherlands
JELLY ROLL QUILTS Lintott, Pam Publication Date: May-08 9780715328637 £14.99 | $24.99 278 mm x 210 mm | 128 pages Sales Rights: World Rights Sold: Netherlands
70 www.davidandcharles.com
Catalogue.indd 70 29/01/2020 14:03 Quilting - Lynette Anderson
STITCH IT FOR SPRING COUNTRY COTTAGE Lynette Anderson QUILTING Publication Date: Jun-13 Lynette Anderson 9781446303177 Publication Date: Mar-12 £7.99 | $12.99 9781446300398 276 mm x 210 mm | 48 pages £15.99 | $24.99 Sales Rights: World 276 mm x 210 mm | 128 pages Rights Sold: France, Russia Sales Rights: World Rights Sold: France, Netherlands, Spain
COUNTRY STYLE STITCH IT FOR QUILTING CHRISTMAS Lynette Anderson Lynette Anderson Publication Date: Oct-15 Publication Date: Jul-12 9781446305959 9781446302538 £15.99 | $24.99 £7.99 276 mm x 210 mm | 128 pages 276 mm x 210 mm | 48 pages Sales Rights: World Sales Rights: World Rights Sold: France
STITCH IT FOR AUTUMN Lynette Anderson Publication Date: Oct-13 9781446303207 £7.99 | $12.99 276 mm x 210 mm | 48 pages Sales Rights: World
71 www.davidandcharles.com
Catalogue.indd 71 29/01/2020 14:03 Quilting
CUSHIONS & QUILTS BEGINNER’S GUIDE Jo Colwill TO QUILTING Elizabeth Betts Publication Date: Aug-13 9781446302569 Publication Date: Jun-13 £16.99 | $24.99 9781446302545 276 mm x 210 mm | 128 pages £14.99 | $24.99 Sales Rights: World 276 mm x 210 mm | 128 pages Sales Rights: World Rights Sold: Australia, Germany, Portugal, Russia, South Africa
STASH-BUSTER QUILTS THE ESSENTIAL SAMPLER Lynne Edwards QUILT BOOK Lynne Edwards Publication Date: Aug-08 9780715324639 Publication Date: Jul-10 £14.99 | $24.99 9780715336137 279 mm x 216 mm | 144 pages £19.99 | $29.99 Sales Rights: World 276 mm x 210 mm | 256 pages Rights Sold: Australia, New Sales Rights: World Zealand Rights Sold: Netherlands
25 WAYS TO SEW JELLY PATCHWORK QUILTS ROLLS, LAYER CAKES & GIFTS AND CHARM PACKS Jo Colwill Brioni Greenberg Publication Date: Sep-15 Publication Date: Sep-13 9781446305263 9781446302934 £16.99 | $24.99 £16.99 | $24.99 276 mm x 210 mm | 128 pages 276 mm x 210 mm | 128 pages Sales Rights: World Sales Rights: World Rights Sold: Australia Rights Sold: Czech Republic
72 www.davidandcharles.com
Catalogue.indd 72 29/01/2020 14:03 Quilting
QUILT ESSENTIALS: THE 1718 COVERLET JAPANESE STYLE Susan Briscoe|Kae Fassett Susan Briscoe Publication Date: Jul-16 Publication Date: Mar-13 9781446304440 9781446303504 £15.99 | $24.99 £6.99 | $12.99 276 mm x 210 mm | 144 pages 276 mm x 210 mm | 32 pages Sales Rights: World Sales Rights: World
QUILT IMPROV QUILT A GIFT Lucie Summers FOR CHRISTMAS Publication Date: Sep-13 Barrie Sue Gaudet 9781446302941 Publication Date: Jul-12 £16.99 | $24.99 9781446301845 276 mm x 210 mm | 128 pages £15.99 | $24.99 Sales Rights: World 276 mm x 210 mm | 128 pages Rights Sold: Germany Sales Rights: World
