DOCSLIB.ORG

Annual Report for 2004.Indd

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Annual Report for 2004.Indd PUBLISHED BY: Central Bank of Montenegro Bulevar Svetog Petra Cetinjskog 6 81000 Podgorica Telephone: +381 81 664 997, 664 269 Fax: +381 81 664 576 WEBSITE: http:/www.cb-cg.org CENTRAL BANK COUNCIL: Ljubiša Krgović, MS, president Milojica Dakić, MS Krunislav Vukčević Goran Knežević, MS Petar Drakić Radmila Savićević TRANSLATED BY: Lidija Ćirović Popadić DESIGNED BY: Andrijana Vujović PRINTED BY: Grafo Crna Gora The Report is published annually. Users of this publication are requested to make reference to the source of information whenever they use data from the Report. LIST OF ABBREVIATIONS BIS Bank for International Settlements BPK/BAK Banking and Payment Authority of Kosovo BS Bank of Slovenia BSCEE Group of Banking Supervisors from Central and Eastern Europe CBBiH Central Bank of Bosnia and Herzegovina CBM Central Bank of Montenegro CDA Central Depository Agency CEBIT Annual trade show of information and telecommunication technology EBRD European Bank for Reconstruction and Development ECB European Central Bank EIB European Investment Bank EMU European Monetary Union EU European Union EUR Euro EURIBOR Euro Interbank Offered Rate FDI Foreign Direct Investments FED Federal Reserve System HNB Croatian National Bank IBRD International Bank for Reconstruction and Development IDA International Development Association IDF Institutional Development Fund IFC International Finance Corporation IMF International Monetary Fund IMF International Monetary Fund IS-CB Information System of the Central Bank of Montenegro KFW Kreditanstait fur Wiederaufbau LIBOR London Interbank Offered Rate MFI Micro-credit Financial Institution MIGA Multilateral Investment Agency MONSTAT Statistical Office of Montenegro n/a not available NBM National Bank of Macedonia NBS National Bank of Serbia RIA Regulatory Impact Assessment RIR Register of account owners RM Republic of Montenegro SCG Serbia and Montenegro SDR Special Drawing Rights SITC Standard International Trade Classification UCD Unique Customs Declaration USD US Dollar VAT Value added tax WTO World Trade Organisation FOREWORD BY THE PRESIDENT OF THE CBM COUNCIL ...................................................... vi ACTIVITIES OF THE CBM COUNCIL IN 2004 .............................................................................. ix 1. MACROECONOMIC ENVIRONMENT IN MONTENEGRO IN 2004 ......................................11 1.1. Review of Macroeconomic Developments ..............................................................................13 1.2. Prices ..........................................................................................................................................15 1.3. Monetary Developments ..........................................................................................................20 1.4. Financial Markets .....................................................................................................................26 1.5. Fiscal Policy ...............................................................................................................................29 1.6. Public Debt ................................................................................................................................32 1.7. External Developments .............................................................................................................36 2. THE BANKING SYSTEM ..............................................................................................................47 2.1. Structure of the Banking System in Montenegro .................................................................49 2.2. Banks’ Performance in 2004 ..................................................................................................51 3. BANKING SECTOR SUPERVISION AND REGULATION .........................................................67 3.1. Regulatory and Supervisory Developments ..........................................................................69 3.2. Assessment of Compliance with Basel Core Principles .......................................................71 3.3. Risk Exposure of Banking System .........................................................................................74 CONTENTS 4. PAYMENT SYSTEM .......................................................................................................................85 4.1. Payment System Reform .........................................................................................................87 5. BANKING AND FINANCIAL OPERATIONS ..............................................................................91 5.1. Foreign Exchange Reserve Management ....................................................................................93 5.2. International Payment Operations ..............................................................................................96 5.3. Fiscal Agent and Advisor .............................................................................................................97 6. MACROECONOMIC ANALYSES AND RESEARCH ..................................................................103 6.1. Improvements in Statistics ..........................................................................................................105 6.2. Reporting on Macroeconomic Developments ...........................................................................106 