DOCSLIB.ORG

Tenecteplase - Drugbank

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Tenecteplase - Drugbank 10/30/2018 Tenecteplase - DrugBank Tenecteplase Targets (11) Biointeractions (1) IDENTIFICATION Name Tenecteplase Accession Number DB00031 (BTD00019, BIOD00019) Type Biotech Groups Approved Biologic Classification Protein Based Therapies Thrombolytic agents Description Tissue plasminogen activator (tPA). Tenecteplase is a 527 amino acid glycoprotein developed by introducing the following modifications to the complementary DNA (cDNA) for natural human tPA: a substitution of threonine 103 with asparagine, and a substitution of asparagine 117 with glutamine, both within the kringle 1 domain, and a tetra-alanine substitution at amino acids 296- 299 in the protease domain. Protein structure https://www.drugbank.ca/drugs/DB00031 1/23 10/30/2018 Tenecteplase - DrugBank Protein chemical formula C2561H3919N747O781S40 Protein average weight 58951.2 Da Sequences >DB00031 sequence SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGG TCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQGISYRGNWSTAESGAECTNWQSSA LAQKPYSGRRPDAIRLGLGNHNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDC YFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAK PWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQAAIFAAAAAS PGERFLCGGILISSCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVH KEFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEAL SPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGG PLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP Download FASTA Format Synonyms TNK-tPA Prescription Products Search MARKETING MARKETING NAME ↑↓ DOSAGE ↑↓ STRENGTH ↑↓ ROUTE ↑↓ LABELLER ↑↓ START ↑↓ END ↑↓ ↑↓ ↑↓ Metalyse Injection, 10000 units Intravenous Boehringer 2001-02-23 Not applicable powder, for Ingelheim solution Metalyse Injection, 8000 units Intravenous Boehringer 2001-02-23 Not applicable powder, for Ingelheim solution TNKase Kit 52.5 Genentech, 2000-06-02 Not applicable https://www.drugbank.ca/drugs/DB00031 2/23 10/30/2018 Tenecteplase - DrugBank mg/50mg Inc. MARKETING MARKETING NAME ↑↓ DOSAGE ↑↓ STRENGTH ↑↓ ROUTE ↑↓ LABELLER ↑↓ START ↑↓ END ↑↓ ↑↓ ↑↓ TNKase Powder, for 50 mg Intravenous Hoffmann La 2001-10-18 Not applicable solution Roche Showing 1 to 4 of 4 entries ‹ › Mixture Products Search MARKETING MARKETING NAME ↑↓ INGREDIENTS DOSAGE ↑↓ ROUTE ↑↓ LABELLER ↑↓ START ↑↓ END ↑↓ ↑↓ ↑↓ TNKase Tenecteplase Kit Genentech, 2000-06-02 2014-06-30 (50 Inc. mg/10mL) + Isopropyl Alcohol (0.7 mL/1mL) Showing 1 to 1 of 1 entries ‹ › Categories Agents causing angioedema Amino Acids, Peptides, and Proteins Anticoagulants Biological Factors Blood and Blood Forming Organs Blood Proteins Cardiovascular Agents Endopeptidases Enzymes Enzymes and Coenzymes Fibrin Modulating Agents https://www.drugbank.ca/drugs/DB00031 3/23 10/30/2018 Tenecteplase - DrugBank Fibrinolytic Agents Hematologic Agents Hydrolases Peptide Hydrolases Plasminogen Activators Proteins Serine Endopeptidases Serine Proteases UNII WGD229O42W CAS number 191588-94-0 PHARMACOLOGY Indication For treatment of myocardial infarction and lysis of intracoronary emboli Associated Conditions ST Elevation Myocardial Infarction (STEMI) Pharmacodynamics Tenecteplase is a fibrin-specific tissue-plasminogen activator. It binds to fibrin rich clots and cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction. Mechanism of action Tenecteplase binds to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain. The protease domain then cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. https://www.drugbank.ca/drugs/DB00031 4/23 10/30/2018 Tenecteplase - DrugBank A Plasminogen activator Human A Fibrinogen alpha chain Not Available Human U Urokinase plasminogen activator surface