DOCSLIB.ORG

(12) Patent Application Publication (10) Pub. No.: US 2004/0018550 A1 Bellacosa (43) Pub

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
(12) Patent Application Publication (10) Pub. No.: US 2004/0018550 A1 Bellacosa (43) Pub US 200400185.50A1 (19) United States (12) Patent Application Publication (10) Pub. No.: US 2004/0018550 A1 Bellacosa (43) Pub. Date: Jan. 29, 2004 (54) ANTIBODIES IMMUNOLOGICALLY continuation-in-part of application No. 09/463,891, SPECIFIC FOR A DNA REPAIR filed on Jan. 28, 2000, now abandoned, filed as 371 of ENDONUCLEASE AND METHODS OF USE international application No. PCT/US98/15828, filed THEREOF on Jul. 28, 1998. (76) Inventor: Alfonso Bellacosa, Philadelpha, PA Publication Classification (US) (51) Int. Cl." ............................. C12Q 1/68; CO7H 21/04 Correspondence Address: DANN, DORFMAN, HERRELL & SKILLMAN (52) U.S. Cl. ............................................... 435/6; 536/24.3 1601 MARKET STREET SUTE 2400 PHILADELPHIA, PA 19103-2307 (US) (57) ABSTRACT (21) Appl. No.: 10/629,951 An isolated nucleic acid molecule encoding a human DNA repair enzyme, MED1, is disclosed. Like other mismatch (22) Filed: Jul. 29, 2003 repair genes which are mutated in certain cancers, MED1, encoding nucleic acids, proteins and antibodies thereto may Related U.S. Application Data be used to advantage in genetic or cancer Screening assayS. MED1, which recognizes and cleaves DNA, may also be (63) Continuation of application No. 09/629,222, filed on used for the diagnostic detection of mutations and genetic Jul. 31, 2000, now Pat. No. 6,599,700, which is a variants Patent Application Publication Jan. 29, 2004 Sheet 1 of 44 US 2004/0018550 A1 LexA-MLH1 / B42-f5 LeXA/B42-f5 LexA-myc / B42-f5 LeXA-bicoid / B42-f5 LeXA-K-rev 1 / B42-f5 LeXA-K-reV-1 / Krit Leu- X-gal Fig. I Patent Application Publication Jan. 29, 2004 Sheet 2 of 44 US 2004/00185.50A1 3 St C - O 1.35 -> Fig. 2 Patent Application Publication Jan. 29, 2004 Sheet 4 of 44 US 2004/0018550 A1 S. A e. > a > a as a C EY pa M. A () E r. se on U A KD (9 - - r a () (r. A (5 n, as a > - 2 <d r ( E- a la s SC I ap r - a () ?h > o d- 2. r (CH s () a a O. a CD (na > - A > A 4 A d Y - it H - (5) r I a. r () > a r C a O. a. O. N. Sea 3. A "O5 O.i "O ;C, "O O, Patent Application Publication Jan. 29, 2004 Sheet 5 of 44 US 2004/0018550 A1 a - E st U. - to a is a bar Z. a -- a - - 4 H as A as as a ir - - 2 O ( 2. appa as a as CD yer E 55wr vs.r- g er re EE5 sh w e 5'EE:o EEE5 ran to y > rhBE to g r E:5to S. C. As Oto b E) o U to O C. A Patent Application Publication Jan. 29, 2004 Sheet 6 of 44 US 2004/0018550 A1 3 E.s c E as Eaa Uni a - D > s > H Sc Cl D s E r str ), a a CD U - La - - Ca a CD C) U 2. K. Y i. He I - - r a A Patent Application Publication Jan. 29, 2004 Sheet 7 of 44 US 2004/0018550 A1 Fig. 5 Patent Application Publication Jan. 29, 2004 Sheet 8 of 44 US 2004/0018550 A1 