6.3. Projects .........................................................................................................................................106 6.4. Preparation of Laws and Enabling Regulations ........................................................................107 7. OTHER IMPORTANT ACTIVITIES OF THE CENTRAL BANK IN 2004 ..............................109 7.1. International Cooperation ..........................................................................................................111 7.2. Vault ..............................................................................................................................................114 7.3. Internal Audit ...............................................................................................................................114 7.4. Information Technology Support ................................................................................................115 7.5. Human Resources Management .................................................................................................116 7.6. Public Relations ............................................................................................................................117 ANNEXES ...........................................................................................................................................119 CENTRAL BANK OF MONTENEGRO ANNUAL REPORT 2004 FOREWORD BY THE PRESIDENT OF THE COUNCIL OF THE CENTRAL BANK OF MONTENEGRO The year 2004 can be categorized as a successful year in which macroeconomic stability was maintained, economic growth was accelerated, and the reform processes of the Montenegrin economy continued. The inflation downtrend continued, relatively high economic growth was achieved, the unemployment rate fell, the highest industrial growth in the region was achieved, the number of tourists significantly increased, and almost all monetary and financialaggregatesimproved.Thesuccessoftheimplementedreformsinthebanking system is definitely confirmed by the regained credibility of the system, something which had been lost during the 1990’s. A favourable credit rating assigned to Montenegro by the international rating agency Standard & Poor’s is also confirmation that the reforms are moving in the right direction, proving that Montenegro does not belong to the category of highly indebted countries. This rating improves Montenegro’s position in the international capital market, and shall bring about a higher inflow of foreign direct investments. The reform process in the banking sector continued in the reporting year. With regard to the payment system, new regulations governing the domestic payment system were enacted, IT hardware and software requirements were met thus creating both normative and technical grounds for the successful transfer of payment operations to banks at the beginning of 2005. The bank supervision overall level of compliance with the Basel Core Principles was improved. Theregulationsgoverningthemanagingofoperativeriskandmarket risk in banks and country risk rounded off the legal requirements with regard to the risk management in banks. Operative activities on the closing of the Government’s deposit accounts with commercial banks and the transfer of those funds to the all-in-one account with the Central Bank were performed in cooperation with the Ministry of Finance. Theresultoftheseisasoundandliquidbanking-financialsystemwhichcanbeconfirmedby theimprovement in almost all monetary indicators - loans granted, savings by private citizens, banks’ total assets, and deposits in which term deposits made up more than half. In addition, banks opened eighteen new branch offices. The Central Bank established correspondent relations with eight foreign commercial banks where it held its foreign exchange funds and through which international payment operations were performed. According to reputable agencies, credit ratings of the aforementioned banks fall into the highest credit rating category. vi FOREWORD BY THE PRESIDENT OF THE CBM COUNCIL As the fiscalagentoftheGovernmenttheCentralBankofMontenegroorganisedthirty-eightT-Billsauctions,
Load more

Recommended publications
  • Montenegro Economic Trends
    MONET MONTENEGRO ECONOMIC TRENDS April 2003 ABOUT ISSP ABOUT CEPS The Institute for Strategic Studies and Prognoses CEPS was established in 1983. It performs (ISSP), established by Professor Vukotic in independent analyses and critiques on European 1999, is the first independent economic institute economic policy and politics, as well as on in Montenegro. USAID assisted in this process European institutions and security. It and continues to support the work of the disseminates its findings through a regular flow Institute. ISSP has a wide network of associates of publications, public events and electronic both in Montenegro (about 150) and abroad. commentaries. ISSP is a member of the Balkan Network, the CEPS is an independent membership-driven Global Development Network established by the organization with more than 100 corporate World Bank and the European Integration members and a large number of central banks, Network. ISSP cooperates with ICER (Torino), diplomatic missions and international business WIIW (Vienna), CEPS (Brussels) and organizations in its constituency. Chesapeake Associates (Washington). ABOUT MONET The Institute’s mission is "to provide research that will contribute to Montenegro’s economic MONET (www.monetonline.org) is the result of transformation and to change the current the joint work of ISSP in Podgorica and CEPS in mindset, as well as to train today’s young people Belgium. It is financed by the grant from the how to function successfully in the new European Agency for Reconstruction. environment." MONET team