receptor Not Available Human U Plasminogen activator inhibitor 1 Not Available Human U Plasminogen activator inhibitor 2 Not Available Human U Tetranectin Not Available Human U Keratin, type II cytoskeletal 8 Not Available Human U Annexin A2 Not Available Human U Calreticulin Not Available Human U Calnexin Not Available Human U Prolow-density lipoprotein receptor-related protein 1 Not Available Human https://www.drugbank.ca/drugs/DB00031 5/23 10/30/2018 Tenecteplase - DrugBank Absorption Not Available Volume of distribution Not Available Protein binding Not Available Metabolism Not Available Route of elimination Not Available Half life 1.9 hours (mammalian reticulocytes, in vitro) >20 hours (yeast, in vivo) >10 hours (Escherichia coli, in vivo) Clearance 99 - 119 mL/min [acute myocardial infarction patients] Toxicity Not Available Affected organisms Humans and other mammals Pathways Tenecteplase Action Pathway Drug action Pharmacogenomic Effects/ADRs Not Available INTERACTIONS https://www.drugbank.ca/drugs/DB00031 6/23 10/30/2018 Tenecteplase - DrugBank Drug Interactions ALL DRUGS APPROVED VET APPROVED NUTRACEUTICAL ILLICIT WITHDRAWN INVESTIGATIONAL EXPERIMENTAL Search DRUG ↑↓ INTERACTION ↑↓ (1,2,6,7-3H)Testosterone The therapeutic efficacy of Tenecteplase can be increased when used in combination with (1,2,6,7-3H)Testosterone. (R)-warfarin The risk or severity of bleeding can be increased when Tenecteplase is combined with (R)-warfarin. (S)-Warfarin The risk or severity of bleeding can be increased when Tenecteplase is combined with (S)-Warfarin. 1-Testosterone The therapeutic efficacy of Tenecteplase can be increased when used in combination with 1-Testosterone. 18-methyl-19- The therapeutic efficacy of Tenecteplase can be increased when used in nortestosterone combination with 18-methyl-19-nortestosterone. 4-hydroxycoumarin The risk or severity of bleeding can be increased when Tenecteplase is combined with 4-hydroxycoumarin. 4-Hydroxytestosterone The therapeutic efficacy of Tenecteplase can be increased when used in combination with 4-Hydroxytestosterone. 5beta-dihydrotestosterone The therapeutic efficacy of Tenecteplase can be increased when used in combination with 5beta-dihydrotestosterone. Abciximab The risk or severity of bleeding can be increased when Abciximab is combined with Tenecteplase. Aceclofenac The risk or severity of bleeding and hemorrhage can be increased when Aceclofenac is combined with Tenecteplase. Showing 1 to 10 of 583 entries ‹ › Food Interactions Not Available REFERENCES General References https://www.drugbank.ca/drugs/DB00031 7/23 10/30/2018 Tenecteplase - DrugBank 1. Gurbel PA, Hayes K, Bliden KP, Yoho J, Tantry US: The platelet-related effects of tenecteplase versus alteplase versus reteplase. Blood Coagul Fibrinolysis. 2005 Jan;16(1):1-7. [PubMed:15650539] 2. Melzer C, Richter C, Rogalla P, Borges AC, Theres H, Baumann G, Laule M: Tenecteplase for the treatment of massive and submassive pulmonary embolism. J Thromb Thrombolysis. 2004 Aug;18(1):47-50. [PubMed:15744554] 3. Ohman EM, Van de Werf F, Antman EM, Califf RM, de Lemos JA, Gibson CM, Oliverio RL, Harrelson L, McCabe C, DiBattiste P, Braunwald E: Tenecteplase and tirofiban in ST-segment elevation acute myocardial infarction: results of a randomized trial. Am Heart J. 2005 Jul;150(1):79-88. [PubMed:16084152] 4. De Luca G, Suryapranata H, Chiariello M: Tenecteplase followed by immediate angioplasty is more effective than tenecteplase alone for people with STEMI. Commentary. Evid Based Cardiovasc Med. 2005 Dec;9(4):284- 7. Epub 2005 Nov 2. [PubMed:16380055] 5. Authors unspecified: Primary versus tenecteplase-facilitated percutaneous coronary intervention in patients with ST-segment elevation acute myocardial infarction (ASSENT-4 PCI): randomised trial. Lancet. 