THE QUILTER’S BIBLE ANIMAL QUILTS Linda Clements Juliet van der Heijden Publication Date: Mar-11 Publication Date: Oct-17 9780715336267 9781446306673 £19.99 | $29.99 £16.99 | $24.99 276 mm x 210 mm | 256 pages 273 mm x 210 mm | 128 pages Sales Rights: World Sales Rights: World Rights Sold: China, France, Germany, Italy, Netherlands, South Korea
73 www.davidandcharles.com
Catalogue.indd 73 29/01/2020 14:03 Papercraft
BETTER LIVING PAPERIE THROUGH ORIGAMI Kirsty Neale Nellianna van den Publication Date: Jul-14 Baard|Kenneth Veenenbos 9781446304273 Publication Date: Sep-18 £14.99 | $22.99 9781446307120 276 mm x 210 mm | 160 pages £15.99 | $22.99 Sales Rights: World 229 mm x 216 mm | 128 pages Rights Sold: Germany Sales Rights: World Rights Sold: Belgium, South Korea
READY STEADY ORIGAMI QUICK AND CLEVER Didier Boursin HANDMADE CARDS Publication Date: Sep-10 Julie Hickey 9780715338407 Publication Date: Sep-04 £12.99 9780715316603 195 mm x 210 mm | 344 pages £12.99 | $19.99 Sales Rights: World 279 mm x 216 mm | 112 pages Sales Rights: World Rights Sold: Finland, France, Hungary, Indonesia, Norway, Poland, Slovenia
WASHI TAPE CHRISTMAS Kami Bigler Publication Date: Oct-14 9781446305034 £9.99 | $14.99 276 mm x 210 mm | 64 pages Sales Rights: World Rights Sold: Belgium, Taiwan
74 www.davidandcharles.com
Catalogue.indd 74 29/01/2020 14:03 Jewellery & Other Craft
THE BEAD JEWELLERY TIE DIP DYE BIBLE Pepa Martin|Karen Davis Dorothy Wood Publication Date: Jan-15 Publication Date: Jul-11 9781446304877 9780715338704 £14.99 £16.99 246 mm x 190 mm | 128 pages 276 mm x 210 mm | 160 pages Sales Rights: English Language Sales Rights: World Uk & Europe Only
FROM PASSION TO THE CRAFT SELLER’S PROFIT - START YOUR COMPANION BUSINESS IN 6 WEEKS Caroline Taggart OR LESS! Publication Date: May-13 Claire Hughes 9781446303108 Publication Date: Oct-14 £12.99 9781446305010 240 mm x 192 mm | 208 pages £14.99 | $22.99 Sales Rights: World 234 mm x 156 mm | 128 pages Sales Rights: World Rights Sold: Thailand
STYLE YOUR MODERN THE NATURAL AND VINTAGE HOME HANDMADE SOAP BOOK Kate Beavis|Paloma Faith Sarah Harper Publication Date: Aug-13 Publication Date: Sep-14 9781446303443 9781446304174 £19.99 | $24.99 £15.99 | $24.99 276 mm x 210 mm | 160 pages 276 mm x 210 mm | 128 pages Sales Rights: World Sales Rights: World Rights Sold: China, Estonia, Finland, Spain, Taiwan
VINTAGE CARAVAN THE COMPLETE VINTAGE STYLE WEDDING GUIDE Lisa Mora Lucy Morris Publication Date: May-14 Publication Date: Nov-13 9781446304518 9781446303573 £15.99 £17.99 | $27.99 220 mm x 215 mm | 160 pages 276 mm x 210 mm | 144 pages Sales Rights: World Sales Rights: World
75 www.davidandcharles.com
Catalogue.indd 75 29/01/2020 14:03 Cake Decorating
BUTTERCREAM ONE-TIER BUTTERCREAM FLOWERS WONDERS FOR ALL SEASONS Valeri Valeriano|Christina Ong Valeri Valeriano|Christina Ong Publication Date: Apr-16 Publication Date: Jan-18 9781446306215 9781446306642 £15.99 | $24.99 £15.99 | $24.99 276 mm x 210 mm | 144 pages 273 mm x 210 mm | 144 pages Sales Rights: World Sales Rights: World Rights Sold: China, Germany Rights Sold: China