s L > ch CO CC CC 2 Z ?h ?h O CD O Ol KD 144 87 32.7- Fig. 6 Patent Application Publication Jan. 29, 2004 Sheet 9 of 44 US 2004/0018550 A1 HCOO Patent Application Publication Jan. 29, 2004 Sheet 10 of 44 US 2004/0018550 A1 Fig. 7B Patent Application Publication Jan. 29, 2004 Sheet 11 of 44 US 2004/0018550 A1 Fig. 8 Patent Application Publication Jan. 29, 2004 Sheet 12 of 44 US 2004/0018550 A1 i s s O C) N - ( C) Patent Application Publication Jan. 29, 2004 Sheet 13 of 44 US 2004/0018550 A1 Fig. 10A Patent Application Publication Jan. 29, 2004 Sheet 14 of 44 US 2004/0018550 A1 MBD: - -- - - - - - - -- Cold methylated: - - - - -- - Cold unmethylated: - - + - - -- Bound-o- 8P-methylated 3P-unmethylated Fig. 10B Patent Application Publication Jan. 29, 2004 Sheet 15 of 44 US 2004/00185.50A1 -- hvSH2 total lysate IP: anti-FLAG Western: anti-hvSH2 Fig. 11A Patent Application Publication Jan. 29, 2004 Sheet 16 of 44 US 2004/0018550 A1 total lysate IP: anti-FLAG Western: anti-FAG Fig. 11B Patent Application Publication Jan. 29, 2004 Sheet 17 of 44 US 2004/0018550 A1 Fig. 1 FC total lysate P: anti-HT HT-MED1/CMV5: CMV5: MLH1-- HT-MED1-- Patent Application Publication Jan. 29, 2004 Sheet 18 of 44 US 2004/0018550 A1 SIZI‘313N 9}}|.9||H8EB|8||01JH| Patent Application Publication Jan. 29, 2004 Sheet 19 of 44 US 2004/0018550 A1 O Y4 3 Ois H do r O O O O CO O N OO r CO s & d .9 S O CD O) CD t S C Fig. 13 Patent Application Publication Jan. 29, 2004 Sheet 20 of 44 US 2004/0018550 A1 c) CD D Y d 9C E O s 23.1 kbp - 9.4 - Fig. 14A Fig. 14B Patent Application Publication Jan. 29, 2004 Sheet 21 of 44 US 2004/0018550 A1 s & Fig. 15. Patent Application Publication Jan. 29, 2004 Sheet 22 of 44 US 2004/0018550 A1 CAAGGAAGAT ATTGCIGTTG GACTGGGAGG AGTGGGAGAA GATGGAAAGG 51 ACCTGGTGAT AAGCAGTGAG CGCAGCTCCC TTCTCCAAGA GCCCACTGCT 101 TCTACTCTGT CTACTACTAC AGCGACAGAA GGCCACAAGC CTGTCCCGTG 151 TGGATGGGAA AGAGTTGTGA AGCAAAGGIT ATCTGGGAAA ACTGCAGGAA 201 AATTTGATGT ATACTITATC AGCCCACAAG GATTGAAGTT CAGATCAAAA 251 CGTTCACTTG CTAATTATCT TCTCAAAAAT GGGGAGACTT TTCTTAAGCC 301 TGAAGATTTT AATTTTACTG TACTGCCGAA AGGGAGCATC AATCCCGGTT 351 ATAAACACCA AAGTTTGGCA GCTCTGACTT CCCTGCAGCC AAATGAAACT 401 GACGTTTCAA AGCAGAACCT CAAGACACGA AGCAAGTGGA AAACAGATGT 451 GTTGCCTCTG CCCAGTGGTA CTTCAGAGTC GCCAGAAAGC AGCGGACTGT 501 CTAACTCTAA CTCGGCTTGC TTGCTATTGA GAGA ACATAG GGACATTCAG 591 GATGTTGACT CTGAGA AGAG GAGAAAGTCC AAAAGAAAGG TGACTGTTTT 601 GAAAGGAACT GCAAGTCAGA AAACCAAACA AAAGTGCAGG AAGAGTCTCT 651 TAGAGTCTAC TCAAAGAAAC AGAAAAAGAG CATCTGTGGT TCAGAAGGTG 701. GGTGCTGATC GCGAGCTGGT GCCACAGGAA AGTCAACTCA ACAGAACCCT 751. CTGCCCTGCA GATGCCTGTG CAAGGGAGAC TGTTGGCCTG GCTGGGGAAG 801 AAAAATCACC AAGCCCAGGA CTGGATCTTT GTTTCATACA AGTAACTTCT 851 GGCACCACAA ACAAATTCCA TTCA ACTGAA GCAGCAGGTG AAGCAAATCG 901 TGAGCAGACT TTTTTAGAAT CAGAGGAAAT CAGATCGAAG GGAGACAGAA 951 AGGGGGAGGC ACATTTGCAT ACTGGTGTTT TACAGGATGG CTCTGAAATG 1001 