2006 Feb 18;367(9510):569-78. [PubMed:16488800] External Links UniProt P00750 Genbank L00153 KEGG Drug D06070 PubChem Substance 46508657 ChEMBL CHEMBL2108791 Therapeutic Targets Database DAP000204 PharmGKB PA164776757 RxList RxList Drug Page Drugs.com Drugs.com Drug Page Wikipedia Tenecteplase https://www.drugbank.ca/drugs/DB00031 8/23 10/30/2018 p Tenecteplase - DrugBank ATC Codes B01AD11 — Tenecteplase B01AD — Enzymes B01A — ANTITHROMBOTIC AGENTS B01 — ANTITHROMBOTIC AGENTS B — BLOOD AND BLOOD FORMING ORGANS AHFS Codes 20:12.20 — Thrombolytic Agents CLINICAL TRIALS Clinical Trials Search PHASE ↑↓ STATUS ↑↓ PURPOSE ↑↓ CONDITIONS ↑↓ COUNT ↑↓ 1 Withdrawn Treatment Acute Respiratory Distress Syndrome (ARDS) 1 1, 2 Terminated Treatment Acute Myelogenous Leukaemia (AML) / 1 Myelodysplastic Syndrome 2 Active Not Treatment Stroke, Ischemic 1 Recruiting 2 Completed Treatment Acute Myocardial Infarction (AMI) 1 2 Completed Treatment Cerebral Infarctions / Ischemia, Brain / Strokes 1 2 Completed Treatment Stroke, Ischemic 1 2 Completed Treatment Strokes 1 2 Recruiting Treatment Stroke, Ischemic 1 2 Terminated Treatment Leukemias 1 2 Terminated Treatment Pulmonary Embolism (PE) 1 Showing 1 to 10 of 34 entries ‹ › PHARMACOECONOMICS Manufacturers Not Available https://www.drugbank.ca/drugs/DB00031 9/23 10/30/2018 Tenecteplase - DrugBank Packagers F Hoffmann-La Roche Ltd. Genentech Inc. Dosage forms Search FORM ↑↓ ROUTE ↑↓ STRENGTH ↑↓ Injection, powder, for solution Intravenous 10000 units Injection, powder, for solution Intravenous 8000 units Kit Kit 52.5 mg/50mg Powder, for solution Intravenous 50 mg Showing 1 to 5 of 5 entries ‹ › Prices Search UNIT DESCRIPTION ↑↓ COST ↑↓ UNIT ↑↓ Tnkase 50 mg kit 3238.76USD kit Showing 1 to 1 of 1 entries ‹ › DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Load more

Recommended publications
  • Clinical Protocol
    CLINICAL PROTOCOL Subject: Page Protocol # EMERGENT TREATMENT OF PATIENTS WITH BLEEDING AND 1 of 4 NMH CCP 07.0024 CLOTTING EMERGENCIES WHO ARE TAKING NOVEL ORAL ANTICOAGULANTS Version: 1.0 Title: Revision of: Effective Date: EMERGENT TREATMENT OF PATIENTS WITH BLEEDING AND NEW 04/29/2013 CLOTTING EMERGENCIES WHO ARE TAKING NOVEL ORAL Removal Date: ANTICOAGULANT APIXABAN (ELIQUIS) I. PURPOSE: To standardize management of patients with bleeding and clotting emergencies who are taking novel oral anticoagulants (NOACs). This protocol covers emergent reversal and ischemic stroke in patients on apixaban (Eliquis) therapy. II. CLINICAL PROTOCOL: A. The NOAC apixaban (Eliquis) is FDA approved for stroke prevention in patients with atrial fibrillation. This agent presents clinicians with several challenges because there are no specific antidotes, and no readily available quantitative assay to determine the degree of anticoagulation in a patient on this therapy. B. Patients taking this agent are likely to present to the hospital with; 1. life-threatening bleeding (e.g., intracerebral hemorrhage or GI bleeding), or a need for an emergent invasive procedure (surgery, cardiac Catherization) 2. acute ischemic stroke. The administration of tissue plasminogen activator (IV tPA) in the setting of NOAC use is potentially dangerous. C. There are no accepted evidence-based guidelines for managing these situations. This protocol is a consensus of clinicians from stroke, neurology, neurosurgery, hematology, neurocritical care, laboratory medicine, cardiology, and pharmacy. III. REVERSAL PROTOCOL FOR PATIENTS WITH SEVERE/LIFE-THREATENING BLEEDING TAKING APIXABAN (ELIQUIS) A. Inclusion criteria: 1. Patient has taken any dose of apixaban within last 48 hours. a. If time of last dose is unknown, but patient is suspected of having taken apixaban in last 48 hours, and PT is abnormal and 2.