100 BUTTERCREAM THE CONTEMPORARY FLOWERS BUTTERCREAM BIBLE Valeri Valeriano|Christina Ong Valeri Valeriano|Christina Ong Publication Date: Apr-15 Publication Date: May-14 9781446305744 9781446303986 £16.99 | $24.99 £15.99 | $24.99 276 mm x 210 mm | 144 pages 273 mm x 210 mm | 160 pages Sales Rights: World Sales Rights: World Rights Sold: China, Denmark, Rights Sold: China, Germany, Estonia, France, Germany, Italy, Spain, South Korea Spain, South Korea, Taiwan
MODERN SUGAR WAFER PAPER CAKES FLOWERS Stevi Auble Jacqueline Butler Publication Date: Oct-17 Publication Date: Apr-17 9781446306604 9781446306468 £15.99 | $23.99 £19.99 | $26.99 273 mm x 210 mm | 128 pages 276 mm x 210 mm | 160 pages Sales Rights: World Sales Rights: World Rights Sold: China, Germany Rights Sold: China, Czech Republic, Germany, South Korea, Taiwan
THE GILDED CAKE CHIC & UNIQUE Faye Cahill WEDDING CAKES Publication Date: Sep-18 Zoe Clark 9781446307113 Publication Date: Oct-14 £19.99 | $26.99 9781446301630 273 mm x 210 mm | 144 pages £14.99 | $22.99 Sales Rights: World 276 mm x 210 mm | 128 pages Sales Rights: World Rights Sold: China, Netherlands
BAKE ME I’M YOURS... CHIC & UNIQUE CAKE POPS CELEBRATION CAKES Carolyn White Zoe Clark Publication Date: Sep-11 Publication Date: Aug-11 9781446301371 9781446301715 £9.99 | $14.99 £18.99 170 mm x 170 mm | 128 pages 276 mm x 210 mm | 128 pages Sales Rights: World Sales Rights: World Rights Sold: Belgium, Germany, Italy, Russia
76 www.davidandcharles.com
Catalogue.indd 76 29/01/2020 14:03 Cake Decorating
LINDY SMITH’S MINI SIMPLY PERFECT PARTY CAKES ACADEMY CAKES FOR KIDS Lindy Smith Zoe Clark Publication Date: Oct-14 Publication Date: Sep-14 9781446304075 9781446304266 £19.99 £15.99 | $24.99 276 mm x 210 mm | 144 pages 276 mm x 210 mm | 128 pages Sales Rights: World Sales Rights: World Rights Sold: Germany Rights Sold: Germany, Italy
SIMPLY MODERN CHIC & UNIQUE WEDDING CAKES VINTAGE CAKES Lindy Smith Zoe Clark Publication Date: Mar-16 Publication Date: Aug-13 9781446306017 9781446302842 £19.99 £19.99 | $24.99 276 mm x 210 mm | 144 pages 276 mm x 210 mm | 128 pages Sales Rights: World Sales Rights: World Rights Sold: China, Germany, Spain
CHARACTER CAKE THE CAKE PARLOUR TOPPERS SWEET TABLES Maisie Parrish Zoe Clark Publication Date: Mar-13 Publication Date: Jul-12 9781446302729 9781446302002 £14.99 | $22.99 £14.99 | $23.99 276 mm x 210 mm | 128 pages 276 mm x 210 mm | 128 pages Sales Rights: World Sales Rights: World Rights Sold: Germany, Spain Rights Sold: Netherlands
FUN & ORIGINAL CAKES FUN AND ORIGINAL FOR MEN & BOYS CHILDREN’S CAKES Maisie Parrish Maisie Parrish Publication Date: May-12 Publication Date: Mar-10 9781446301623 9780715336311 £14.99 | $23.99 £14.99 | $22.99 276 mm x 210 mm | 128 pages 276 mm x 210 mm | 128 pages Sales Rights: World Sales Rights: World Rights Sold: Netherlands Rights Sold: Netherlands, Spain
