Volume 2 Issue 4

Total Page:16

File Type:pdf, Size:1020Kb

Load more

PIF – A++ ISSN 2581-6349 VOLUME 2 ISSUE IV || SEPTEMBER 2020 || Email: [email protected] Website: www.jurisperitus.co.in 1 PIF – A++ ISSN 2581-6349 DISCLAIMER No part of this publication may be reproduced or copied in any form by any means without prior written permission of Editor-in-chief of Jurisperitus – The Law Journal. The Editorial Team of Jurisperitus holds the copyright to all articles contributed to this publication. The views expressed in this publication are purely personal opinions of the authors and do not reflect the views of the Editorial Team of Jurisperitus or Legal Education Awareness Foundation. Though all efforts are made to ensure the accuracy and correctness of the information published, Jurisperitus shall not be responsible for any errors caused due to oversight or otherwise. 2 PIF – A++ ISSN 2581-6349 EDITORIAL TEAM Editor-in-Chief ADV. SIDDHARTH DHAWAN Core-Team Member || Legal Education Awareness Foundation Phone Number + 91 9013078358 Email ID – [email protected] Additional Editor -in-Chief ADV. SOORAJ DEWAN Founder || Legal Education Awareness Foundation Phone Number + 91 9868629764 Email ID – [email protected] Editor MR. RAM AVTAR Senior General Manager || NEGD Ministry of Electronics and Information Technology Phone Number +91 9968285623 Email ID: [email protected] SMT. BHARTHI KUKKAL Principal || Kendriya Vidyalaya Sangathan, New Delhi Ministry of Human Resource and Development Phone Number + 91 9990822920 Email ID: [email protected] MS. NIKHITA Assistant Manager || Deloitte India Phone Number +91 9654440728 Email ID: [email protected] MR. TAPAS BHARDWAJ Member || Raindrops Foundation Phone + 91 9958313047 Email ID: [email protected] 3 PIF – A++ ISSN 2581-6349 ABOUT US Jurisperitus: The Law Journal is a non-annual journal incepted with an aim to provide a platform to the masses of our country and re-iterate the importance and multi-disciplinary approach of law. This journal is an initiative by Legal Education and Awareness Foundation, a registered Non-Governmental Organization, which aims at providing legal education and awareness to all parts of the country beyond any social and economic barriers. We, at Jurisperitus believe in the principles of justice, morality and equity for all. We hope to re-ignite those smoldering embers of passion that lie buried inside us, waiting for that elusive spark. With this thought, we hereby present to you Jurisperitus: The Law Journal. 4 PIF – A++ ISSN 2581-6349 INDEX S No. TITLE AUTHOR(S) PAGE 1 DEATH ROW PHENOMENON: HARSHITA 10 REALITY BEHIND THE HIGH WALLS KAKKAR OF PRISON 2 UCC: AN ANALYSIS ON THE HISTORY SHARAD 22 OF ARTICLE 44 AGNIHOTRI 3 CHILD ABUSE: A CRY THAT IS OFTEN NEHAL GUPTA & 37 LEFT UNHEARD HARPREET KAUR 4 STATUTORY LICENSING UNDER THE ANKIT SINGH 47 INDIAN COPYRIGHT ACT, 1957 AND ONLINE BROADCASTING: A CRITICAL ANALYSIS 5 ROLE OF NGO’S IN ADVOCACY OF JHARNA 57 HUMAN RIGHTS SAKSENA 6 COMPOUNDING OF NON- KUNWAR 65 COMPOUNDABLE OFFENCES: AN ABHIJEET & INSIGHT INTO THE CONFLICT PRERNA MITRA BETWEEN SECTION 320 AND 482 OF THE CODE OF CRIMINAL PROCEDURE 7 COGNATE OFFENCES: WHETHER TUPAKULA 72 MERE IRREGULARITY VITIATES THE NIKHIL TRIAL 8 SOCIAL TRANSFORMATION ANIRUDH & 87 THROUGH LAW VRINDA K. 9 OBSERVANCE OF PRECEDENT: SURABHI 91 SIGNIFICANCE IN JUDICIAL SARAWGI PROCESS IN THE COMMON LAW SYSTEM 10 DEVELOPMENT OF SHAREHOLDER VIRAL MARU 95 DEMOCRACY: AN INDIAN PERSPECTIVE 11 TRADEMARK LAWS IN INDIA BHUMIKA 101 MUCHAN 12 STREET CHILDREN IN INDIA AND NIYATHA 114 THEIR RIGHT TO EDUCATION RAJEEV 5 PIF – A++ ISSN 2581-6349 13 APPOINTMENT TO THE COLLEGIUM DEEPAK 118 SYSTEM AND IT’S RECENT SINGHAL DEVELOPMENTS 14 COPYRIGHT ON COVER VERSION HARPREET 125 MAKKAD, SHAURYA ABROL & VARUN SACHDEVA 15 CONCEPTUALIZING THE SOCIO- KHULOOS AZIZ 136 ECONOMIC STATUS OF INDIA WITH CHAWLA REGARD TO CHILD LABOUR AND RIGHT TO EDUCATION 16 REDRESSAL MECHANISM UNDER PRADYUM 147 THE REAL ESTATE (REGULATION CHAUDHARY AND DEVELOPMENT) ACT 2016: OUSTER OF THE ARBITRATION TRIBUNAL? 17 IMPACT OF GOODS & SERVICES TAX AMBUJ MISHRA 161 ON TAXATION LAW 18 RIGHTS OF TRANSGENDERS IN INDIA C. AMRIDHA 171 VARSHINI & B. ADITYA KRISHNAN 19 MARTIN LUTHER KING’S LETTER CHINTAN 182 FROM BIRMINGHAM JAIL: BHARDWAJ ANALYSING QUESTIONS OF RACE, INEQUALITY AND JUSTICE THROUGH VARIOUS JURISPRUDENTIAL SCHOOLS OF THOUGHT 20 REGIONAL TRADE AGREEMENTS KSHITIJ SINHA 188 (RTAS) AND ITS IMPACT ON INDIAN AND WORLD TRADE 21 DEVELOPMENT OF RIGHTS OF LGBT KUMAR SAMEER 197 COMMUNITY 22 A CRITICAL LEGAL ANALYSIS OF SHEIKH SULTAN 209 HUMAN ORGAN THEFT & AADIL HUQUE & TRANSPLANTATION LAWS IN INDIA MAHWESH BULAND 23 IP ISSUES IN CLOUD COMPUTING DIOTIMA ROY & 219 ARANYA NATH 24 DEVELOPMENT OF ARBITRAL LAWS VALLABHA 224 IN INDIA GULATI 6 PIF – A++ ISSN 2581-6349 25 ATTRIBUTES OF FORENSIC MANISHA 237 ODONTOLOGY: THE TOOL MARKS DANSANA OF ORAL CAVITY 26 INTERNATIONAL ARBITRATION AND NIHARIKA 245 ICSID SHARMA & ESHAN APRAMEYA CHATURVEDI 27 ADDICTED OFFENDERS – PRANAY 262 REHABILITATION AND CHALLENGES GOLCHHA UNDER THE CRIMINAL JUSTICE SYSTEM 28 RESERVATION IN INDIA: AN ARUSHI GUPTA 272 ANALYSIS IN LIGHT OF RAWLSIAN PRINCIPLES OF JUSTICE 29 ANALYSING THE DECISION OF THE ARCHIT UNIYAL 277 COMPETITION COMMISSION OF INDIA IN THE TYRE AND CEMENT CARTEL CASE 30 RIGHT TO PRIVACY IN THIS ERA OF NIKITA DAS 282 PAPARAZZI 31 SOCIO-ECONOMIC INSTITUTION OF RISHIKA 293 WAQF IN INDIA: A LEGAL ANALYSIS AGARWAL 32 UNHCR: INADEQUACY AMID THE SAGNIK 300 SURGE IN REFUGEE CRISIS SENGUPTA & AKSHITI KUMAR 33 INTRODUCTION TO BANK MERGERS PUSHPESH 312 & MERGER OF BANKS IN 2020 SRIVASTAVA 34 THE APPLICABILITY OF THE CODE RICHA 318 OF CIVIL PROCEDURE TO WRIT BORTHAKUR PROCEEDINGS 35 BILATERAL INVESTMENT TREATIES: PRISHA SINHA 326 A THREAT TO INTERNAL SOVEREIGNTY? 