    [Show full text]
  • The Central Role of Fibrinolytic Response in COVID-19—A Hematologist’S Perspective
    International Journal of Molecular Sciences Review The Central Role of Fibrinolytic Response in COVID-19—A Hematologist’s Perspective Hau C. Kwaan 1,* and Paul F. Lindholm 2 1 Division of Hematology/Oncology, Department of Medicine, Feinberg School of Medicine, Northwestern University, Chicago, IL 60611, USA 2 Department of Pathology, Feinberg School of Medicine, Northwestern University, Chicago, IL 60611, USA; [email protected] * Correspondence: [email protected] Abstract: The novel coronavirus disease (COVID-19) has many characteristics common to those in two other coronavirus acute respiratory diseases, severe acute respiratory syndrome (SARS) and Middle East respiratory syndrome (MERS). They are all highly contagious and have severe pulmonary complications. Clinically, patients with COVID-19 run a rapidly progressive course of an acute respiratory tract infection with fever, sore throat, cough, headache and fatigue, complicated by severe pneumonia often leading to acute respiratory distress syndrome (ARDS). The infection also involves other organs throughout the body. In all three viral illnesses, the fibrinolytic system plays an active role in each phase of the pathogenesis. During transmission, the renin-aldosterone- angiotensin-system (RAAS) is involved with the spike protein of SARS-CoV-2, attaching to its natural receptor angiotensin-converting enzyme 2 (ACE 2) in host cells. Both tissue plasminogen activator (tPA) and plasminogen activator inhibitor 1 (PAI-1) are closely linked to the RAAS. In lesions in the lung, kidney and other organs, the two plasminogen activators urokinase-type plasminogen activator (uPA) and tissue plasminogen activator (tPA), along with their inhibitor, plasminogen activator 1 (PAI-1), are involved. The altered fibrinolytic balance enables the development of a hypercoagulable Citation: Kwaan, H.C.; Lindholm, state.
    [Show full text]
  • • All Doacs Are Cleared to Some Extent by the Kidneys
    • All DOACs are cleared to some extent by the kidneys – Dabigatran 80% – Rivaroxaban 33% – Apixaban 25% – Potential for drug accumulation in patients with severe renal impairment especially below eGFRs <30 Warfarin is unaffected by renal impairment (only • Rivaroxaban & Apixaban are both oral direct inhibitor of factor Xa. • Rivaroxaban doses recommended for clinical use are 15mg od and 20 mg od (15 mg bd for first 3 weeks of treatment of DVT). • Apixaban 5mg bd or 2.5mg bd • Rivaroxaban peak plasma levels are reached 2 to 3 h after ingestion • Apixaban peak plasma levels are reached ~3hrs after ingestion • Rivaroxaban is taken with food – Apixaban without food • Rivaroxaban is 33% renaly excreted and has a half-life of 9 h in patients with normal renal function. – There is an analogy with Therapeutic LMWH – We very rarely ask for an anti-Xa assay • And what is the clinical significance of a Xa assay ? (Cut off values are largely arbitrary) – Fixed doses – Importance of When the last dose was taken ? – Importance of What is the renal function ? – If bleeding • What is the nature of the bleeding ? • In extremis we can give protamine sulphate (? Efficacy) • How to manage bleeding on a DOAC? –How severe is the bleeding ? –When was the last dose of medication ? –What is the renal function ? – Recheck –If minor bleeding; epistaxis, gingival, bruising, menorrhagia • Withhold the NOAC (when was the last dose taken?) • Recheck renal function • Check FBC • Local measures • Unlikely to require further intervention – Re-challenge – ? Switch NOAC