THE CONTEMPORARY BUSY GIRLS GUIDE TO CAKE DECORATING CAKE DECORATING BIBLE Ruth Clemens Lindy Smith Publication Date: Apr-12 Publication Date: Oct-11 9781446301647 9780715338360 £14.99 | $23.99 £19.99 220 mm x 215 mm | 128 pages 276 mm x 210 mm | 160 pages Sales Rights: World Sales Rights: World Rights Sold: France Rights Sold: Australia, China, Germany, Italy, Netherlands, Spain, Thailand
77 www.davidandcharles.com
Catalogue.indd 77 29/01/2020 14:04 Equestrian & Pets
HORSE ANATOMY FOR HOW YOUR HORSE PERFORMANCE MOVES Gillian Higgins|Stephanie Martin Gillian Higgins|Stephanie Martin Publication Date: Apr-12 Publication Date: Aug-11 9781446300961 9781446300992 £19.99 £16.99 263 mm x 193 mm | 160 pages 263 mm x 193 mm | 160 pages Sales Rights: World Sales Rights: World Rights Sold: Czech Republic, Rights Sold: Czech Republic, France, Germany, Netherlands, Denmark, Finland, France, Poland, Slovenia Germany, Hungary, Japan, Netherlands, Poland, Spain, Sweden, Italy
101 SCHOOLING 101 HORSEMANSHIP EXERCISES EXERCISES Jaki Bell|Andrew Day Rio Barrett Publication Date: Apr-08 Publication Date: Oct-07 9780715329757 9780715326725 £14.99 £19.99 | $29.99 279 mm x 216 mm | 224 pages 279 mm x 216 mm | 224 pages Sales Rights: World Sales Rights: World Rights Sold: China, Japan, Rights Sold: France, Netherlands, Poland, Spain, Netherlands South Korea
100 WAYS TO TRAIN THE 100 WAYS TO PERFECT DOG UNDERSTAND YOUR CAT Sarah Fisher|Marie Miller Roger Tabor Publication Date: Nov-08 Publication Date: 9780715329412 9780715321607 £12.99 | $19.99 £12.99 276 mm x 210 mm | 144 pages 278 mm x 216 mm | pages Sales Rights: World Sales Rights: World Rights Sold: China, Finland, Rights Sold: China, Czech France, Netherlands, Romania, Republic, Denmark, Finland, Spain, South Korea France, Germany, Greece, Hungary, Netherlands, Norway, Poland, Spain, Taiwan
78 www.davidandcharles.com
Catalogue.indd 78 29/01/2020 14:04 Art Techniques
THE FASHION DESIGN CUTTING-EDGE FASHION WORKBOOK ILLUSTRATION Annabel Bénilan Erica Sharp Publication Date: Jul-14 Publication Date: May-14 9781446304914 9781446304365 £12.99 | $22.99 £15.99 | $24.99 276 mm x 210 mm | 128 pages 276 mm x 210 mm | 128 pages Sales Rights: World Sales Rights: World Rights Sold: Rights Sold: France, Turkey
COLOUR MIXING BIBLE FASHION ILLUSTRATION Ian Sidaway Anna Kiper Publication Date: Feb-04 Publication Date: Mar-11 9780715318232 9780715336182 £15.99 £17.99 | $26.99 230 mm x 230 mm | 144 pages 276 mm x 210 mm | 144 pages Sales Rights: World English Sales Rights: World Language Rights Sold: China, France, Germany, Netherlands, Russia, Spain, South Korea, Turkey
THE FASHION DOODLE KEN HOWARD: A BOOK PERSONAL VIEW Annabel Bénilan|Violette Ken Howard|Sally Bulgin Bénilan Publication Date: Sep-01 Publication Date: Mar-14 9780715312377 9781446304549 £16.99 | $19.99 £9.99 | $14.99 290 mm x 218 mm | 128 pages 260 mm x 185 mm | 144 pages Sales Rights: World Sales Rights: World English Rights Sold: China Language