CCCAGCTGCT CACAAGCCAA GAAACACTTT ACTTCTGAGA CATTTCAAGA 1051 AGACAGCATC CCACGGACAC AAGTAGAAAA AAGGAAAACA AGCCTGTATT 1.101 TTTCCAGCAA GTACAACAAA GAAGCTCTTA GCCCCCCAAG ACGCAAATCC 1151 TTCAAGAAAT GGACCCCTCC TCGGTCACC TTTAATCTTG TTCAAGAAAT 120 ACTTTTCCAT GACCCATGGA AGCTCCTCAT CGCGACTATA TTTCTCAATC 1251 GGACCTCAGG CAAGATGGCC ATCCCTGTGC TGTGGGAGTT TCTAGAGAAG 1301 TACCCTTCAG CTGAAGTGGC CCGAGCTGCC GACTGGAGGG ACGTGTCGGA Fig. 6A Patent Application Publication Jan. 29, 2004 Sheet 23 of 44 US 2004/0018550 A1 1351 GCTTCTCAAG CCTCTTGGTC TCTACGATCT CCGTGCAAAA ACCATTATCA 1401, AGTTCTCAGA TGAATATCTG ACAAAGCAGT GGAGGTATCC GATTGAGCTT 1451 CATGGGATTT GGTTAAAATA TGGCAACGAC TCTACCGGAT. CTTTTGTGTC 1501 AATGAATGGA ACAG Fig. 16B Patent Application Publication Jan. 29, 2004 Sheet 24 of 44 US 2004/0018550 A1 mouse MED1 protein (upper sequence) X human MED1 protein (lower sequence) 1. KEDIAVGLGGVGEDGKDLVI. SSERSSLLQEPTAST. LSSTTATEGHKP A 7 36 KEDVAMELERVGEDEEOMMIKRSSECNPLLOEPIASAOFGATAGTECRKS 85 48 VPCGWERVVKQRLSGKTAGKFDVYFISPOGLKFRSKRSLANYLLKNGETF 97 | | | | | | | | | | | | | | | | | | : | | | | | | | | | | | | | | | | | | | | | | | | | | 86 VPCGWERVVKORLFGKTAGRFDVYFISPQGLKFRSKSSLANYLHKNGETS 135 98 LKPEDFNFTVLPKGSINPGYKHQSLAALTSLOPNETDVSKQNLKTRSKWK 147 | | | | | . || | | | | | : : . : 136 LKPEDFDFTVLSKRGIKSRYKDCSMAALTSHLONQSNNSNWNLRTRSKCK 185 148 TDVLPLPSGTSESPESSGLSNSNSACLLLREHRDIQDVDSEKRRKSKRKV 197 | | | | | | | | | | | | | | | | : : ||. | | | || 186 KDVFMPPSSSSELOESRGLSNFTSTHLLLKEDEGVDDVNFRKVRKPKGKV 235 198 TVLKGTASOKTKOKCRKSLLESTORNRKRAS. - - - - - - - - - - - - - 228 236 TILKGIPIKKTKKGCRKSCSGFVQSDSKRESVCNKADAESEPVAQKSQLD 285 229 . EDSIPRTOVEKRKTSLYFSSKYNKEALSPPRRKSF 263 . ; ; | | | | | | | | | | | | | | | | | . 386 CSPTRKDFTGEKIFQEDTIPRTOIERRKTSLYFSSKYNKEALSPPRRKAF 435 264 KKWTPPRSPFNLVOEILFHDPWKLLIATIFLNRTSGKMAIPVLWEFLELY 313 | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | 436 KKWTPPRSPFNLVOETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKY 485 314 PSAEVARAADWRDVSELLKPLGLYDLRAKTIIKFSDEYLTKQWRYPIELH 363 | | | | | | | | | | | | | | | | | | | | | | | | | | | | | : | | | | | | | | | |: 486 PSAEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELH 535 364 GIWLKYGNDSYRIFCVNEWKO 384 | | | | | | | | | | | | | | | 536 GIG. KYGNDSYRIFCVNEWKQ 555 Fig. 17 Patent Application Publication Jan. 29, 2004 Sheet 25 of 44 US 2004/0018550 A1 Fig. 18A Exon 2 ggttttgtttittccago'AAGGAAGATATTGCTGTTGGACTGGGAGGAGTG GGAGAAGATGGAAAGGACCTGGTGATAAGCAGTGAGCGCAGCTCCCTTCT CCAAGAGCCCACTGCTTCTACTCTGTCTAGTACTACAGCGACAGAAGGCC ACAAGCCTGTCCCGTGTGGATGGGAAAGAGTTGTGAAGCAAAGGTTATCT GGGAAAACTGCAGGAAAATTTGATGTATACTTTATCAGgtaagcatttag Galaggaaaata Fig. 18B Exon 3 cttttttittttitccttittaagCCCACAAGGATTGAAGTTCAGATCAAAAC GTTCACTTGCTAATTATCTTCTCAAAAATGGGGAGACTTTTCTTAAGCCT GAAGATTTTAATTTTACTGTACTGCCGAAAGGGAGCATCAATCCCGGTTA TAAACACCAAAGTTTGGCAGCTCTGACTTCCCTGCAGCCAAATGAAACTG ACGTTTCAAAGCAGAACCTCAAGACACGAAGCAAGTGGAAAACAGATGTG