36 UNVEILING SOCIO-LEGAL ASPECTS KOKUL M. C & 340 OF RAPE VIJAYALAKSHMI. R 37 THE LEGALITY OF THE BOMBAY SURAJ T.N. 349 STOCK EXCHANGE AND ITS BYE- LAWS: V.V. RUIA VS. S. DALMIA 7 PIF – A++ ISSN 2581-6349 38 CONTEMPT OF COURT IN INDIA: A PRABHAT TYAGI 356 COMPREHENSIVE ANALYSIS 39 MOB LYNCHING IN INDIA SHUBHAM 363 SHARMA & AMAN BANKA 40 COMMERCIAL SURROGACY AND PAUL ABRAHAM 372 PROSPECTS FOR REGULATION IN INDIA 41 EDWARD SNOWDEN WHISTLEBLOW HARDIL BATRA 382 & CORRESPONDING CYBER LAW 42 SANSKAR MARATHE VS THE STATE AVIK SARKAR & 392 OF MAHARASHTRA AND ANR: IS DEBASRITA SEDITION LAW AN OPPRESSION OR CHOUDHURY NEED? 43 AN ANALYSIS OF CORPORATE AADEESH 399 SOCIAL RESPONSIBILITY IN INDIA SHARMA 44 SECTION 498-A OF INDIAN PENAL YASHWANTH A S 411 CODE, 1860 45 IMPORTANCE OF LEGAL AID WITH FAHAD BASHIR 415 SPECIAL REFERENCE TO LEGAL KHAN SERVICES AUTHORITY ACT, 1987 46 DOMESTIC VIOLENCE – THE ASHWINA YADAV 419 SHADOW PANDEMIC 2020 47 UNEMPLOYMENT IN INDIA- A CRISIS SHEIKH AMAN 422 RANA 48 THE WATCHDOG GONE LOOSE? JAGRATHI 426 YALADALU SOMAIAH & RAGHURAM PILLAI 49 JUVENILE JUSTICE MINISTRY: WHY DEBASRITA 430 SHOULD IT BE IMPLEMENTED IN CHOUDHURY INDIA? 50 ENDAGERING OF WOMEN: TAHMINA NAZ 434 VIOLENCE AGAINST WOMEN 51 SURROGACY – A BLESSING IN SANYA AHUJA & 438 DISGUISE RANJAN VYAS 8 PIF – A++ ISSN 2581-6349 52 PERSISTING TOWARDS A BETTER STEFY MARIA 443 TOMORROW FOR REFUGEES AMIDST SEBASTIAN & COVID-19 PANDEMIC NILANI CLAIRE N. 53 DNA PROFILING TO SETTLE SABARI .CH 449 PATERNITY DISPUTES 54 WHY TRANS ARE BEING LEFT TO SHREYA 454 CRY: UNCOVERED COVID-19 STORY BHARGAVA 55 SOCIAL MEDIA- A MORAL CHECK ON ANKITA SINGH 458 POLITICS 56 CUSTODIAL VIOLENCE IN SAMRIDDHI RAI 462 INDIA LINGER IN JUSTICE! 57 PENALISING MARITAL RAPE: SHAMBHAVI 467 CHALLENGES AND IMPLICATIONS SINHA 9 PIF – A++ ISSN 2581-6349 DEATH ROW PHENOMENON: REALITY BEHIND THE HIGH WALLS OF PRISON -HARSHITA KAKKAR ABSTRACT In nations holding the death penalty, delay before execution is generally estimated in years. A significant reason for delay is the inmate's appeals to various councils. Unreasonable postponement, in any event, when brought about by the detainee, can frame the premise of human rights infringement. Under the lamentable states of death row, prisoners are breaking down mentally and physically. It has been more than two decades since the death row phenomenon entered the worldwide domain; there is still no recognition on what comprises the marvel. The non appearance of obvious lines leaves us uncertain of when death row detainment becomes unlawful. The aim of this paper is to bring into light how the death row phenomenon is getting rooted into the international human rights law and the consequences it has on the detainee’s psychological and physical health. Also, this paper aims to establish delay as a ground for commutation of a sentence. INTRODUCTION Around half of the world population resides in countries that sustain capital punishment.1 Capital punishment can be defined as when the government executes a person for committing capital offenses. These offenses vary around the world with every country having its own reasons to carry it out. Currently, according to the report by Amnesty International 106 countries have abolished death penalty by the end of 2019 but the countries that still hold the practice can execute people for a variety of crimes which can be drug related offences, terrorism related acts, murder or changing ones religion.2 1 Confronting capital punishment in Asia: human rights, politics and public opinion by roger hood and surya deva 2 Amnesty international, death penalty, https://www.amnesty.org/en/what-we-do/death-penalty/ 10 PIF – A++ ISSN 2581-6349 In countries retaining death penalty the delay prior to the execution is measured in years and can take up to decades.3 The individuals convicted of capital offenses are isolated not only from the outside world but the prison community as well. The treatment given to the detainees given capital punishment is a breach of human rights alongside the conditions they are kept in.4 the idea of death row phenomenon conceptualizes this allegation. This idea can be depicted as the mental effect on the convicts under the shadow of execution that looms over them.
Recommended publications
  • The Mahabharata