LEONARDO DA VINCI Leonardo da Vinci Publication Date: Apr-06 9780715324530 £12.99 152 mm x 118 mm | 640 pages Sales Rights: World English Language
79 www.davidandcharles.com
Catalogue.indd 79 29/01/2020 14:04 General
THE MET OFFICE THE MET OFFICE POCKET BOOK OF THE BRITISH CLOUD BOOK WEATHER Richard Hamblyn The Met Oɝce Publication Date: May-10 Publication Date: Jun-10 9780715337615 9780715336403 £8.99 £9.99 140 mm x 106 mm | 128 pages 200 mm x 168 mm | 160 pages Sales Rights: World Sales Rights: World
THE CLOUD BOOK FIFTY RAILWAYS THAT The Met Oɝce|Richard CHANGED THE COURSE Hamblyn OF HISTORY Publication Date: Mar-08 Bill Laws 9780715328088 Publication Date: Jul-13 £9.99 | $16.99 9781446302903 168 mm x 245 mm | 160 pages £12.99 Sales Rights: World 227 mm x 170 mm | 224 pages Rights Sold: China, France, Sales Rights: World English Germany, Netherlands, Poland, Language South Korea
FIFTY PLANTS THAT FIFTY ANIMALS THAT CHANGED THE COURSE CHANGED THE COURSE OF HISTORY OF HISTORY Bill Laws Eric Chaline Publication Date: Nov-10 Publication Date: Nov-11 9780715338544 9781446301432 £12.99 £14.99 | $20.73 227 mm x 170 mm | 224 pages 227 mm x 170 mm | 224 pages Sales Rights: World English Sales Rights: World English Language Language
KINGS & QUEENS Cavendish, Richard Publication Date: Oct-07 9780715323762 £10.99 | $14.99 155 mm x 121 mm | 480 pages Sales Rights: World
80 www.davidandcharles.com
Catalogue.indd 80 29/01/2020 14:04 Photography
THE BUSY GIRL’S DAVID NOTON GUIDE TO DIGITAL THE VISION PHOTOGRAPHY David Noton Lorna Yabsley Publication Date: Oct-13 Publication Date: Oct-13 9781446302965 9781446303160 £25.00| $24.99 £17.99 | $24.99 240 mm x 260 mm | 160 pages 220 mm x 215 mm | 144 pages Sales Rights: World Sales Rights: World Rights Sold: China Rights Sold: China, Russia, South Korea, Taiwan
50 PHOTO PROJECTS - THE COMPLETE GUIDE IDEAS TO KICKSTART TO DIGITAL NIGHT YOUR PHOTOGRAPHY AND LOW-LIGHT Frost, Lee PHOTOGRAPHY Publication Date: Aug-11 Tony Worobiec 9780715329764 Publication Date: Jul-10 £15.99 | $24.99 9780715338551 186 mm x 215 mm | 160 pages £14.99 | $24.99 Sales Rights: World 276 mm x 210 mm | 144 pages Rights Sold: Bulgaria, China, Sales Rights: World Russia Rights Sold: Australia, China, Poland, Taiwan
81 www.davidandcharles.com
Catalogue.indd 81 29/01/2020 14:04 Travel
MEMORIES OF STEAM UISTS AND BARRA Tom Quinn Francis Thompson Publication Date: Sep-08 Publication Date: Mar-08 9780715329566 9780715328903 £25.00| $19.99 £8.99 276 mm x 210 mm | 256 pages 250 mm x 190 mm | 112 pages Sales Rights: World Sales Rights: World
ARRAN SKYE Robert McLellan|Norman Norman S. Newton Newton Publication Date: Sep-07 Publication Date: Mar-08 9780715328873 9780715328910 £7.99 £7.99 250 mm x 190 mm | 112 pages 250 mm x 190 mm | 112 pages Sales Rights: World Sales Rights: World