TTGCCTCTGCCCAGTGGTACTTCAGAGICGCCAGAAAGCAGCGGACTGTC TAACTCTAACTCGGCTTGCTTGCTATTGAGAGAACATAGGGACATTCAGG ATGTTGACTCTGAGAAGAGGAGAAAGTCCAAAAGAAAGGTGACTGTTTTG AAAGGAACTGCAAGTCAGAAAACCAAACAAAAGTGCAGGAAGAGTCTCTT AGAGTCTACTCAAAGAAACAGAAAAAGAGCATCTGTGGTTCAGAAGGTGG GTGCTGATCGCGAGCTGGTGCCACAGGAAAGTCAACTCAACAGAACCCTC TGCCCTGCAGATGCCTGTGCAAGGGAGACTGTTGGCCTGGCTGGGGAAGA AAAATCACCAAGCCCAGGACTGGATCTTTGTTTCATACAAGTAACTTCG GCACCACAAACAAATTCCATTCAACTGAAGCAGCAGGTGAAGCAAATCGT GAGCAGACTTTTTTAGAATCAGAGGAAATCAGATCGAAGGGAGACAGAAA GGGGGAGGCACATTTGCATACTGGTGTTTTACAGGATGGCTCTGAAATGC CCAGCTGCTCACAAGCCAAGAAACACTTTACTTCTGAGACATTTCAAGgt actCagtgcatgaaaa Patent Application Publication Jan. 29, 2004 Sheet 26 of 44 US 2004/0018550 A1 Fig. 18C EKon 4 gactataaactaattittgct tctoagAAGACAGCATCCCACGGACACAAG TAGAAAAAAGGAAAACAAGCCTGTATTTTTCCAGCAAGTACAACAAAGAA Ggtaccoacct ttccctaagc Fig. 18D Eko. 5 tatatttntgnagCTCTTAGCCCCCCAAGACGCAAATCCTTCAAGAAATG GACCCCCCTCGGTCACCTTTAATCTTGTTCAAGAAATACTTTTCCATG ACCCATGGAAGCTCCTCATCGCGACTATATTTCTCAATCGGACCTCAGg ttingggg.tcattgncat Fig. 18E Exon 6 tgtt tatgctccc.cagoCAAGATGGCCATCCCTGTGCTGTGGGAGTTTCT AGAGAAGTACCCTTCAGCTGAAGTGGCCCGAGCTGCCGACTGGAGGGACG
Load more

Recommended publications
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • 4-6 Weeks Old Female C57BL/6 Mice Obtained from Jackson Labs Were Used for Cell Isolation
    Methods Mice: 4-6 weeks old female C57BL/6 mice obtained from Jackson labs were used for cell isolation. Female Foxp3-IRES-GFP reporter mice (1), backcrossed to B6/C57 background for 10 generations, were used for the isolation of naïve CD4 and naïve CD8 cells for the RNAseq experiments. The mice were housed in pathogen-free animal facility in the La Jolla Institute for Allergy and Immunology and were used according to protocols approved by the Institutional Animal Care and use Committee. Preparation of cells: Subsets of thymocytes were isolated by cell sorting as previously described (2), after cell surface staining using CD4 (GK1.5), CD8 (53-6.7), CD3ε (145- 2C11), CD24 (M1/69) (all from Biolegend). DP cells: CD4+CD8 int/hi; CD4 SP cells: CD4CD3 hi, CD24 int/lo; CD8 SP cells: CD8 int/hi CD4 CD3 hi, CD24 int/lo (Fig S2). Peripheral subsets were isolated after pooling spleen and lymph nodes. T cells were enriched by negative isolation using Dynabeads (Dynabeads untouched mouse T cells, 11413D, Invitrogen). After surface staining for CD4 (GK1.5), CD8 (53-6.7), CD62L (MEL-14), CD25 (PC61) and CD44 (IM7), naïve CD4+CD62L hiCD25-CD44lo and naïve CD8+CD62L hiCD25-CD44lo were obtained by sorting (BD FACS Aria). Additionally, for the RNAseq experiments, CD4 and CD8 naïve cells were isolated by sorting T cells from the Foxp3- IRES-GFP mice: CD4+CD62LhiCD25–CD44lo GFP(FOXP3)– and CD8+CD62LhiCD25– CD44lo GFP(FOXP3)– (antibodies were from Biolegend). In some cases, naïve CD4 cells were cultured in vitro under Th1 or Th2 polarizing conditions (3, 4).
