DOCSLIB.ORG

RTL6 (NM 032287) Human Tagged ORF Clone – RC206668 | Origene

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
RTL6 (NM 032287) Human Tagged ORF Clone – RC206668 | Origene OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC206668 RTL6 (NM_032287) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: RTL6 (NM_032287) Human Tagged ORF Clone Tag: Myc-DDK Symbol: RTL6 Synonyms: dJ1033E15.2; LDOC1L; Mar6; Mart6; SIRH3 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC206668 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGTGCAGCCGCAGACGTCCAAAGCTGAAAGCCCAGCCTTGGCAGCGTCTCCGAATGCCCAGATGGATG ACGTTATTGACACCCTGACCTCCCTGCGCCTCACCAACTCGGCGCTGAGGCGGGAGGCTTCCACCCTGCG GGCGGAGAAGGCCAATCTCACCAACATGCTGGAGAGCGTGATGGCAGAGCTGACCTTGTTACGCACCAGG GCGCGGATCCCGGGGGCTCTGCAGATCACCCCGCCCATCTCCTCAATTACTTCAAACGGGACTCGACCCA TGACCACACCTCCAACCTCTCTGCCCGAGCCCTTTTCCGGGGACCCAGGCCGGTTGGCGGGGTTCCTGAT GCAGATGGACAGATTCATGATCTTCCAGGCCTCCCGCTTCCCGGGTGAGGCCGAGCGTGTGGCCTTCCTT GTGTCTCGACTGACTGGGGAGGCGGAGAAGTGGGCTATCCCCCACATGCAACCTGACAGCCCCTTGCGCA ACAACTATCAGGGGTTCCTGGCAGAGTTGCGGAGAACCTACAAGTCTCCGCTCCGGCATGCGCGGCGCGC CCAAATCAGGAAGACTTCTGCCTCTAATAGGGCTGTGCGAGAGAGGCAGATGCTCTGCCGCCAGCTGGCC TCTGCGGGCACGGGGCCTTGCCCAGTGCATCCAGCTTCCAACGGGACTAGTCCAGCGCCAGCCCTGCCTG CCCGAGCACGGAATCTT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 RTL6 (NM_032287) Human Tagged ORF Clone – RC206668 Protein Sequence: >RC206668 protein sequence Red=Cloning site Green=Tags(s) MVQPQTSKAESPALAASPNAQMDDVIDTLTSLRLTNSALRREASTLRAEKANLTNMLESVMAELTLLRTR ARIPGALQITPPISSITSNGTRPMTTPPTSLPEPFSGDPGRLAGFLMQMDRFMIFQASRFPGEAERVAFL VSRLTGEAEKWAIPHMQPDSPLRNNYQGFLAELRRTYKSPLRHARRAQIRKTSASNRAVRERQMLCRQLA SAGTGPCPVHPASNGTSPAPALPARARNL myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mk6359_b08.zip Restriction Sites: SgfI-MluI Cloning Scheme: Plasmid Map: ACCN: NM_032287 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 RTL6 (NM_032287) Human Tagged ORF Clone – RC206668 ORF Size: 717 bp OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_032287.3 RefSeq Size: 5355 bp RefSeq ORF: 720 bp Locus ID: 84247 UniProt ID: Q6ICC9, Q9BQJ3 MW: 26.2 kDa Product images: Western blot validation of overexpression lysate (Cat# [LY410230]) using anti-DDK antibody (Cat# [TA50011-100]). Left: Cell lysates from un- transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC206668 using transfection reagent MegaTran 2.0 (Cat# [TT210002]). Coomassie blue staining of purified RTL6 protein (Cat# [TP306668]). The protein was produced from HEK293T cells transfected with RTL6 cDNA clone (Cat# RC206668) using MegaTran 2.0 (Cat# [TT210002]). This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.