ISLAY LEWIS AND HARRIS Norman Newton Francis Thompson Publication Date: Apr-07 Publication Date: Apr-07 9780715334959 9780715327210 £7.99 £7.99 250 mm x 190 mm | 112 pages 250 mm x 190 mm | 112 pages Sales Rights: World Sales Rights: World
100 GREATEST WALKS IN BRITAIN “Country Walking” Magazine Publication Date: May-10 9780715337752 £16.99 210 mm x 175 mm | 208 pages Sales Rights: World
82 www.davidandcharles.com
Catalogue.indd 82 29/01/2020 14:04 Other Titles available
BAKE ME I’M YOURS... PUSH POP CAKES Katie Deacon Publication Date: Jan-13 | 9781446303061 | £9.99 | $14.99 | 170 mm x 170 mm | 128 pages
SEASONAL CUPCAKES Carolyn White Publication Date: Oct-12 | 9781446303016 | £5.99 | 276 mm x 210 mm | 48 pages
CREATIVE ÉCLAIRS Ruth Clemens Publication Date: Apr-14 | 9781446303870 | £14.99 | $22.99 | 220 mm x 215 mm | 128 pages
MAISIE PARRISH’S NAUGHTY CAKES Maisie Parrish Publication Date: Apr-14 | 9781446303832 | £15.99 | $24.99 | 276 mm x 210 mm | 128 pages
THE CONTEMPORARY CAKE DECORATING BIBLE: FLOWERS Lindy Smith Publication Date: Nov-13 | 9781446304068 | £6.99 | $10.99 | 246 mm x 210 mm | 32 pages
THE CONTEMPORARY CAKE DECORATING BIBLE: PIPING Lindy Smith Publication Date: Nov-13 | 9781446304051 | £6.99 | $10.99 | 246 mm x 210 mm | 32 pages
THE CONTEMPORARY CAKE DECORATING BIBLE: STENCILLING Lindy Smith Publication Date: Nov-13 | 9781446304044 | £6.99 | $10.99 | 246 mm x 210 mm | 32 pages
CHIC & UNIQUE CELEBRATION CAKES Zoe Clark Publication Date: Sep-13 | 9780715338384 | £14.99 | | 276 mm x 210 mm | 128 pages
CREATIVE COLOUR FOR CAKE DECORATING Lindy Smith Publication Date: Sep-13 | 9781446302378 | £19.99 | | 276 mm x 210 mm | 144 pages
BAKE ME I’M YOURS... SWEET BITESIZE BAKES Sarah Trivuncic Publication Date: Jun-12 | 9781446301838 | £9.99 | 170 mm x 170 mm | 128 pages
FUN & ORIGINAL BIRTHDAY CAKES Maisie Parrish Publication Date: Mar-11 | 9780715338339 | £14.99 | $22.99 | 276 mm x 210 mm | 128 pages
CAKES FOR ROMANTIC OCCASIONS Clee-Cadman, May Publication Date: Nov-10 | 9780715331545 | £14.99 | $24.99 | 276 mm x 212 mm | 128 pages
83 www.davidandcharles.com
Catalogue.indd 83 29/01/2020 14:04 Other Titles available
FUN AND ORIGINAL CHARACTER CAKES Maisie Parrish Publication Date: Jun-09 | 9780715330050 | £14.99 | $22.99 | 276 mm x 210 mm | 128 pages
SWEET AND SIMPLE PARTY CAKES May Clee-Cadman Publication Date: Oct-08 | 9780715326879 | £14.99 | $19.99 | 276 mm x 210 mm | 144 pages
CAKES TO INSPIRE AND DESIRE Lindy Smith Publication Date: Nov-07 | 9780715324974 | £14.99 | $24.99 | 280 mm x 220 mm | 144 pages
PARTY ANIMAL CAKES Smith, Lindy Publication Date: Mar-06 | 9780715322079 | £12.99 | $21.99 | 280 mm x 218 mm | 112 pages
TEDDY BEARS IN CROSS STITCH Various Designers Publication Date: Oct-08 | 9780715329337 | £19.99 | 279 mm x 216 mm | 112 pages