    ^«/4 •m ^1 m^m^ The original of tiiis book is in tine Cornell University Library. There are no known copyright restrictions in the United States on the use of the text. http://www.archive.org/details/cu31924071123131 ) THE MAHABHARATA OF KlUSHNA-DWAIPAYANA VTASA TRANSLATED INTO ENGLISH PROSE. Published and distributed, chiefly gratis, BY PROTSP CHANDRA EOY. BHISHMA PARVA. CALCUTTA i BHiRATA PRESS. No, 1, Raja Gooroo Dass' Stbeet, Beadon Square, 1887. ( The righi of trmsMm is resem^. NOTICE. Having completed the Udyoga Parva I enter the Bhishma. The preparations being completed, the battle must begin. But how dan- gerous is the prospect ahead ? How many of those that were counted on the eve of the terrible conflict lived to see the overthrow of the great Knru captain ? To a KsJtatriya warrior, however, the fiercest in- cidents of battle, instead of being appalling, served only as tests of bravery that opened Heaven's gates to him. It was this belief that supported the most insignificant of combatants fighting on foot when they rushed against Bhishma, presenting their breasts to the celestial weapons shot by him, like insects rushing on a blazing fire. I am not a Kshatriya. The prespect of battle, therefore, cannot be unappalling or welcome to me. On the other hand, I frankly own that it is appall- ing. If I receive support, that support may encourage me. I am no Garuda that I would spurn the strength of number* when battling against difficulties. I am no Arjuna conscious of superhuman energy and aided by Kecava himself so that I may eHcounter any odds.
  • Väkivallan Muodot Ja Sen Kuvaamisen Keinot Arundhati Royn Teoksessa the God of Small Things Ja Bernardine Evariston Runoromaanissa the Emperor’S Babe

    Väkivallan Muodot Ja Sen Kuvaamisen Keinot Arundhati Royn Teoksessa the God of Small Things Ja Bernardine Evariston Runoromaanissa the Emperor’S Babe