Load more

Recommended publications
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Supplementary Table S1. PCR Primer and Probe Set Information
    Supplementary Table S1. PCR primer and probe set information NCBI Entrez Gene TaqMan Gene Expression Gene Name Gene ID* Symbol Assay ID 59085 Asl argininosuccinate lyase Rn01480437_g1 25698 Ass1 argininosuccinate synthase 1 Rn00565808_g1 292804 Gpi glucose-6-phosphate isomerase Rn01475756_m1 25104 Pc pyruvate carboxylase Rn00562534_m1 361596 Idh2 isocitrate dehydrogenase 2 Rn01478119_m1 81718 Cdo1 cysteine dioxygenasetype 1 Rn00583853_m1 25256 Fmo1 flavin containing monooxygenase 1 Rn00562945_m1 246248 Fmo5 flavin containing monooxygenase 5 Rn00595199_m1 81822 Actb β-actin Rn00667869_m1 *Gene IDs reference The National Center for Biotechnology Information database 1 Supplementary Table S2. Metabolite assignments and H NMR data in urine samples of rat* Urine Metabolite δ1H (ppm) 1 N-Methylnicotinamide 4.48(s) 8.18(t) 8.90(d) 8.97(d) 2 Nicotinamide N-oxide 7.73(dd) 8.12(m) 8.48(m) 3 Formate 8.46(s) 4 Hippurate 3.97(d) 7.55(t) 7.64(m) 7.84(dd) 8.56(s) 5 Tryptophan 3.30(dd) 3.47(dd) 4.05(dd) 7.20(m) 7.28(m) 7.50(d) 7.71(d) 6 Phenylalanine 3.11(dd) 3.28(dd) 3.99(dd) 7.36(m) 7.42(m) 7 Tyrosine 3.04(dd) 3.19(dd) 3.93(dd) 6.89(m) 7.17(m) 8 Fumarate 6.53(s) 9 Allantoin 5.39(s) 6.05(s) 7.26(s) 8.01(s) 10 Urea 5.80(s) 11 Glucose 3.24(dd) 3.39(t) 3.40(t) 3.45(m) 3.48(t) 3.53(dd) 3.70(t) 3.72(dd) 3.76(dd) 3.82(m) 3.84(dd) 3.89(dd) 4.65(d) 5.24(d) 12 Tartrate 4.36(s) 13 Threonine 1.33(d) 3.58(d) 4.24(m) 14 Creatinine 3.05(s) 4.06(s) 15 Creatine 3.02(s) 3.95(s) 16 Glycine 3.57(s) 17 Taurine 3.27(t) 3.43(t) 18 Choline 3.20(s) 3.51(m) 4.06(m) 19 cis-Aconitate
    [Show full text]
  • Supplementary Table 1
    There are 657 predicted targets for hsa-miR-138-5p in miRDB.
    [Show full text]
  • Fig. S1. Related to Figure 1
    Fig. S1. Related to Figure 1 20 ● ● Heat map of sample distances PCA Analysis A 20B ● ● ● 20 ● ● ● Stage 10 Genotype 300 Stage ● Stage2D Stage 250 4D OPC 10 Genotype200 ● 2D Genotype 10 150 300 Stage A Stage4D 100 B 2D Stage ● 2D 50 250 4D0 ● OPCOPC2D 0 OPC DIV24D 200 0 DIV4OPC Genotype0 Genotype 150 Thap1A +/+ ● Thap1A +/+ PC2: 14% variance Genotype B -/- ● Thap1 Genotype●● A -/- 100 PC2: 14% variance Thap1B −10 ● ●● AB PC2: 14% variance −10 50 ● −10 ● ● B ● 0 ● mouse_Library_13_D7T34D mouse_Library_14_D3T34D mouse_Library_15_E8T34D mouse_Library_8_D3T32D mouse_Library_7_D7T32D mouse_Library_9_E8T32D mouse_Library_17_D6T34D mouse_Library_16_3FT34D mouse_Library_18_7FT34D mouse_Library_11_D6T32D mouse_Library_10_3FT32D mouse_Library_12_7FT32D mouse_Library_3_E8OPC mouse_Library_1_D7OPC mouse_Library_2_D3OPC mouse_Library_4_3FOPC mouse_Library_5_D6OPC mouse_Library_6_7FOPC ● −20 −20 ● −40 −20 0 20 −20 −40 −20 PC1: 49%0 variance20 PC1: 49% variance −40 −20 0 20 PC1: 49% variance C Overrepresentation of THAP1-dependent pathways - GO Analysis Terms DIV2 heparan sulfate proteoglycan metabolic process DNA damage response mouse_Library_13_D7T34D mouse_Library_14_D3T34D mouse_Library_15_E8T34D mouse_Library_8_D3T32D mouse_Library_7_D7T32D mouse_Library_9_E8T32D mouse_Library_17_D6T34D mouse_Library_16_3FT34D mouse_Library_18_7FT34D mouse_Library_11_D6T32D mouse_Library_10_3FT32D mouse_Library_12_7FT32D mouse_Library_3_E8OPC mouse_Library_1_D7OPC mouse_Library_2_D3OPC mouse_Library_4_3FOPC mouse_Library_5_D6OPC mouse_Library_6_7FOPC membrane biogenesis