    [Show full text]
  • The Cgmp-Dependent Protein Kinase 2 Contributes to Cone Photoreceptor Degeneration in the Cnga3-Deficient Mouse Model of Achroma
    International Journal of Molecular Sciences Article The cGMP-Dependent Protein Kinase 2 Contributes to Cone Photoreceptor Degeneration in the Cnga3-Deficient Mouse Model of Achromatopsia Mirja Koch 1, Constanze Scheel 1, Hongwei Ma 2, Fan Yang 2, Michael Stadlmeier 3,† , Andrea F. Glück 3, Elisa Murenu 1,4, Franziska R. Traube 3 , Thomas Carell 3, Martin Biel 1, Xi-Qin Ding 2 and Stylianos Michalakis 1,4,* 1 Department of Pharmacy—Center for Drug Research, Ludwig-Maximilians-University, 81377 Munich, Germany; [email protected] (M.K.); [email protected] (C.S.); [email protected] (E.M.); [email protected] (M.B.) 2 Department of Cell Biology, University of Oklahoma Health Sciences Center, Oklahoma City, OK 73104, USA; [email protected] (H.M.); [email protected] (F.Y.); [email protected] (X.-Q.D.) 3 Department of Chemistry, Ludwig-Maximilians-University, 81377 Munich, Germany; [email protected] (M.S.); [email protected] (A.F.G.); [email protected] (F.R.T.); [email protected] (T.C.) 4 Department of Ophthalmology, Ludwig-Maximilians-University, 80336 Munich, Germany * Correspondence: [email protected] † Present affiliation: Lewis-Sigler Institute for Integrative Genomics, Princeton University, NJ 08544, USA. Abstract: Mutations in the CNGA3 gene, which encodes the A subunit of the cyclic guanosine monophosphate (cGMP)-gated cation channel in cone photoreceptor outer segments, cause total colour blindness, also referred to as achromatopsia. Cones lacking this channel protein are non- functional, accumulate high levels of the second messenger cGMP and degenerate over time after induction of ER stress.
    [Show full text]
  • An Investigation Into the Genetic Architecture of Multiple System Atrophy and Familial Parkinson's Disease
    An investigation into the genetic architecture of multiple system atrophy and familial Parkinson’s disease By Monica Federoff A thesis submitted to University College London for the degree of Doctor of Philosophy Laboratory of Neurogenetics, Department of Molecular Neuroscience, Institute of Neurology, University College London (UCL) 2 I, Monica Federoff, confirm that the work presented in this thesis is my own. Information derived from other sources and collaborative work have been indicated appropriately. Signature: Date: 09/06/2016 3 Acknowledgements: When I first joined the Laboratory of Neurogenetics (LNG), NIA, NIH as a summer intern in 2008, I had minimal experience working in a laboratory and was both excited and anxious at the prospect of it. From my very first day, Dr. Andrew Singleton was incredibly welcoming and introduced me to my first mentor, Dr. Javier Simon- Sanchez. Within just ten weeks working in the lab, both Dr. Singleton and Dr. Simon- Sanchez taught me the fundamental skills in an encouraging and supportive environment. I quickly got to know others in the lab, some of whom are still here today, and I sincerely appreciate their help with my assimilation into the LNG. After returning for an additional summer and one year as an IRTA postbac, I was honored to pursue a PhD in such an intellectually stimulating and comfortable environment. I am so grateful that Dr. Singleton has been such a wonderful mentor, as he is not only a brilliant scientist, but also extremely personable and approachable. If I inquire about meeting with him, he always manages to make time in his busy schedule and provides excellent guidance and mentorship.
    [Show full text]