    TAMPEREEN YLIOPISTO Raisa Aho Miten kertoa kivusta? Väkivallan muodot ja sen kuvaamisen keinot Arundhati Royn teoksessa The God of Small Things ja Bernardine Evariston runoromaanissa The Emperor’s Babe Yleisen kirjallisuustieteen pro gradu -tutkielma Tampere 2011 Tampereen yliopisto, Kieli-, käännös- ja kirjallisuustieteiden yksikkö AHO, Raisa: Miten kertoa kivusta? Väkivallan muodot ja sen kuvaamisen keinot Arundhati Royn romaanissa The God of Small Things ja Bernardine Evariston runoteoksessa The Emperor’s Babe Pro Gradu -tutkielma, 128 s. Yleinen kirjallisuustiede Huhtikuu 2011 Yleisen kirjallisuustieteen pro gradu -tutkielmassani tarkastelen erilaisia väkivallan ilmenemismuotoja ja niiden kuvaamisen keinoja kahdessa kaunokirjallisessa teoksessa, eli Arundhati Royn romaanissa The God of Small Things (1997) ja Bernardine Evariston runoromaanissa The Emperor’s Babe (2001). Päädyin tarkastelemaan juuri näitä kahta teosta rinnakkain sekä sisällöllisistä, temaattisista, kirjallisuushistoriallisista että kerronnallisista syistä. Ne molemmat kuuluvat niin sanotun postkoloniaalisen kirjallisuuden traditioon, mutta eri tavoilla. Molemmissa käsitellään väkivaltaa ja sen traumatisoivaa luonnetta, mutta kertojaratkaisujen erot tuovat väkivallan kuvauksiin erilaisia painotuksia. Tutkimukseni lähtee liikkeelle sekä ruumiillisen kivun että traumaattisen kokemuksen kieltä pakenevasta luonteesta. Molempia ilmiöitä on tarkasteltu siitä lähtökohdasta, että ne ovat symboloimattomia, ja niiden sanoiksi pukeminen on vaikeaa, ellei peräti mahdotonta. Kivun
  • Global Journal of Human Social Science

    Global Journal of Human Social Science

    Online ISSN: 2249-460X Print ISSN: 0975-587X exploration Volume 11 Issue 5 of version 1.0 innovations4 Comparative Analysis Patterns of Contemporary Geographic Information Facet of Human Rights October 2011 Global Journal of Human Social Science Global Journal of Human Social Science Volume 11 Issue 5 (Ver. 1.0) Open Association of Research Society *OREDO-RXUQDORI+XPDQ *OREDO-RXUQDOV,QF 6RFLDO6FLHQFHV $'HODZDUH86$,QFRUSRUDWLRQZLWK³*RRG6WDQGLQJ´Reg. Number: 0423089 6SRQVRUV Open Association of Research Society $OOULJKWVUHVHUYHG 2SHQ6FLHQWLILF6WDQGDUGV 7KLVLVDVSHFLDOLVVXHSXEOLVKHGLQYHUVLRQ RI³*OREDO-RXUQDORI+XPDQ6RFLDO 3XEOLVKHU¶V+HDGTXDUWHUVRIILFH 6FLHQFHV´%\*OREDO-RXUQDOV,QF $OODUWLFOHVDUHRSHQDFFHVVDUWLFOHVGLVWULEXWHG *OREDO-RXUQDOV,QF+HDGTXDUWHUV&RUSRUDWH2IILFH XQGHU³*OREDO-RXUQDORI+XPDQ6RFLDO 6FLHQFHV´ &DPEULGJH2IILFH&HQWHU,,&DQDO3DUN)ORRU1R 5HDGLQJ/LFHQVHZKLFKSHUPLWVUHVWULFWHGXVH WKCambridge (Massachusetts)3LQ0$ (QWLUHFRQWHQWVDUHFRS\ULJKWE\RI³*OREDO -RXUQDORI+XPDQ6RFLDO6FLHQFHV´XQOHVV 8QLWHG6WDWHV RWKHUZLVHQRWHGRQVSHFLILFDUWLFOHV 86$7ROO)UHH 86$7ROO)UHH)D[ 1RSDUWRIWKLVSXEOLFDWLRQPD\EHUHSURGXFHG RUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQV 2IIVHW7\SHVHWWLQJ HOHFWURQLFRUPHFKDQLFDOLQFOXGLQJ SKRWRFRS\UHFRUGLQJRUDQ\LQIRUPDWLRQ VWRUDJHDQGUHWULHYDOV\VWHPZLWKRXWZULWWHQ Open Association of Research Society , Marsh Road, SHUPLVVLRQ Rainham, Essex, London RM13 8EU 7KHRSLQLRQVDQGVWDWHPHQWVPDGHLQWKLV United Kingdom. ERRNDUHWKRVHRIWKHDXWKRUVFRQFHUQHG 8OWUDFXOWXUHKDVQRWYHULILHGDQGQHLWKHU FRQILUPVQRUGHQLHVDQ\RIWKHIRUHJRLQJDQG QRZDUUDQW\RUILWQHVVLVLPSOLHG
  • Violation of Women Human Rights in India