    [Show full text]
  • Universidade De São Paulo Faculdade De Zootecnia E Engenharia De Alimentos Ana Clara Faquineli Cavalcante Mendes De Ávila
    UNIVERSIDADE DE SÃO PAULO FACULDADE DE ZOOTECNIA E ENGENHARIA DE ALIMENTOS ANA CLARA FAQUINELI CAVALCANTE MENDES DE ÁVILA Efeitos da comunicação entre células do sistema reprodutivo feminino e oócitos bovinos mediada por vesículas extracelulares de diferentes estágios do ciclo estral Pirassununga 2019 ANA CLARA FAQUINELI CAVALCANTE MENDES DE ÁVILA Efeitos da comunicação entre células do sistema reprodutivo feminino e oócitos bovinos mediada por vesículas extracelulares de diferentes estágios do ciclo estral Versão Corrigida Dissertação apresentada à Faculdade de Zootecnia e Engenharia de Alimentos da Universidade de São Paulo, como parte dos requisitos para a obtenção do título de Mestre em Ciências do programa de pós-graduação em Biociência Animal. Área de Concentração: Biociência Animal Orientador: Prof. Dr. Juliano Coelho da Silveira Pirassununga 2019 Ficha cataLográfica eLaborada peLo Serviço de BibLioteca e Informação, FZEA/USP, com os dados fornecidos pelo(a) autor(a) de Ávila, Ana Clara Faquineli Cavalcante Mendes d278e Efeitos da comunicação entre células do sistema reprodutivo feminino e oócitos bovinos mediada por vesículas extracelulares de diferentes estágios do ciclo estral / Ana Clara Faquineli Cavalcante Mendes de Ávila ; orientador Juliano Coelho da Silveira. -- Pirassununga, 2019. 194 f. Dissertação (Mestrado - Programa de Pós-Graduação em Biociência Animal) -- Faculdade de Zootecnia e Engenharia de Alimentos, Universidade de São Paulo. 1. Reprodução animal. 2. Bovinos. 3. Folículo ovariano. 4. Vesículas extracelulares.
    [Show full text]
  • RTL6 (NM 032287) Human Over-Expression Lysate – LC410230 | Origene
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for LC410230 RTL6 (NM_032287) Human Over-expression Lysate Product data: Product Type: Over-expression Lysates Description: LDOC1L HEK293T cell transient overexpression lysate (as WB positive control) Species: Human Expression Host: HEK293T Expression cDNA Clone TrueORF Clone RC206668 or AA Sequence: Tag: C-Myc/DDK Detection Antibodies: Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody (TA50011-100) Accession Number: NM_032287, NP_115663 Synonyms: dJ1033E15.2; LDOC1L; Mar6; Mart6; SIRH3 Predicted MW: 26.2 kDa Components: 1 vial of 20 ug lyophilized gene specific transient over-expression cell lysate Storage: The lysate can be shipped at ambient temperature. Upon receiving, store the sample at - 20°C. Lysate samples can be reconstituted with SDS Sample Buffer. Avoid repeated freeze- thaw cycles after reconstitution. Lysate samples are stable for 12 months from date of receipt when stored at -20°C. Preparation: HEK293T cells in 10-cm dishes were transiently transfected withM egaTran Transfection Reagent (TT200002) and 5ug TrueORF cDNA plasmid. Transfected cells were cultured for 48hrs before collection. The cells were lysed in modified RIPA buffer (25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix (Sigma), 1mM PMSF and 1mM Na3VO4), and then centrifuged to clarify the lysate. Protein concentration was measured by BCA kit (Thermo Scientific Inc.). To facilitate transportation and protein, the products are supplied as lyophilized proteins. RefSeq: NP_115663 Locus ID: 84247 Cytogenetics: 22q13.31 This product is to be used for laboratory only.
