PRKAB1 Polyclonal Antibody Gene Symbol: PRKAB1

PRKAB1 Polyclonal Antibody Gene Symbol: PRKAB1

PRKAB1 polyclonal antibody Gene Symbol: PRKAB1 Gene Alias: AMPK, HAMPKb, MGC17785 Catalog Number: PAB30688 Gene Summary: The protein encoded by this gene is a Regulation Status: For research use only (RUO) regulatory subunit of the AMP-activated protein kinase Product Description: Rabbit polyclonal antibody raised (AMPK). AMPK is a heterotrimer consisting of an alpha against partial recombinant human PRKAB1. catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme Immunogen: Recombinant protein corresponding to that monitors cellular energy status. In response to human PRKAB1. cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase Sequence: (ACC) and beta-hydroxy beta-methylglutaryl-CoA MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKI reductase (HMGCR), key enzymes involved in regulating LMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKA de novo biosynthesis of fatty acid and cholesterol. This PAQARPTVFRWTGGGKEVYLSGSFNNW subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit Host: Rabbit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also Reactivity: Human,Mouse,Rat serve as an adaptor molecule mediating the association of the AMPK complex. [provided by RefSeq] Applications: IF, IHC-P, WB-Ce (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Form: Liquid Purification: Antigen affinity purification Isotype: IgG Recommend Usage: Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. Storage Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). Storage Instruction: Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 5564 Page 1/1 Powered by TCPDF (www.tcpdf.org).

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    1 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us