  • GANC (NM 001301409) Human Untagged Clone Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for SC335588 GANC (NM_001301409) Human Untagged Clone Product data: Product Type: Expression Plasmids Product Name: GANC (NM_001301409) Human Untagged Clone Tag: Tag Free Symbol: GANC Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin Fully Sequenced ORF: >NCBI ORF sequence for NM_001301409, the custom clone sequence may differ by one or more nucleotides ATGGAAGCAGCAGTGAAAGAGGAAATAAGTCTTGAAGATGAAGCTGTAGATAAAAACATTTTCAGAGACT GTAACAAGATCGCATTTTACAGGCGTCAGAAACAGTGGCTTTCCAAGAAGTCCACCTATCAGGCATTATT GGATTCAGTCACAACAGATGAAGACAGCACCAGGTTCCAAATCATCAATGAAGCAAGTAAGGTTCCTCTC CTGGCTGAAATTTATGGTATAGAAGGAAACATTTTCAGGCTTAAAATTAATGAAGAGACTCCTCTAAAAC CCAGATTTGAAGTTCCGGATGTCCTCACAAGCAAGCCAAGCACTGTAAGGCTGATTTCATGCTCTGGGGA CACAGGCAGTCTGATATTGGCAGATGGAAAAGGAGACCTGAAGTGCCATATCACAGCAAACCCATTCAAG GTAGACTTGGTGTCTGAAGAAGAGGTTGTGATTAGCATAAATTCCCTGGGCCAATTATACTTTGAGCATC TACAGATTCTTCACAAACAAAGAGCTGCTAAAGAAAATGAGGAGGAGACATCAGTGGACACCTCTCAGGA AAATCAAGAAGATCTGGGCCTGTGGGAAGAGAAATTTGGAAAATTTGTGGATATCAAAGCTAATGGCCCT TCTTCTATTGGTTTGGATTTCTCCTTGCATGGATTTGAGCATCTTTATGGGATCCCACAACATGCAGAAT CACACCAACTTAAAAATACTGGTGATGGAGATGCTTACCGTCTTTATAACCTGGATGTCTATGGATACCA AATATATGATAAAATGGGCATTTATGGTTCAGTACCTTATCTCCTGGCCCACAAACTGGGCAGAACTATA GGTATTTTCTGGCTGAATGCCTCGGAAACACTGGTGGAGATCAATACAGAGCCTGCAGTAGAGTACACAC TGACCCAGATGGGCCCAGTTGCTGCTAAACAAAAGGTCAGATCTCGCACTCATGTGCACTGGATGTCAGA
    [Show full text]
  • Supplementary Table S4. FGA Co-Expressed Gene List in LUAD
    Supplementary Table S4. FGA co-expressed gene list in LUAD tumors Symbol R Locus Description FGG 0.919 4q28 fibrinogen gamma chain FGL1 0.635 8p22 fibrinogen-like 1 SLC7A2 0.536 8p22 solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 DUSP4 0.521 8p12-p11 dual specificity phosphatase 4 HAL 0.51 12q22-q24.1histidine ammonia-lyase PDE4D 0.499 5q12 phosphodiesterase 4D, cAMP-specific FURIN 0.497 15q26.1 furin (paired basic amino acid cleaving enzyme) CPS1 0.49 2q35 carbamoyl-phosphate synthase 1, mitochondrial TESC 0.478 12q24.22 tescalcin INHA 0.465 2q35 inhibin, alpha S100P 0.461 4p16 S100 calcium binding protein P VPS37A 0.447 8p22 vacuolar protein sorting 37 homolog A (S. cerevisiae) SLC16A14 0.447 2q36.3 solute carrier family 16, member 14 PPARGC1A 0.443 4p15.1 peroxisome proliferator-activated receptor gamma, coactivator 1 alpha SIK1 0.435 21q22.3 salt-inducible kinase 1 IRS2 0.434 13q34 insulin receptor substrate 2 RND1 0.433 12q12 Rho family GTPase 1 HGD 0.433 3q13.33 homogentisate 1,2-dioxygenase PTP4A1 0.432 6q12 protein tyrosine phosphatase type IVA, member 1 C8orf4 0.428 8p11.2 chromosome 8 open reading frame 4 DDC 0.427 7p12.2 dopa decarboxylase (aromatic L-amino acid decarboxylase) TACC2 0.427 10q26 transforming, acidic coiled-coil containing protein 2 MUC13 0.422 3q21.2 mucin 13, cell surface associated C5 0.412 9q33-q34 complement component 5 NR4A2 0.412 2q22-q23 nuclear receptor subfamily 4, group A, member 2 EYS 0.411 6q12 eyes shut homolog (Drosophila) GPX2 0.406 14q24.1 glutathione peroxidase
    [Show full text]
  • Newborn Screening for Pompe Disease
    Newborn Screening for Pompe Disease • Wuh-Liang Hwu, Yin-Hsiu Chien and Raymond Wang Newborn Screening for Pompe Disease Edited by Wuh-Liang Hwu, Yin-Hsiu Chien and Raymond Wang Printed Edition of the Special Issue Published in International Journal of Neonatal Screening www.mdpi.com/journal/IJNS Newborn Screening for Pompe Disease Newborn Screening for Pompe Disease Editors Wuh-Liang Hwu Yin-Hsiu Chien Raymond Wang MDPI • Basel • Beijing • Wuhan • Barcelona • Belgrade • Manchester • Tokyo • Cluj • Tianjin Editors Wuh-Liang Hwu Yin-Hsiu Chien Raymond Wang National Taiwan University National Taiwan University Children’s Hospital of Orange Hospital Hospital County Taiwan Taiwan USA Editorial Office MDPI St. Alban-Anlage 66 4052 Basel, Switzerland This is a reprint of articles from the Special Issue published online in the open access journal International Journal of Neonatal Screening (ISSN 2409-515X) (available at: https://www.mdpi.com/ journal/IJNS/special issues/pompe). For citation purposes, cite each article independently as indicated on the article page online and as indicated below: LastName, A.A.; LastName, B.B.; LastName, C.C. Article Title. Journal Name Year, Volume Number, Page Range. ISBN 978-3-0365-0580-0 (Hbk) ISBN 978-3-0365-0581-7 (PDF) Cover image courtesy of the American Academy of Pediatrics. © 2021 by the authors. Articles in this book are Open Access and distributed under the Creative Commons Attribution (CC BY) license, which allows users to download, copy and build upon published articles, as long as the author and publisher are properly credited, which ensures maximum dissemination and a wider impact of our publications.