QUILT A GIFT Barri Sue Gaudet Publication Date: Nov-09 | 9780715332825 | £14.99 | $24.99 | 276 mm x 210 mm | 128 pages
FLORAL DIMENSIONS Pauline Ineson Publication Date: May-12 | 9781446301814 | £15.99 | | 276 mm x 210 mm | 128 pages
QUILT A GIFT FOR LITTLE ONES Barri Sue Gaudet Publication Date: Aug-11 | 9780715338667 | £15.99 | | 276 mm x 210 mm | 128 pages
FOLK QUILT APPLIQUE Clare Kingslake Publication Date: Jul-11 | 9780715338261 | £15.99 | $24.99 | 276 mm x 210 mm | 128 pages
SEW FABULOUS FABRIC Alice Butcher|Ginny Farquhar Publication Date: Sep-08 | 9780715328583 | £12.99 | $22.99 | 279 mm x 216 mm | 128 pages
LOVE LEATHER ACCESSORIES Zoe Larkins Publication Date: Oct-14 | 9781446304792 | £14.99 | $22.99 | 220 mm x 216 mm | 128 pages
STITCH STYLE SWEET DREAMS Margaret Rowan Publication Date: Oct-14 | 9781446305157 | £12.99 | $19.99 | 276 mm x 210 mm | 96 pages
84 www.davidandcharles.com
Catalogue.indd 84 29/01/2020 14:04 Other Titles available
DANCE WITH ME DRESS Lisa Lam Publication Date: Jun-14 | 9781446304198 | £9.99 | $14.99 | 276 mm x 210 mm | 20 pages
HAPPINESS HALTER PLAYSUIT Lisa Lam Publication Date: Jun-14 | 9781446304464 | £9.99 | $14.99 | 276 mm x 210 mm | 20 pages
STITCHED SAFARI Tomomi Maeda Publication Date: Jan-13 | 9781446302651 | £14.99 | $22.99 | 276 mm x 210 mm | 128 pages
HEADS UP Carol Meldrum Publication Date: Jul-12 | 9781446301920 | £12.99 | 220 mm x 215 mm | 96 pages
THE STITCH BIBLE Kate Haxell Publication Date: Jul-12 | 9781446301661 | £15.99 | $23.99 | 267 mm x 210 mm | 176 pages
SIMPLE SEWN GIFTS Helen Philipps Publication Date: Aug-10 | 9780715337776 | £14.99 | $22.99 | 276 mm x 210 mm | 128 pages
101 GREAT WAYS TO SEW A METRE Patricia Hoskins|Rebecca Yaker Publication Date: May-10 | 9780715337783 | £16.99 | 224 mm x 212 mm | 304 pages
FAST FABRIC GIFTS Sally Southern Publication Date: Apr-10 | 9780715330401 | £14.99 | $22.99 | 276 mm x 210 mm | 128 pages
CRAFT BOMB YOUR BIKE Shara Ballard Publication Date: Aug-14 | 9781446305256 | £14.99 | 220 mm x 215 mm | 128 pages
HANDMADE PERSONALIZED PHOTO GIFTS Carla Visser Publication Date: Jul-14 | 9781446304990 | £14.99 | $22.99 | 260 mm x 193 mm | 128 pages Sales Rights: World English Language excluding South Africa
85 www.davidandcharles.com
Catalogue.indd 85 29/01/2020 14:04 HOW TO GET IN TOUCH
JAMES WOOLLAM CUSTOMER SERVICES & ORDERING: Managing Director GBS [email protected] UK Trade Tel: +44 (0)1476 541080 Tel: +44(0)1392 302660 [email protected] International Trade Tel: +44 (0)1476 541082 [email protected] AME VERSO Credit Services Publishing Director [email protected]
[email protected] INTERNATIONAL RIGHTS AGENTS: Tel: +44(0)1392 302663 All rights and permissions enquiries to Sam Vallance Tel: +44 (0)1392 302676 [email protected] BEL YOULDON Commercial Director Denmark, Finland, Norway, Sweden, The Netherlands [email protected] Candida Buckley Tel: +44(0)1225 333495 Tel: +44(0)1392 302665 Mobile:07774 871512 [email protected]