    [Show full text]
  • Low Molecular Weight Heparins and Heparinoids
    NEW DRUGS, OLD DRUGS NEW DRUGS, OLD DRUGS Low molecular weight heparins and heparinoids John W Eikelboom and Graeme J Hankey UNFRACTIONATED HEPARIN has been used in clinical ABSTRACT practice for more than 50 years and is established as an effective parenteral anticoagulant for the prevention and ■ Several low molecular weight (LMW) heparin treatment of various thrombotic disorders. However, low preparations, including dalteparin, enoxaparin and molecularThe Medical weight Journal (LMW) of heparinsAustralia haveISSN: recently 0025-729X emerged 7 October as nadroparin, as well as the heparinoid danaparoid sodium, more2002 convenient, 177 6 379-383 safe and effective alternatives to unfrac- are approved for use in Australia. 1 tionated©The heparin Medical (BoxJournal 1). of AustraliaIn Australia, 2002 wwwLMW.mja.com.au heparins are ■ LMW heparins are replacing unfractionated heparin for replacingNew Drugs,unfractionated Old Drugs heparin for preventing and treating the prevention and treatment of venous thromboembolism venous thromboembolism and for the initial treatment of and the treatment of non-ST-segment-elevation acute unstable acute coronary syndromes. The LMW heparinoid coronary syndromes. danaparoid sodium is widely used to treat immune heparin- ■ induced thrombocytopenia. The advantages of LMW heparins over unfractionated heparin include a longer half-life (allowing once-daily or twice-daily subcutaneous dosing), high bioavailability and Limitations of unfractionated heparin predictable anticoagulant response (avoiding the need
    [Show full text]
  • Anticoagulation Reversal Guideline for Adults
    Anticoagulation Reversal Guideline for Adults Antithrombotic reversal strategies should be limited to clinical situations (i.e. life-threatening bleeding) where the immediate need for anticoagulant reversal outweighs the risk of thrombosis (either from the reversal agent itself or normalization of coagulation in a patient with underlying thromboembolic risk). These recommendations are meant to serve as general guidelines and should not replace clinical judgment. Always seek input from the appropriate specialists when indicated and include the patient and/or family in shared decision making when possible. This document is not meant to guide selection of patients for reversal therapies. Please refer to appropriate national guidelines to aide decision- making regarding need for reversal, if warranted. 1. ACC Expert Consensus Decision Pathway on Management of Bleeding in Patients on Oral Anticoagulants 2. Guideline for Reversal of Antithrombotics in Intracranial Hemorrhage: A Statement for Healthcare Professionals from the Neurocritical Care Society and Society of Critical Care Medicine All indications for anticoagulation are considered, including atrial fibrillation, venous thromboembolism, prosthetic cardiac valves, and intracardiac thrombus. Mechanical circulatory support devices, including temporary or permanent ventricular assist devices (i.e. LVADs), are excluded from this document. Whenever possible, anticoagulation should be resumed in a timely manner to avoid thromboembolic complications related to the underlying indication for anticoagulation. This guideline does not provide recommendations on resuming anticoagulation. References: • Tomaselli GF, Mahaffey KW, Cuker A, et al. 2017 ACC Expert Consensus Decision Pathway on Management of Bleeding in Patients on Oral Anticoagulants: A Report of the American College of Cardiology Task Force on Experts Consensus Decisions Pathways. J Am Coll Cardiol.