    [Show full text]
  • Multiplexed Engineering Glycosyltransferase Genes in CHO Cells Via Targeted Integration for Producing Antibodies with Diverse Complex‑Type N‑Glycans Ngan T
    www.nature.com/scientificreports OPEN Multiplexed engineering glycosyltransferase genes in CHO cells via targeted integration for producing antibodies with diverse complex‑type N‑glycans Ngan T. B. Nguyen, Jianer Lin, Shi Jie Tay, Mariati, Jessna Yeo, Terry Nguyen‑Khuong & Yuansheng Yang* Therapeutic antibodies are decorated with complex‑type N‑glycans that signifcantly afect their biodistribution and bioactivity. The N‑glycan structures on antibodies are incompletely processed in wild‑type CHO cells due to their limited glycosylation capacity. To improve N‑glycan processing, glycosyltransferase genes have been traditionally overexpressed in CHO cells to engineer the cellular N‑glycosylation pathway by using random integration, which is often associated with large clonal variations in gene expression levels. In order to minimize the clonal variations, we used recombinase‑mediated‑cassette‑exchange (RMCE) technology to overexpress a panel of 42 human glycosyltransferase genes to screen their impact on antibody N‑linked glycosylation. The bottlenecks in the N‑glycosylation pathway were identifed and then released by overexpressing single or multiple critical genes. Overexpressing B4GalT1 gene alone in the CHO cells produced antibodies with more than 80% galactosylated bi‑antennary N‑glycans. Combinatorial overexpression of B4GalT1 and ST6Gal1 produced antibodies containing more than 70% sialylated bi‑antennary N‑glycans. In addition, antibodies with various tri‑antennary N‑glycans were obtained for the frst time by overexpressing MGAT5 alone or in combination with B4GalT1 and ST6Gal1. The various N‑glycan structures and the method for producing them in this work provide opportunities to study the glycan structure‑and‑function and develop novel recombinant antibodies for addressing diferent therapeutic applications.
    [Show full text]
  • Whole Exome Sequencing in Families at High Risk for Hodgkin Lymphoma: Identification of a Predisposing Mutation in the KDR Gene
    Hodgkin Lymphoma SUPPLEMENTARY APPENDIX Whole exome sequencing in families at high risk for Hodgkin lymphoma: identification of a predisposing mutation in the KDR gene Melissa Rotunno, 1 Mary L. McMaster, 1 Joseph Boland, 2 Sara Bass, 2 Xijun Zhang, 2 Laurie Burdett, 2 Belynda Hicks, 2 Sarangan Ravichandran, 3 Brian T. Luke, 3 Meredith Yeager, 2 Laura Fontaine, 4 Paula L. Hyland, 1 Alisa M. Goldstein, 1 NCI DCEG Cancer Sequencing Working Group, NCI DCEG Cancer Genomics Research Laboratory, Stephen J. Chanock, 5 Neil E. Caporaso, 1 Margaret A. Tucker, 6 and Lynn R. Goldin 1 1Genetic Epidemiology Branch, Division of Cancer Epidemiology and Genetics, National Cancer Institute, NIH, Bethesda, MD; 2Cancer Genomics Research Laboratory, Division of Cancer Epidemiology and Genetics, National Cancer Institute, NIH, Bethesda, MD; 3Ad - vanced Biomedical Computing Center, Leidos Biomedical Research Inc.; Frederick National Laboratory for Cancer Research, Frederick, MD; 4Westat, Inc., Rockville MD; 5Division of Cancer Epidemiology and Genetics, National Cancer Institute, NIH, Bethesda, MD; and 6Human Genetics Program, Division of Cancer Epidemiology and Genetics, National Cancer Institute, NIH, Bethesda, MD, USA ©2016 Ferrata Storti Foundation. This is an open-access paper. doi:10.3324/haematol.2015.135475 Received: August 19, 2015. Accepted: January 7, 2016. Pre-published: June 13, 2016. Correspondence: [email protected] Supplemental Author Information: NCI DCEG Cancer Sequencing Working Group: Mark H. Greene, Allan Hildesheim, Nan Hu, Maria Theresa Landi, Jennifer Loud, Phuong Mai, Lisa Mirabello, Lindsay Morton, Dilys Parry, Anand Pathak, Douglas R. Stewart, Philip R. Taylor, Geoffrey S. Tobias, Xiaohong R. Yang, Guoqin Yu NCI DCEG Cancer Genomics Research Laboratory: Salma Chowdhury, Michael Cullen, Casey Dagnall, Herbert Higson, Amy A.
