PRKAB1 Polyclonal Antibody Gene Symbol: PRKAB1

PRKAB1 polyclonal antibody Gene Symbol: PRKAB1

Gene Alias: AMPK, HAMPKb, MGC17785 Catalog Number: PAB30688

Gene Summary: The protein encoded by this gene is a Regulation Status: For research use only (RUO) regulatory subunit of the AMP-activated protein kinase Product Description: Rabbit polyclonal antibody raised (AMPK). AMPK is a heterotrimer consisting of an alpha against partial recombinant human PRKAB1. catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme Immunogen: Recombinant protein corresponding to that monitors cellular energy status. In response to human PRKAB1. cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase Sequence: (ACC) and beta-hydroxy beta-methylglutaryl-CoA MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKI reductase (HMGCR), key enzymes involved in regulating LMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKA de novo biosynthesis of fatty acid and cholesterol. This PAQARPTVFRWTGGGKEVYLSGSFNNW subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit Host: Rabbit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also Reactivity: Human,Mouse,Rat serve as an adaptor molecule mediating the association of the AMPK complex. [provided by RefSeq] Applications: IF, IHC-P, WB-Ce (See our web site product page for detailed applications information)

Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols

Form: Liquid

Purification: Antigen affinity purification

Isotype: IgG

Recommend Usage: Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.

Storage Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).

Storage Instruction: Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.

Entrez GeneID: 5564

Page 1/1