    [Show full text]
  • ACTIVASE (Alteplase) for Injection, for Intravenous Use Initial U.S
    Application 103172 This document contains: Label for ACTIVASE [Supplement 5203, Action Date 02/13/2015] Also available: Label for CATHFLO ACTIVASE [Supplement 5071, Action Date 01/04/2005] HIGHLIGHTS OF PRESCRIBING INFORMATION Acute Ischemic Stroke These highlights do not include all the information needed to use • Current intracranial hemorrhage. (4.1) ACTIVASE safely and effectively. See full prescribing information for • Subarachnoid hemorrhage. (4.1) ACTIVASE. Acute Myocardial Infarction or Pulmonary Embolism • History of recent stroke. (4.2) ACTIVASE (alteplase) for injection, for intravenous use Initial U.S. Approval: 1987 -----------------------WARNINGS AND PRECAUTIONS-----------------------­ • Increases the risk of bleeding. Avoid intramuscular injections. Monitor for ---------------------------INDICATIONS AND USAGE--------------------------­ bleeding. If serious bleeding occurs, discontinue Activase. (5.1) Activase is a tissue plasminogen activator (tPA) indicated for the treatment of • Monitor patients during and for several hours after infusion for orolingual • Acute Ischemic Stroke (AIS). (1.1) angioedema. If angioedema develops, discontinue Activase. (5.2) • Acute Myocardial Infarction (AMI) to reduce mortality and incidence of • Cholesterol embolism has been reported rarely in patients treated with heart failure. (1.2) thrombolytic agents. (5.3) Limitation of Use in AMI: the risk of stroke may be greater than the benefit • Consider the risk of reembolization from the lysis of underlying deep in patients at low risk of death
    [Show full text]
  • A First in Class Treatment for Thrombosis Prevention. a Phase I
    Journal of Cardiology and Vascular Medicine Research Open Access A First in Class Treatment for Thrombosis Prevention. A Phase I study with CS1, a New Controlled Release Formulation of Sodium Valproate 1,2* 2 3 2 1,2 Niklas Bergh , Jan-Peter Idström , Henri Hansson , Jonas Faijerson-Säljö , Björn Dahlöf 1Department of Molecular and Clinical Medicine, Institute of Medicine, Sahlgrenska Academy, University of Gothenburg, Gothenburg, Sweden 2 Cereno Scientific AB, Gothenburg, Sweden 3 Galenica AB, Malmö, Sweden *Corresponding author: Niklas Bergh, The Wallenberg Laboratory for Cardiovascular Research Sahlgrenska University Hospi- tal Bruna Stråket 16, 413 45 Göteborg, Tel: +46 31 3421000; E-Mail: [email protected] Received Date: June 11, 2019 Accepted Date: July 25, 2019 Published Date: July 27, 2019 Citation: Niklas Bergh (2019) A First in Class Treatment for Thrombosis Prevention? A Phase I Study With Cs1, a New Con- trolled Release Formulation of Sodium Valproate. J Cardio Vasc Med 5: 1-12. Abstract Several lines of evidence indicate that improving fibrinolysis by valproic acid may be a fruitful strategy for throm- bosis prevention. This study investigated the safety, pharmacokinetics, and effect on biomarkers for thrombosis of CS1, a new advanced controlled release formulation of sodium valproate designed to produce optimum valproic acid concen- trations during the early morning hours, when concentrations of plasminogen activator inhibitor (PAI)-1 and the risk of thrombotic events is highest. Healthy volunteers (n=17) aged 40-65 years were randomized to receive single doses of one of three formulations of CS1 (FI, FII, and FIII). The CS1 FII formulation showed the most favorable pharmacokinetics and was chosen for multiple dosing.
    [Show full text]
  • Predicting Potential Drugs for Breast Cancer Based on Mirna and Tissue Specificity
    Int. J. Biol. Sci. 2018, Vol. 14 971 Ivyspring International Publisher International Journal of Biological Sciences 2018; 14(8): 971-982. doi: 10.7150/ijbs.23350 Research Paper Predicting Potential Drugs for Breast Cancer based on miRNA and Tissue Specificity Liang Yu, Jin Zhao and Lin Gao School of Computer Science and Technology, Xidian University, Xi'an, 710071, P.R. China. Corresponding author: [email protected] © Ivyspring International Publisher. This is an open access article distributed under the terms of the Creative Commons Attribution (CC BY-NC) license (https://creativecommons.org/licenses/by-nc/4.0/). See http://ivyspring.com/terms for full terms and conditions. Received: 2017.10.16; Accepted: 2017.12.14; Published: 2018.05.22 Abstract Network-based computational method, with the emphasis on biomolecular interactions and biological data integration, has succeeded in drug development and created new directions, such as drug repositioning and drug combination. Drug repositioning, that is finding new uses for existing drugs to treat more patients, offers time, cost and efficiency benefits in drug development, especially when in silico techniques are used. MicroRNAs (miRNAs) play important roles in multiple biological processes and have attracted much scientific attention recently. Moreover, cumulative studies demonstrate that the mature miRNAs as well as their precursors can be targeted by small molecular drugs. At the same time, human diseases result from the disordered interplay of tissue- and cell lineage-specific processes. However, few computational researches predict drug-disease potential relationships based on miRNA data and tissue specificity. Therefore, based on miRNA data and the tissue specificity of diseases, we propose a new method named as miTS to predict the potential treatments for diseases.