    [Show full text]
  • Montenegro 2020
    MONTENEGRO 2020 1 SENSITIVE BUT UNCLASSIFIED Table of Contents Doing Business in Montenegro ___________________________________________________4 Market Overview ________________________________________________________________4 Market Challenges ______________________________________________________________4 Market Overview ________________________________________________________________5 Market Entry Strategy ___________________________________________________________6 Leading Sectors for U.S. Exports and Investment __________________________ 7 Energy ________________________________________________________________________7 Tourism _______________________________________________________________________9 Medical Equipment _____________________________________________________________10 Construction __________________________________________________________________11 Customs, Regulations and Standards ___________________________________ 12 Trade Barriers _________________________________________________________________12 Import Tariffs __________________________________________________________________12 Import Requirements and Documentation _________________________________________13 Labeling and Marking Requirements ______________________________________________13 U.S. Export Controls ___________________________________________________________13 Temporary Entry _______________________________________________________________14 Prohibited and Restricted Imports ________________________________________________14 Customs Regulations___________________________________________________________14
    [Show full text]
  • Council and Commission Decision of 29 March 2010 on the Conclusion Of
    29.4.2010 EN Official Journal of the European Union L 108/1 II (Non-legislative acts) INTERNATIONAL AGREEMENTS COUNCIL AND COMMISSION DECISION of 29 March 2010 on the conclusion of the Stabilisation and Association Agreement between the European Communities and their Member States, of the one part, and the Republic of Montenegro, of the other part (2010/224/EU, Euratom) THE COUNCIL OF THE EUROPEAN UNION AND THE EUROPEAN (3) As a consequence of the entry into force of the Treaty of COMMISSION, Lisbon on 1 December 2009, the European Union has replaced and succeeded the European Community. Having regard to the Treaty on the Functioning of the European Union, and in particular Article 217 in conjunction with (4) The Agreement should be approved, Article 218(6)(a) and (8) thereof, Having regard to the Treaty establishing the European Atomic HAVE ADOPTED THIS DECISION: Energy Community, and in particular the second paragraph of Article 101 thereof, Article 1 Having regard to the proposal from the European Commission, The Stabilisation and Association Agreement between the Euro­ Having regard to the consent of the European Parliament, pean Communities and their Member States, of the one part, and the Republic of Montenegro, of the other part, the Annexes and Protocols annexed thereto, as well as the joint declarations and Having regard to the approval of the Council granted pursuant to the declaration by the Community attached to the Final Act, are Article 101 of the Treaty establishing the European Atomic hereby approved on behalf of the European Union and the Euro­ Energy Community, pean Atomic Energy Community.
    [Show full text]
  • Nato Expansion: Examining the Accession of Montenegro
    S. HRG. 114–712 NATO EXPANSION: EXAMINING THE ACCESSION OF MONTENEGRO HEARING BEFORE THE COMMITTEE ON FOREIGN RELATIONS UNITED STATES SENATE ONE HUNDRED FOURTEENTH CONGRESS SECOND SESSION SEPTEMBER 14, 2016 Printed for the use of the Committee on Foreign Relations ( Available via the World Wide Web: http://www.fdsys.gpo.gov U.S. GOVERNMENT PUBLISHING OFFICE 27–080 PDF WASHINGTON : 2017 For sale by the Superintendent of Documents, U.S. Government Publishing Office Internet: bookstore.gpo.gov Phone: toll free (866) 512–1800; DC area (202) 512–1800 Fax: (202) 512–2104 Mail: Stop IDCC, Washington, DC 20402–0001 VerDate Mar 15 2010 12:46 Nov 17, 2017 Jkt 000000 PO 00000 Frm 00001 Fmt 5011 Sfmt 5011 S:\FULL COMMITTEE\HEARING FILES\2016 HEARINGS -- WORKING\091416-QQ\27-080.T FOREI-42327 with DISTILLER COMMITTEE ON FOREIGN RELATIONS BOB CORKER, TENNESSEE, Chairman JAMES E. RISCH, Idaho BENJAMIN L. CARDIN, Maryland MARCO RUBIO, Florida BARBARA BOXER, California RON JOHNSON, Wisconsin ROBERT MENENDEZ, New Jersey JEFF FLAKE, Arizona JEANNE SHAHEEN, New Hampshire CORY GARDNER, Colorado CHRISTOPHER A. COONS, Delaware DAVID PERDUE, Georgia TOM UDALL, New Mexico JOHNNY ISAKSON, Georgia CHRISTOPHER MURPHY, Connecticut RAND PAUL, Kentucky TIM KAINE, Virginia JOHN BARRASSO, Wyoming EDWARD J. MARKEY, Massachusetts TODD WOMACK, Staff Director JESSICA LEWIS, Democratic Staff Director ROB STRAYER, Majority Chief Counsel MARGARET TAYLOR, Minority Chief Counsel JOHN DUTTON, Chief Clerk (II) VerDate Mar 15 2010 12:46 Nov 17, 2017 Jkt 000000 PO 00000 Frm 00002 Fmt 5904 Sfmt 5904 S:\FULL COMMITTEE\HEARING FILES\2016 HEARINGS -- WORKING\091416-QQ\27-080.T FOREI-42327 with DISTILLER CONTENTS Page Johnson, Hon.