    [Show full text]
  • Christmas Yol
    MONDAY. DECEMBER tt. 1M7 iianrt;p0t«r l^mUk Avwhg* DfiOy OrtEhtlMi T lw Ruiunu k - lig h t anew endtag hy saity eve- afaig fallowed by partial elearlag tonights Wedaeoday fair and eou- tlanod ooM. M anehester^A City of Village Charm (FOURTEEN PAGES) PRICE POUR CENTS CHRISTMAS YOL. LXVIL, NO. 71 sa Pag* U> MANCHESTER, CONN., TUESDAY, DECEMBER 23,1947 Is Drawing Near! British Tommies Church Bums at Rochester Hines Views Panama And Arabs Fight reement Possible; Near Jerusalem Buim* M e jew.| Promise Lists New Canal Is Urged ish Fnnenil ProeeMion Uiiitril Stales Ambassa­ On Sacred Mount of WiU Be Given The Aacention; Con* Panama Solans Vote dor ('erlaiii Agrccmcnl voy BlasU Hillside* O ose Study Will Be Reaehed oil Above Bab el Wad Against Agreement Military Base* to Two Congressional Com­ Protect Canal; Engel Jerusalem, Dec. 23.—(/P)— Siiggpsls Waterway British Tommies fought to­ mittees W ill Scratiniae National ^ | Aid MoV Toi) day against Arabs who at­ Com m odity Traders Unanimously Refuses. J l Be Buill Elsew here tacked highway traffic north For Any Irregularities If Stand Coiitiiinetl of Jerusalem, and Arab bul­ To Ratify lyeasing Eight Billions lets raked a Jewish funeral Bases lo United States Wnshington, Dec. 23.— (/P) Ballctin! processsion on the sacred Hrig. Gen. Frank T. Hines, tVashlagtou, Dec. **—(A)— III One Year Mount of the Ascension. A HaroM E. BUsaea today chal- Panama, Panama, Dec. 23. anibus.sador to Panama, said green-turbaned Arab in a leaged the admlaistratlo* ta — (/P) — Panama’s National after a conferenee with Pres­ green ■Ilpover xwenter led the any whether any present nnd Assembly unanimously re­ ident Truman today that he higkwny attMdcera la a wild ex­ Tuft Suy* AdtlUiuiiul fornwr officials In the "Execu­ fused last night to ratify a believes an agreement will be change of fire with a British con­ tive department of the White Oil (111 V* Muv Total $1,* voy, Army aourcea aald.
    [Show full text]
  • Strategic Human Cdna Genome Application
    wno^/ta* 3 Una t h cDNA^y / a e w-m 12^3 ^ NEDOBIS T98099 NE co mm ■ mm B & $ # im 1 (ICAWc..................................................................................................................................... l 2 ...................................................................................................................................... 5 3 jo ................................................................................................................ 6 1 s i. i %±&cmkmmfejkum^(nm.m(Dmm^m............... 7 i. 2 ^&cDKAmmfeRTfmfc7-(Dmyo(Dmife^m............... 8 1. 3 ^^ScDNAE^lJ^:^............................................................... 10 12 1 . 5 #$fl§#?#ffflcDNA:r — *7 ~-'<'—7s ................................................................. 14 mm................................................................................................................................. 16 1. 7 AAcDNA?)#&E?lJ#:^(D#%..................................................................... 18 1. 8 Ifelftiftfc hcDNA^V J±Mtif................................................................................. 19 1. 9 A#cDNA(C#&K?iJ#:^ cDNA###:$ij(7)##, Rtf DNA-r-f ^ nTH'f^Sglff .................................................................................. 22 1 . 10 DN A-^/f ?uTU4 ................................ 23 i. ii &mcrnA(Dm,mmvfcfeRtfmmmft\m-tz>%\®.&ffimm....................... 25 i. 12 m#cDNA<z)m###(cM'ra##M9B................................................................. 27 i. 13 .................................................................................................................