    [Show full text]
  • Estonian Statistics on Medicines 2016 1/41
    Estonian Statistics on Medicines 2016 ATC code ATC group / Active substance (rout of admin.) Quantity sold Unit DDD Unit DDD/1000/ day A ALIMENTARY TRACT AND METABOLISM 167,8985 A01 STOMATOLOGICAL PREPARATIONS 0,0738 A01A STOMATOLOGICAL PREPARATIONS 0,0738 A01AB Antiinfectives and antiseptics for local oral treatment 0,0738 A01AB09 Miconazole (O) 7088 g 0,2 g 0,0738 A01AB12 Hexetidine (O) 1951200 ml A01AB81 Neomycin+ Benzocaine (dental) 30200 pieces A01AB82 Demeclocycline+ Triamcinolone (dental) 680 g A01AC Corticosteroids for local oral treatment A01AC81 Dexamethasone+ Thymol (dental) 3094 ml A01AD Other agents for local oral treatment A01AD80 Lidocaine+ Cetylpyridinium chloride (gingival) 227150 g A01AD81 Lidocaine+ Cetrimide (O) 30900 g A01AD82 Choline salicylate (O) 864720 pieces A01AD83 Lidocaine+ Chamomille extract (O) 370080 g A01AD90 Lidocaine+ Paraformaldehyde (dental) 405 g A02 DRUGS FOR ACID RELATED DISORDERS 47,1312 A02A ANTACIDS 1,0133 Combinations and complexes of aluminium, calcium and A02AD 1,0133 magnesium compounds A02AD81 Aluminium hydroxide+ Magnesium hydroxide (O) 811120 pieces 10 pieces 0,1689 A02AD81 Aluminium hydroxide+ Magnesium hydroxide (O) 3101974 ml 50 ml 0,1292 A02AD83 Calcium carbonate+ Magnesium carbonate (O) 3434232 pieces 10 pieces 0,7152 DRUGS FOR PEPTIC ULCER AND GASTRO- A02B 46,1179 OESOPHAGEAL REFLUX DISEASE (GORD) A02BA H2-receptor antagonists 2,3855 A02BA02 Ranitidine (O) 340327,5 g 0,3 g 2,3624 A02BA02 Ranitidine (P) 3318,25 g 0,3 g 0,0230 A02BC Proton pump inhibitors 43,7324 A02BC01 Omeprazole
    [Show full text]
  • ST Elevation Myocardial Infarction (STEMI) Reperfusion Order Set
    Form Title ST Elevation Myocardial Infarction (STEMI) Reperfusion Order Set Form Number CH-0454 © 2018, Alberta Health Services, CKCM This work is licensed under the Creative Commons Attribution-NonCommercial-NoDerivatives 4.0 International License. The license does not apply to content for which the Alberta Health Services is not the copyright owner. To view a copy of this license, visit https://creativecommons.org/licenses/by-nc-nd/4.0/ Disclaimer: This material is intended for use by clinicians only and is provided on an DVLVZKHUHLVEDVLV$OWKRXJKUHDVRQDEOHHIIRUWVZHUHPDGHWRFRQ¿UPWKHDFFXUDF\RIWKH information, Alberta Health Services does not make any representation or warranty, express, LPSOLHGRUVWDWXWRU\DVWRWKHDFFXUDF\UHOLDELOLW\FRPSOHWHQHVVDSSOLFDELOLW\RU¿WQHVVIRU a particular purpose of such information. This material is not a substitute for the advice of a TXDOL¿HGKHDOWKSURIHVVLRQDO$OEHUWD+HDOWK6HUYLFHVH[SUHVVO\GLVFODLPVDOOOLDELOLW\IRUWKHXVH of these materials, and for any claims, actions, demands or suits arising from such use. Patient label placed here (if applicable) or if labels are not + used, minimum information below is required + Last Name First Name Birthdate (yyyy-Mon-dd) Gender PHN # ST Elevation Myocardial Infarction (STEMI) Reperfusion Order Set Phone Number Date Time Initial (yyyy-Mon-dd) (hh:mm) 1. Patient Treatment & Monitoring Complete 12 lead ECG Stat if not already completed. Review with Physician. Take initial vital signs (Temp, HR, RR, SpO2, BP both arms) Repeat vital signs with any chest pain or equivalent symptoms. Initiate intravenous (IV) and infuse 0.9% sodium chloride at 30mL/hour (left arm preferred) Provide oxygen to keep SpO2 greater than or equal to 90% or with clinical signs of hypoxemia. Give acetylsalicylic acid 160 mg orally now, chewed or swallowed OR acetylsalicylic acid 160 mg orally administered pre-arrival (Time _______).