    Violation of Women Human Rights in India

    International Journal of Academic Research and Development ISSN: 2455-4197 Impact Factor: RJIF 5.22 www.academicsjournal.com Volume 2; Issue 5; September 2017; Page No. 817-822 Violation of women human rights in India Suman Resource Person, HIRD, Nillokheri, Karnal, Haryana, India Abstract We can seen that each day all over paper News, T V channels and Electronic devices aree presenting to the violation of Human Rights of Women in India. Human rights aree those minimum rights that are obligatorily accessible by each individual as she could be a member of human family. The constitution of India conjointly guarantees the equality of rights of men and Women. However, within the sphere of women’s human rights in India, there exists a good gap between theory and observe. In our society could be a male dominated society wherever men are continuously assumed to be superior to society. The India women’s need to face to discrimination, injustice and dishonor. The' women’s in India are given a lot of rights as compared to men, even then the condition of Women in India is miserable. This paper can throw lightweight on the human rights of Women in India. Which however all the elemental rights given to the Women aree being profaned in India, by that specialize in the varied crimes done against them. Keywords: human rights, violation, women human rights, crime against women Introduction phenomenon of Human Rights Violation is increasing day by “Freedom means the supremacy of human rights everywhere. day in India. Our support goes to those who struggle to gain those rights and keep them.
  • The Mahabharata of Krishna-Dwaipayana Vyasa SALYA

    The Mahabharata of Krishna-Dwaipayana Vyasa SALYA

    The Mahabharata of Krishna-Dwaipayana Vyasa SALYA PARVA translated by Kesari Mohan Ganguli In parentheses Publications Sanskrit Series Cambridge, Ontario 2002 Salya Parva Section I Om! Having bowed down unto Narayana and Nara, the most exalted of male beings, and the goddess Saraswati, must the word Jaya be uttered. Janamejaya said, “After Karna had thus been slain in battle by Savyasachin, what did the small (unslaughtered) remnant of the Kauravas do, O regenerate one? Beholding the army of the Pandavas swelling with might and energy, what behaviour did the Kuru prince Suyodhana adopt towards the Pandavas, thinking it suitable to the hour? I desire to hear all this. Tell me, O foremost of regenerate ones, I am never satiated with listening to the grand feats of my ancestors.” Vaisampayana said, “After the fall of Karna, O king, Dhritarashtra’s son Suyodhana was plunged deep into an ocean of grief and saw despair on every side. Indulging in incessant lamentations, saying, ‘Alas, oh Karna! Alas, oh Karna!’ he proceeded with great difficulty to his camp, accompanied by the unslaughtered remnant of the kings on his side. Thinking of the slaughter of the Suta’s son, he could not obtain peace of mind, though comforted by those kings with excellent reasons inculcated by the scriptures. Regarding destiny and necessity to be all- powerful, the Kuru king firmly resolved on battle. Having duly made Salya the generalissimo of his forces, that bull among kings, O monarch, proceeded for battle, accompanied by that unslaughtered remnant of his forces. Then, O chief of Bharata’s race, a terrible battle took place between the troops of the Kurus and those of the Pandavas, resembling that between the gods and the Asuras.
  • Compounding Injustice: India

    Compounding Injustice: India

    INDIA 350 Fifth Ave 34 th Floor New York, N.Y. 10118-3299 http://www.hrw.org (212) 290-4700 Vol. 15, No. 3 (C) – July 2003 Afsara, a Muslim woman in her forties, clutches a photo of family members killed in the February-March 2002 communal violence in Gujarat. Five of her close family members were murdered, including her daughter. Afsara’s two remaining children survived but suffered serious burn injuries. Afsara filed a complaint with the police but believes that the police released those that she identified, along with many others. Like thousands of others in Gujarat she has little faith in getting justice and has few resources with which to rebuild her life. ©2003 Smita Narula/Human Rights Watch COMPOUNDING INJUSTICE: THE GOVERNMENT’S FAILURE TO REDRESS MASSACRES IN GUJARAT 1630 Connecticut Ave, N.W., Suite 500 2nd Floor, 2-12 Pentonville Road 15 Rue Van Campenhout Washington, DC 20009 London N1 9HF, UK 1000 Brussels, Belgium TEL (202) 612-4321 TEL: (44 20) 7713 1995 TEL (32 2) 732-2009 FAX (202) 612-4333 FAX: (44 20) 7713 1800 FAX (32 2) 732-0471 E-mail: [email protected] E-mail: [email protected] E-mail: [email protected] July 2003 Vol. 15, No. 3 (C) COMPOUNDING INJUSTICE: The Government's Failure to Redress Massacres in Gujarat Table of Contents I. Summary............................................................................................................................................................. 4 Impunity for Attacks Against Muslims...............................................................................................................
  • TD-30 Data List