    [Show full text]
  • Table SII. Lncrna-Mrna Co-Expression Analysis for RFS in HCC with Fibrosis
    Table SII. LncRNA-mRNA co-expression analysis for RFS in HCC with fibrosis. Pearson correlation lncRNA mRNA coefficient P-value PLCE1-AS1 ERBB3 -0.458 4.05E-12 PLCE1-AS1 NGEF -0.446 1.73E-11 PLCE1-AS1 FOXA2 -0.434 6.45E-11 PLCE1-AS1 GJB1 -0.43 1.02E-10 PLCE1-AS1 HNF4A -0.427 1.47E-10 PLCE1-AS1 HPN -0.42 2.91E-10 PLCE1-AS1 AFMID -0.409 9.85E-10 PLCE1-AS1 SALL1 -0.393 4.74E-09 PLCE1-AS1 C4BPB -0.387 8.48E-09 PLCE1-AS1 A1CF -0.385 1.03E-08 PLCE1-AS1 SLC9A3R1 -0.382 1.37E-08 PLCE1-AS1 HIRA -0.378 1.95E-08 PLCE1-AS1 APOC4-APOC2 -0.374 2.73E-08 PLCE1-AS1 GOLT1A -0.371 3.59E-08 PLCE1-AS1 CPB2 -0.368 5E-08 PLCE1-AS1 MEIG1 -0.36 1.04E-07 PLCE1-AS1 PDZK1 -0.36 1.03E-07 PLCE1-AS1 SERPINA1 -0.358 1.21E-07 PLCE1-AS1 APOB -0.352 2.06E-07 PLCE1-AS1 ESRP2 -0.352 1.97E-07 PLCE1-AS1 PRDX3 -0.351 2.09E-07 PLCE1-AS1 DNAJC22 -0.35 2.3E-07 PLCE1-AS1 RNF128 -0.348 2.73E-07 PLCE1-AS1 CXADR -0.348 2.82E-07 PLCE1-AS1 THPO -0.347 3.11E-07 PLCE1-AS1 IQGAP2 -0.345 3.53E-07 PLCE1-AS1 RNF43 -0.344 3.88E-07 PLCE1-AS1 ALCAM -0.342 4.59E-07 PLCE1-AS1 NIF3L1 -0.337 6.92E-07 PLCE1-AS1 CAMSAP3 -0.334 8.58E-07 PLCE1-AS1 GC -0.332 1.05E-06 PLCE1-AS1 IMPA2 -0.331 1.14E-06 PLCE1-AS1 ST13 -0.326 1.64E-06 PLCE1-AS1 SDC1 -0.323 2.06E-06 PLCE1-AS1 SRP54 -0.321 2.45E-06 PLCE1-AS1 PROX1 -0.321 2.37E-06 PLCE1-AS1 FMO5 -0.318 2.96E-06 PLCE1-AS1 ASGR2 -0.318 2.96E-06 PLCE1-AS1 ASGR1 -0.318 2.92E-06 PLCE1-AS1 SRRD -0.318 3.05E-06 PLCE1-AS1 CYP4F11 -0.316 3.42E-06 PLCE1-AS1 HHEX -0.315 3.76E-06 PLCE1-AS1 MMADHC -0.314 4.04E-06 PLCE1-AS1 ADH6 -0.314 4.1E-06 PLCE1-AS1 DEPDC7 -0.314 4.21E-06
    [Show full text]
  • The Translational Controlled Tumour Protein TCTP: Biological Functions and Regulation Ulrich A
    University of Wollongong Research Online Faculty of Science, Medicine and Health - Papers Faculty of Science, Medicine and Health 2017 The translational controlled tumour protein TCTP: Biological functions and regulation Ulrich A. Bommer University of Wollongong, [email protected] Publication Details Bommer, U. (2017). The translational controlled tumour protein TCTP: Biological functions and regulation. Results and Problems in Cell Differentiation, 64 69-126. Research Online is the open access institutional repository for the University of Wollongong. For further information contact the UOW Library: [email protected] The translational controlled tumour protein TCTP: Biological functions and regulation Abstract The rT anslational Controlled Tumour Protein TCTP (gene symbol TPT1, also called P21, P23, Q23, fortilin or histamine-releasing factor, HRF) is a highly conserved protein present in essentially all eukaryotic organisms and involved in many fundamental cell biological and disease processes. It was first discovered about 35 years ago, and it took an extended period of time for its multiple functions to be revealed, and even today we do not yet fully understand all the details. Having witnessed most of this history, in this chapter, I give a brief overview and review the current knowledge on the structure, biological functions, disease involvements and cellular regulation of this protein. TCTP is able to interact with a large number of other proteins and is therefore involved in many core cell biological processes, predominantly in the response to cellular stresses, such as oxidative stress, heat shock, genotoxic stress, imbalance of ion metabolism as well as other conditions. Mechanistically, TCTP acts as an anti-apoptotic protein, and it is involved in DNA-damage repair and in cellular autophagy.