    [Show full text]
  • RT² Profiler PCR Array (96-Well Format and 384-Well [4 X 96] Format)
    RT² Profiler PCR Array (96-Well Format and 384-Well [4 x 96] Format) Mouse Unfolded Protein Response Cat. no. 330231 PAMM-089ZA For pathway expression analysis Format For use with the following real-time cyclers RT² Profiler PCR Array, Applied Biosystems® models 5700, 7000, 7300, 7500, Format A 7700, 7900HT, ViiA™ 7 (96-well block); Bio-Rad® models iCycler®, iQ™5, MyiQ™, MyiQ2; Bio-Rad/MJ Research Chromo4™; Eppendorf® Mastercycler® ep realplex models 2, 2s, 4, 4s; Stratagene® models Mx3005P®, Mx3000P®; Takara TP-800 RT² Profiler PCR Array, Applied Biosystems models 7500 (Fast block), 7900HT (Fast Format C block), StepOnePlus™, ViiA 7 (Fast block) RT² Profiler PCR Array, Bio-Rad CFX96™; Bio-Rad/MJ Research models DNA Format D Engine Opticon®, DNA Engine Opticon 2; Stratagene Mx4000® RT² Profiler PCR Array, Applied Biosystems models 7900HT (384-well block), ViiA 7 Format E (384-well block); Bio-Rad CFX384™ RT² Profiler PCR Array, Roche® LightCycler® 480 (96-well block) Format F RT² Profiler PCR Array, Roche LightCycler 480 (384-well block) Format G RT² Profiler PCR Array, Fluidigm® BioMark™ Format H Sample & Assay Technologies Description The Mouse Unfolded Protein Response RT² Profiler PCR Array profiles the expression of 84 key genes recognizing and responding to misfolded protein accumulation in the endoplasmic reticulum (ER). Chaperones bound to unfolded proteins in the ER initiate protein kinase cascades that immediately inhibit ER translation, reverse ER translocation, activate ER-specific ubiquitination enzymes, and even induce apoptosis under extreme stress. The signaling event also activates endonucleases to process specific mature cytosolic mRNA into variants that now translate into active transcription factors that increase the expression of heat shock proteins, protein disulfide isomerases, and even more chaperones.
    [Show full text]
  • Supplementary Material Contents
    Supplementary Material Contents Immune modulating proteins identified from exosomal samples.....................................................................2 Figure S1: Overlap between exosomal and soluble proteomes.................................................................................... 4 Bacterial strains:..............................................................................................................................................4 Figure S2: Variability between subjects of effects of exosomes on BL21-lux growth.................................................... 5 Figure S3: Early effects of exosomes on growth of BL21 E. coli .................................................................................... 5 Figure S4: Exosomal Lysis............................................................................................................................................ 6 Figure S5: Effect of pH on exosomal action.................................................................................................................. 7 Figure S6: Effect of exosomes on growth of UPEC (pH = 6.5) suspended in exosome-depleted urine supernatant ....... 8 Effective exosomal concentration....................................................................................................................8 Figure S7: Sample constitution for luminometry experiments..................................................................................... 8 Figure S8: Determining effective concentration .........................................................................................................
    [Show full text]
  • Alpa Sidhu , Justin R. Miller , Ashootosh Tripathi , Danielle M. Garshott , Amy L. Brownell , Daniel J. Chiego , Carl Arevang
    Alpa Sidhu€‡, Justin R. Miller€‡, Ashootosh Tripathi¶, Danielle M. Garshott€, Amy L. Brownell€, Daniel J. Chiego∑, Carl Arevang¶, Qinghua Zeng€, Leah C. Jackson€, Shelby A. Bechler€, Michael U. Calla- ghan€, George H. YooÖ, Seema Sethiñ, Ho-Sheng LinÖ, Joseph H. Callaghan§, Giselle Tamayo- CastilloØ, David H. Sherman¶, *, Randal J. KaufmanΩ, * and Andrew M. Fribley€,Ö, ≠,* € Carmen and Ann Adams Department of Pediatrics, Wayne State University School of Medicine, Detroit, MI 48201 ¶ Life Sciences Institute and Departments of Medicinal Chemistry, Chemistry, Microbiology & Immunology, University of Michigan, Ann Arbor, MI 48109 ∑ Cariology, Restorative Sciences and Endodontics, University of Michigan School of Dentistry, Ann Arbor, MI 48109 Ö Department of Otolaryngology, Wayne State University and Karmanos Cancer Institute, Detroit, MI 48201 ñ Department of Pathology, Wayne State University and Karmanos Cancer Institute, Detroit, MI 48201 § School of Business Administration, Oakland University, Rochester, MI 48309 ØInstituto Nacional de Biodiversidad, 3100-Heredia, CIPRONA-Escuela de Química, Universidad de Costa Rica Ω Degenerative Disease Research Program, Center for Cancer Research, Sanford|Burnham Medical Research Institute, La Jolla, CA 92037 ≠ Developmental Therapeutics Program, Barbara Ann Karmanos Cancer Institute, Detroit, MI 48201 ‡ These authors contributed equally Contents: Page: Experimental Procedures 2 - 3 Figure S1. SEM RT-qPCR, Leukemia proliferation, and Leukemia Casp3/7-glo 4 Table S1. UPR Gene Array. 5-7 Table S2. DNA Damage Gene Array. 8-10 Table S3. Apoptosis Gene Array. 11-13 Figure S2. Comparison of two borrelidin samples purchased from Sigma. 14 Figure S3. RT-qPCR analysis of OSCC cell lines reveals expression of cell UPR genes in 15 response to borrelidin.
    [Show full text]