    TD-30 Data List

    Data List Preset Drum Kit List No. Name Pad pattern No. Name Pad pattern 1 Studio 41 RockGig 2 LA Metal 42 Hard BeBop 3 Swingin’ 43 Rock Solid 4 Burnin’ 44 2nd Line 5 Birch 45 ROBO TAP 6 Nashville 46 SATURATED 7 LoudRock 47 piccolo 8 JJ’s DnB 48 FAT 9 Djembe 49 BigHall 10 Stage 50 CoolGig LOOP 11 RockMaster 51 JazzSes LOOP 12 LoudJazz 52 7/4 Beat LOOP 13 Overhead 53 :neotype: 1SHOT, TAP 14 Looooose 54 FLA>n<GER 1SHOT, TAP 15 Fusion 55 CustomWood 16 Room 56 50s King 17 [RadioMIX] 57 BluesRock 18 R&B 58 2HH House 19 Brushes 59 TechFusion 20 Vision LOOP, TAP 60 BeBop 21 AstroNote 1SHOT 61 Crossover 22 acidfunk 62 Skanky 23 PunkRock 63 RoundBdge 24 OpenMaple 64 Metal\Core 25 70s Rock 65 JazzCombo 26 DrySound 66 Spark! 27 Flat&Shallow 67 80sMachine 28 Rvs!Trashy 68 =cosmic= 29 melodious TAP 69 1985 30 HARD n’BASS TAP 70 TR-808 31 BazzKicker 71 TR-909 32 FatPressed 72 LatinDrums 33 DrumnDubStep 73 Latin 34 ReMix-ulator 74 Brazil 35 Acoutronic 75 Cajon 36 HipHop 76 African 37 90sHouse 77 Ka-Rimba 38 D-N-B LOOP 78 Tabla TAP 39 SuperLoop TAP 79 Asian 40 >>process>>> 80 Orchestra TAP Copyright © 2012 ROLAND CORPORATION All rights reserved. No part of this publication may be reproduced in any form without the written permission of ROLAND CORPORATION. Roland and V-Drums are either registered trademarks or trademarks of Roland Corporation in the United States and/or other countries.
  • African Drumming in Drum Circles by Robert J

    African Drumming in Drum Circles by Robert J

    African Drumming in Drum Circles By Robert J. Damm Although there is a clear distinction between African drum ensembles that learn a repertoire of traditional dance rhythms of West Africa and a drum circle that plays primarily freestyle, in-the-moment music, there are times when it might be valuable to share African drumming concepts in a drum circle. In his 2011 Percussive Notes article “Interactive Drumming: Using the power of rhythm to unite and inspire,” Kalani defined drum circles, drum ensembles, and drum classes. Drum circles are “improvisational experiences, aimed at having fun in an inclusive setting. They don’t require of the participants any specific musical knowledge or skills, and the music is co-created in the moment. The main idea is that anyone is free to join and express himself or herself in any way that positively contributes to the music.” By contrast, drum classes are “a means to learn musical skills. The goal is to develop one’s drumming skills in order to enhance one’s enjoyment and appreciation of music. Students often start with classes and then move on to join ensembles, thereby further developing their skills.” Drum ensembles are “often organized around specific musical genres, such as contemporary or folkloric music of a specific culture” (Kalani, p. 72). Robert Damm: It may be beneficial for a drum circle facilitator to introduce elements of African music for the sake of enhancing the musical skills, cultural knowledge, and social experience of the participants. PERCUSSIVE NOTES 8 JULY 2017 PERCUSSIVE NOTES 9 JULY 2017 cknowledging these distinctions, it may be beneficial for a drum circle facilitator to introduce elements of African music (culturally specific rhythms, processes, and concepts) for the sake of enhancing the musi- cal skills, cultural knowledge, and social experience Aof the participants in a drum circle.
  • Stylistic Evolution of Jazz Drummer Ed Blackwell: the Cultural Intersection of New Orleans and West Africa

    Stylistic Evolution of Jazz Drummer Ed Blackwell: the Cultural Intersection of New Orleans and West Africa

    STYLISTIC EVOLUTION OF JAZZ DRUMMER ED BLACKWELL: THE CULTURAL INTERSECTION OF NEW ORLEANS AND WEST AFRICA David J. Schmalenberger Research Project submitted to the College of Creative Arts at West Virginia University in partial fulfillment of the requirements for the degree of Doctor of Musical Arts in Percussion/World Music Philip Faini, Chair Russell Dean, Ph.D. David Taddie, Ph.D. Christopher Wilkinson, Ph.D. Paschal Younge, Ed.D. Division of Music Morgantown, West Virginia 2000 Keywords: Jazz, Drumset, Blackwell, New Orleans Copyright 2000 David J. Schmalenberger ABSTRACT Stylistic Evolution of Jazz Drummer Ed Blackwell: The Cultural Intersection of New Orleans and West Africa David J. Schmalenberger The two primary functions of a jazz drummer are to maintain a consistent pulse and to support the soloists within the musical group. Throughout the twentieth century, jazz drummers have found creative ways to fulfill or challenge these roles. In the case of Bebop, for example, pioneers Kenny Clarke and Max Roach forged a new drumming style in the 1940’s that was markedly more independent technically, as well as more lyrical in both time-keeping and soloing. The stylistic innovations of Clarke and Roach also helped foster a new attitude: the acceptance of drummers as thoughtful, sensitive musical artists. These developments paved the way for the next generation of jazz drummers, one that would further challenge conventional musical roles in the post-Hard Bop era. One of Max Roach’s most faithful disciples was the New Orleans-born drummer Edward Joseph “Boogie” Blackwell (1929-1992). Ed Blackwell’s playing style at the beginning of his career in the late 1940’s was predominantly influenced by Bebop and the drumming vocabulary of Max Roach.
  • SMITA NARULA 78 North Broadway, White Plains, New York 10603, Snarula@Law.Pace.Edu