    [Show full text]
  • Original Article Endogenous Risk Factors for Deep-Vein Thrombosis in Patients with Acute Spinal Cord Injuries
    Spinal Cord (2007) 45, 627–631 & 2007 International Spinal Cord Society All rights reserved 1362-4393/07 $30.00 www.nature.com/sc Original Article Endogenous risk factors for deep-vein thrombosis in patients with acute spinal cord injuries S Aito*,1, R Abbate2, R Marcucci2 and E Cominelli1 1Spinal Unit, Careggi University Hospital, Florence, Italy; 2Medical division, coagulation disease, Careggi University Hospital, Florence, Italy Study design: Case–control study. Aim of the study: Investigate the presence of additional endogenous risk factors of deep-vein thrombosis (DVT). Setting: Regional Spinal Unit of Florence, Italy. Methods: A total of 43 patients with spinal lesion and a history of DVT during the acute stage of their neurological impairment (Group A) were comprehensively evaluated and the blood concentrations of the following risk factors, that are presumably associated with DVT, were determined: antithrombin III (ATIII), protein C (PC), protein S (PS), factor V Leiden, gene 200210A polymorphism, homocysteine (Hcy), inhibitor of plasminogen activator-1 (PAI-1) and lipoprotein A (LpA). The control group (Group B) consisted of 46 patients matched to Group A for sex, age, neurological status and prophylactic treatment during the acute stage, with no history of DVT. Statistical analysis was performed using the Mann–Whitney and Fisher’s exact tests. Results: Of the individuals in GroupA, 14% had no risk factor and 86% had at least one; however, in GroupB 54% had no endogenous risk factors and 46% had at least one. None of the individuals in either grouphad a deficit in their coagulation inhibitors (ATIII, PC and PS), and the LpA level was equivalent in the two groups.
    [Show full text]
  • Use of Antithrombotic Medications in the Presence of Neuraxial Anesthesia
    Guideline: Use of Antithrombotic Medications In The Presence of Neuraxial Anesthesia Use of Antithrombotic Medications In The Presence of Neuraxial Anesthesia Purpose of Guidelines: To establish appropriate administration and timing of antithrombotic medications before, during, and after the use of neuraxial anesthesia to minimize the risk of bleeding. Definitions: Neuraxial Anesthesia = Delivery of anesthetic medication requiring placement of catheters or needles into the epidural or spinal space Antithrombotic Medications = Anticoagulant, antiplatelet, and thrombolytic medications Background1-3: Spinal (or epidural) hematomas are a rare but catastrophic complication of neuraxial anesthesia. The risk of hematoma development is increased in the presence of antithrombotic medication. Patients undergoing neuraxial anesthesia must have the risks of bleeding from neuraxial interventions balanced with the underlying and ongoing risk of thromboembolism necessitating anticoagulation. Recommendations for the management of specific antithrombotics in patients undergoing neuraxial anesthesia are provided in the following Tables: o Table 1. Management of Intravenous and Subcutaneous Anticoagulation Therapy in Patients Undergoing Neuraxial Anesthesia o Table 2. Management of ORAL Anticoagulation Therapy in Patients Undergoing Neuraxial Anesthesia o Table 3. Management of ORAL and Intravenous Antiplatelet and Thrombolytic Therapy in Patients Undergoing Neuraxial Anesthesia Workflow if a Contradicted Medication is Prescribed: Providers will have
    [Show full text]