France Brigitte Perivier RACHEL MACPHAIL Literary Agent France Head of UK Sales 10 rue Gustave Dore 75017 Paris [email protected] France Tel: +44(0)1392 302674 Tel: +33 143 202 542 Fax: +33 143 202 542 [email protected]
SAM VALLANCE International Sales Director
[email protected] Tel: +44(0)1392 302676
KELLY RULE International Sales Executive
[email protected] Tel: +44(0)1392 302672
Catalogue.indd 86 29/01/2020 14:04 UK & INTERNATIONAL Asia Ghana & Nigeria SALES REPRESENTATIVES: Chris Ashdown Femi Anulopo Publishers International Marketing Rombic Concepts Ltd For Uk art and craft trade Mobile 07866 777246 Learning Solutions Building enquiries please contact Search [email protected] 24 Osuntokun Avenue,Bodija Press www.pim-uk.com Mapo PO Box 25256 Tel: +44 (0)1892 510850 Ibadan, [email protected] India, Bangladesh, Bhutan, Nigeria Nepal, Sri Lanka Tel: +234(0)8033280593; Northern Ireland & Eire +234(0)8055610112 Nigel Carré MAYA PUBLISHERS PVT LTD [email protected] 1 Glenheron Walk 4821, Parwana Bhawan (3rd Greystones Floor) Australia Co. Wicklow 24, Ansari Road, Daryaganj Peribo Pty Ltd Ireland NEW DELHI - 110 002 (India) 58 Beaumont Road, A63 CV40 Tel : + 91 11 43549145 Mount Kuring-Gai Tel: +353 (0) 86 0861290 / 23243829 NSW 2080 [email protected] [email protected] Australia Tel: +61 (0)2 9457 0011 Southern & Eastern Europe Pakistan Fax: +61(0)2 9457 0022 and Russia Tahir Lodhi [email protected] Durnell Marketing Publishers Representatives www.peribo.com.au Linden Park C.C. 14-G Canalberg H.S Fir Tree Road Multan Road Lahore.53700 New Zealand Tunbridge Wells Pakistan David Bateman Ltd TN4 8AH Tel:-+92-42-35292168 Unit 2/5 Workspace Drive United Kingdom Cell:-+923008419436 Hobonville 0618 Tel: +44 (0)1892 544272 [email protected] Auckland, [email protected] New Zealand South Africa Tel: +64 9 415 7664 Scandinavia, Central & Blue Weaver Fax: +64 9 415 8892 South America and The Cape Town [email protected] Caribbean PO Box 30370 Kelly Rule Tokai, Cape Town United States [email protected] 7966 Distribution to the trade by Two South Africa Rivers Distribution, an Ingram Middle East Tel: +27 (0) 21 701-4477 brand. Richard Ward Fax: +27 (0) 21 701-7302 Orders and Customer Service: Ward International Books export [email protected] Ingram Content Group LLC Ltd, Unit 16, One Ingram Blvd. 264 lavender Hill, La Vergne, TN 37086 London, SW11 1IJ , UK Tel: 866-400-5351 Tel: +44 (0)20 8672 1171 [email protected] [email protected] [email protected]
All other enquiries to the appropriate department at:
David and Charles Ltd | 1 Emperor Way | Exeter Business Park | Exeter | EX13QS | UK +44 (0)1392 790650 | [email protected] | www.davidandcharles.com
Catalogue.indd 87 29/01/2020 14:04 Catalogue.indd 88 29/01/2020 14:04 Celebrating 60 Years
NEW TITLES SPRING 2020
Get in touch...
+44 (0)1392 790650 [email protected] www.davidandcharles.com
catalogue_jacket2020.indd 1 30/01/2020 14:41