    SMITA NARULA 78 North Broadway, White Plains, New York 10603, [email protected]

    SMITA NARULA 78 North Broadway, White Plains, New York 10603, [email protected] ACADEMIC APPOINTMENTS ELISABETH HAUB SCHOOL OF LAW AT PACE UNIVERSITY White Plains, NY Haub Distinguished Professor of International Law Sept. 2018 - present ▪ Appointed in 2018 as the inaugural Distinguished Haub Chair in International Law to teach in the law school’s internationally renowned and top-ranked environmental law program. ▪ Courses: International Environmental Law; Environmental Justice; Human Rights & the Environment; Property Law. Committees: Appointments Committee; Admissions Committee; Nominating Committee; Environmental Law Program. Research interests: International Human Rights Law; Food Sovereignty & the Right to Food; Indigenous Peoples’ Rights; Environmental Movements; Sustainable Development Goals. Faculty Advisor: Pace International Law Review. ▪ Appointed Co-Director of the Global Center for Environmental Legal Studies in July 2019. Coordinate and supervise Haub Law students’ efforts to draft, submit, appeal and negotiate motions on international environmental law subjects for the International Union for the Conservation of Nature’s World Conservation Congress. HUNTER COLLEGE – CITY UNIVERSITY OF NEW YORK New York, NY Distinguished Lecturer & Interim Director 2017 – 2018 Human Rights Program, Roosevelt House Public Policy Institute ▪ Directed interdisciplinary program in human rights for undergraduate students and provided strategic direction for relevant academic, public outreach, and programming efforts. Fostered human rights
  • Bhagavad Gita Free