    [Show full text]
  • Target (4427) 1783 Genes on 609 Pathways 15
    Supplementary Figure S1. The SARS-CoV-2 Knowledge Graph SARS-CoV-2 Host genes (322) baits (27) 1,783 genes on 609 pathways 15 Target (4,427) 10 723 84 Phenotypes (1,285) Drugs (3,635) Supplementary Figure S2. Interactive t-sne plot inorganic cation transmembrane DIOSMIN EXTL1 SIGMAR1 HEATR3 LIPT2 CD6 SIGLEC1 CD2 TBCA STOML2 NAA80 CDH15 CDH3 MAG NEGR1 CADM3 CADM1 CD99 CDH5 ESAM positive regulation of neutrophil transport "TRANS-10 activation L 750667 CACOSPONGIONOLIDE B MIMOSINE VOLATILE ORGANICBRUCINE COMPOUNDS "1-PHENYL-6 ATP6AP1 ATRACTYLENOLIDE I HOMOCASTASTERONE ISOPENTYL ALCOHOL MEMANTINE AH 13205 DELPHINIDINPOLYETHYLENE GLYCOLMANSONONE 6000 G SARS-CoV2 orf7a SOFOSBUVIR LIAS EXT2 4-(4-(4-CHLORO-PHENYL)THIAZOL-2-YLAMINO)PHENOL TRIMETHYLARSINE OXIDE EXT1 SARS-CoV2 nsp6 8-CHLORO-2'-DEOXYGUANOSINEALGINIC ACID DIAMIDE ROPIVACAINE ALCAM SPN CD58 SARS-CoV2 nsp11SARS-CoV2 orf3b YOD1 MANGOSTIN HERBICIDESFLUNISOLIDEGW 6471 PHOSPHORYLCHOLINE DIACETYLDICHLOROFLUORESCEIN BENTONITE TRIENOMYCIN A positive regulation of leukocyte OLEOYL-ESTRONESIPONIMOD PRISTANE positive regulation of productionANETHOLE TRITHIONE bone remodeling VANOXERINEadhesion to arterial endothelial BN 50739 DONG QUAI ATP13A3 KAMEBAKAURIN of miRNAsinterleukin-1 involved receptor in gene antagonist endocrine pancreas developmentPYRIDOXAMINE ISOMENTHONEtoll-like receptor 3 signalingMECLOFENAMIC cell ACID "6-(4-FLUOROPHENYL)-2 "(2Svesicle MRS 2211silencing by miRNAactivity regulation of calcium-mediated 4-ETHYLNAPHTHALEN-1-YL-(1-PENTYLINDOL-3-YL)METHANONEpathway CYCLAMATES positive
    [Show full text]
  • An Integrated Systems Biology Approach to Investigate
    Master's thesis Marie Gulla An integrated systems biology approach to investigate 2019 transcriptomic data of thyroid Master's thesis carcinoma Marie Gulla NTNU May 2019 Norwegian University of Science and Technology Faculty of Natural Sciences Department of Biotechnology and Food Science An integrated systems biology approach to investigate transcriptomic data of thyroid carcinoma Marie Gulla Biotechnology MBIOT5 Submission date: May 2019 Supervisor: Eivind Almaas Co-supervisor: André Voigt Norwegian University of Science and Technology Department of Biotechnology and Food Science An integrated systems biology approach to investigate transcriptomics data of thyroid carcinoma Marie Gulla May 15, 2019 “ I can appreciate the beauty of a flower. At the same time, I see much more about the flower (..). I could imagine the cells in there, the complicated actions inside, which also have a beauty. I mean it’s not just beauty at this dimension, at one centimeter; there’s also beauty at smaller dimensions, the inner structure, also the processes. (...) The science knowledge only adds to the excitement, the mystery and the awe of a flower. It only adds. ” Richard Feynman Abstract Driven by the development of innovative approaches to quantify gene expression levels across large numbers of samples, differential transcriptome analysis is emerging as a powerful strategy to interrogate the complex interplay of genes accountable for malignancies. The CSD method is a correlation-based method to systematically classify differential genetic associations, facilitating identification of dissimilar interactions driving pathogenesis. In this work, we have used the CSD framework for analyzing gene correlation for thyroid carcinoma (THCA) patients. THCA is the most common endocrine cancer type.
    [Show full text]