    Bhagavad Gita Free

    öËÅ Ç⁄∞¿Ë⁄“®¤ Ñ∆ || ¥˘®Ωæ Ã˘¤-í‹¡ºÎ ≤Ÿ¨ºÎ —∆Ÿ´ºŸ¿Ÿº® æË⁄í≤Ÿ | é∆ƒºÎ ¿Ÿú-æËíŸæ “ Ÿé¿Å || “§-⁄∆YŸºÎ ⁄“ º´—æ‰≥Æ˙-íË¿’-ÇŸYŸÅ ⁄∆úŸ≤™‰ | —∆Ÿ´ºŸ¿ŸºÅ Ǩ∆Ÿ æËí¤ úŸ≤¤™‰ ™ ÇŸ¿Ëß‹ºÎ ÑôöËÅ Ç⁄∞¿Ë⁄“®¤ Ñ∆ || ¥˘®Ωæ Ã˘¤-í‹¡ºÎ ≤Ÿ¨ºÎ —∆Ÿ´ºŸ¿Ÿº‰® æË⁄í≤Ÿ | éÂ∆ƒºÎ ¿Ÿú ºŸ¿ŸºÅ é‚¥Ÿé¿Å || “§-⁄∆YŸºÎ ⁄“ º´—æ‰≥Æ˙-íË¿’-ÇŸYŸÅ ⁄∆úŸ≤™‰ | —∆Ÿ´ºŸ¿ŸºÅ Ǩ∆Ÿ æËí¤ ¿Ÿú-æËíºÎ ÇŸ¿Ëß‹ºÎ ÑôöËÅ Ç⁄∞¿Ë⁄“®¤ Ñ∆ || ¥˘®Ωæ Ã˘¤-í‹¡ºÎ ≤Ÿ¨ºÎ —∆Ÿ´ºŸ¿Ÿº‰® æË⁄í≤Ÿ 韺Π∞%‰ —∆Ÿ´ºŸ¿ŸºÅ é‚¥Ÿé¿Å || “§-⁄∆YŸºÎ ⁄“ º´—æ‰≥Æ˙-íË¿’-ÇŸYŸÅ ⁄∆úŸ≤™‰ | —∆Ÿ´ºŸ¿Ÿº ∫Ÿú™‰ ¥˘Ë≤Ù™-¿Ÿú-æËíºÎ ÇŸ¿Ëß‹ºÎ ÑôöËÅ Ç⁄∞¿Ë⁄“®¤ Ñ∆ || ¥˘®Ωæ Ã˘¤-í‹¡ºÎ ≤Ÿ¨ºÎ —∆Ÿ´ºŸ¿Ÿ §-¥˘Æ¤⁄¥éŸºÎ ∞%‰ —∆Ÿ´ºŸ¿ŸºÅ é‚¥Ÿé¿Å || “§-⁄∆YŸºÎ ⁄“ º´—æ‰≥Æ˙-íË¿’-ÇŸYŸÅ ⁄∆úŸ≤™‰ | -⁄∆YŸ | ⁄∆∫˘Ÿú™‰ ¥˘Ë≤Ù™-¿Ÿú-æËíºÎ ÇŸ¿ËßThe‹ºÎ ÑôöËÅ Ç⁄∞¿Ë⁄“®¤ Ñ∆ || ¥˘®Ωæ Ã˘¤-í‹¡ºÎ ≤Ÿ¨ ÇúŸ≤™ŸºÎ | “§-¥˘Æ¤⁄¥éŸºÎ ∞%Bhagavad‰ —∆Ÿ´ºŸ¿ŸºÅ é‚¥Ÿé¿Å Gita || “§-⁄∆YŸºÎ ⁄“ º´—æ‰≥Æ˙-íË¿’-ÇŸYŸ {Ÿ “§-æËí-⁄∆YŸ | ⁄∆∫˘Ÿú™‰ ¥˘Ë≤Ù™-¿Ÿú-æËíºÎ ÇŸ¿Ëß‹ºÎ ÑôöËÅ Ç⁄∞¿Ë⁄“®¤ Ñ∆ || ¥˘®Ωæ Ã˘¤ æËíºÎ ÇúŸ≤™ŸºÎ | “§-¥˘Æ¤⁄¥éŸºÎ ∞%‰ —∆Ÿ´ºŸ¿ŸºÅ é‚¥Ÿé¿Å || “§-⁄∆YŸºÎ ⁄“ º´—æ‰≥Æ˙-íË¿’ ≤ Ü¥⁄Æ{Ÿ “§-æËí-⁄∆YŸ | ⁄∆∫˘Ÿú™‰ ¥˘Ë≤Ù™-¿Ÿú-æËíºÎ ÇŸ¿Ëß‹ºÎ ÑôöËÅ Ç⁄∞¿Ë⁄“®¤ Ñ∆ || ¥˘ ≥™‰ ¿Ÿú-æËíºÎ ÇúŸ≤™ŸºÎ | “§-¥The˘Æ¤⁄¥éŸº OriginalÎ ∞%‰ —∆Ÿ´ºŸ¿ŸºÅSanskrit é‚¥Ÿé¿Å || “§-⁄∆YŸºÎ ⁄“ º´—æ‰ —ºÊ æ‰≤ Ü¥⁄Æ{Ÿ “§-æËí-⁄∆YŸ | ⁄∆∫˘Ÿú™‰ ¥˘Ë≤Ù™-¿Ÿú-æËíºÎ ÇŸ¿Ëß‹ºÎ ÑôöËÅ Ç⁄∞¿Ë⁄“®¤ Ñ “‹-º™-±∆Ÿ≥™‰ ¿Ÿú-æËíºÎ ÇúŸ≤™ŸºÎ | “§-¥˘Æ¤⁄¥éŸºand Î ∞%‰ —∆Ÿ´ºŸ¿ŸºÅ é‚¥Ÿé¿Å || “§-⁄∆YŸº Å Ç—™‹ ™—ºÊ æ‰≤ Ü¥⁄Æ{Ÿ “§-æËí-⁄∆YŸ | ⁄∆∫˘Ÿú™‰ ¥˘Ë≤Ù™-¿Ÿú-æËíºÎ ÇŸ¿Ëß‹ºÎ ÑôöËÅ Ç⁄∞¿ Ÿ ∏“‹-º™-±∆Ÿ≥™‰ ¿Ÿú-æËíºÎ ÇúŸ≤™ŸºÎ | “§-¥˘Æ¤⁄¥éŸºÎ ∞%‰ —∆Ÿ´ºŸ¿ŸºÅ é‚¥Ÿé¿Å || “§- An English Translation ≤Ÿ¨Ÿæ
  • More Cowbell: a Case Study in System Dynamics for Information Operations Lt Col Will Atkins, USAF Lt Col Donghyung Cho, ROK MAJ Sean Yarroll, USA

    More Cowbell: a Case Study in System Dynamics for Information Operations Lt Col Will Atkins, USAF Lt Col Donghyung Cho, ROK MAJ Sean Yarroll, USA

    AIR & SPACE POWER JOURNAL - FEATURE More Cowbell: A Case Study in System Dynamics for Information Operations LT COL WILL ATKINS, USAF LT COL DONGHYUNG CHO, ROK MAJ SEAN YARROLL, USA Disclaimer: The views and opinions expressed or implied in the Journal are those of the authors and should not be construed as carrying the official sanction of the Department of Defense, Air Force, Air Education and Training Command, Air University, or other agencies or departments of the US government. This article may be reproduced in whole or in part without permission. If it is reproduced, the Air and Space Power Journal requests a courtesy line. To put it simply, we need to worry a lot less about how to communicate our actions and much more about what our actions communicate. —Former Chairman, Joint Chiefs of Staff Adm Michael G. Mullen, August 2009 Introduction In a popular “Saturday Night Live” skit from 2000, despite the cowbell depicted as an afterthought in a fully integrated band, the audience learns a valuable lesson on the importance of “more cowbell.”1 To continue the metaphor, the cowbell has never been and will never be the primary line of effort in the band. But the cow- bell permeates throughout the music, often tying the entire performance together. Such is the fate of information operations in a joint environment, often consid- 20 AIR & SPACE POWER JOURNAL SUMMER 2020 More Cowbell: A Case Study in System Dynamics for Information Operations ered a “second- class citizen as a source of nonlethal effects, an afterthought bolt- on to fires, or worse.”2 On the contrary, information operations is often the capa- bility that binds joint operations together to make it successful.