    [Show full text]
  • February 2004
    MONET MONTENEGRO ECONOMIC TRENDS February 2004 ABOUT ISSP ABOUT CEPS The Institute for Strategic Studies and Prognoses CEPS was established in 1983. It performs (ISSP), established by Professor Vukotic in independent analyses and critiques on European 1999, is the first independent economic institute economic policy and politics, as well as on in Montenegro. USAID assisted in this process European institutions and security. It and continues to support the work of the disseminates its findings through a regular flow Institute. ISSP has a wide network of associates of publications, public events and electronic both in Montenegro (about 150) and abroad. commentaries. ISSP is a member of the Balkan Network, the Global Development Network established by the CEPS is an independent membership-driven World Bank and the European Integration organization with more than 100 corporate Network. ISSP cooperates with ICER (Torino), members and a large number of central banks, WIIW (Vienna), CEPS (Brussels) and diplomatic missions and international business Chesapeake Associates (Washington). organizations in its constituency. The Institute’s mission is "to provide research ABOUT MONET that will contribute to Montenegro’s economic transformation and to change the current MONET (www.isspm.org) is the result of the mindset, as well as to train today’s young people joint work of ISSP in Podgorica and CEPS in how to function successfully in the new Belgium. It is financed by the grant from the environment." European Agency for Reconstruction. Major projects: MONET team o Macroeconomic reform in Montenegro a) Privatization -ISSP- b) Monetary Reform c) Capital Markets Development ISSP team leaders: d) Fiscal Reform Professor Veselin Vukotic Petar Ivanovic e) Reform of the Pension System f) Introduction of the SNA system Researchers: o Macroeconomic indicators in Jadranka Kaludjerovic, Montenegro Maja Bacovic, o Economic education Milorad Katnic, Nina Labovic, President: Ana Krsmanovic, Professor Veselin Vukotic, Ph.D.
    [Show full text]
  • Lecture #3 European Monetary Integrason: the Second Stage (1992
    Lecture #3 European monetary integraon: the second stage (1992‐2002) 欧州通貨統合の第二段階 基礎比較経済論 14 May 2012 From the previous class • The Breon‐Woods system: the internaonal monetary system that existed between 1944 and 1971 • Based on the USD, which was the only currency freely converble into gold • Collapsed in 1971 because the US gave higher priority to its own naonal interests (e.g. fiscal deficits and prinng of too many USD in the 1960s) アメリカ国益優先、財政拡大、ドル紙幣の増刷 • Since 1969, the EU countries started preparaons for a monetary union • I. The “snake” (1972‐1978) From the previous class • II. The European monetary system (EMS) 1979‐1998 欧州通貨制度 • (1) created the ECU, a basket currency • (2) fixed EU member currencies to each other via the ECU (official exchange rates) 公式為替レート • (3) tried to reduce the fluctuaons of market exchange rates within a band of ±2.25% 市場為替レート • (4) tried joint intervenons by central banks when market rates moved toward the “ceiling” or the “floor” of the band • The EMS was supposed to be “symmetric” but actually became dominated by the German mark (DM) The German mark’s (DM) dominance 欧州通貨制度＝ドイツマルク圏 The main problem of the EMS ドイツの国益優先 • To keep their currencies aligned with the German mark, the other EMS member countries had to follow German monetary policy • If the German central bank (the Bundesbank) increased interest rates, all other EMS members had to do the same thing • But what happens if some did not raise interest rates due to fears of economic recession? these countries might have to leave the EMS • And what happens
    [Show full text]
  • The Measures of Phase I of the Accession of Serbia and Montenegro to the European Union Within the Stabilization and Association Process
    Ulica kralja Milana 16, 11000 Belgrade, Serbia and Montenegro Phone: (+381 11) 3613–118, 3612–407, 2688–255 Fax: (+381 11) 3613–467 E–mail: [email protected] Internet site: http://www.ecinst.org.yu The Measures of Phase I of the Accession Of Serbia and Montenegro to the European Union within the Stabilization and Association Process Thematic Area: EU Accession Including Euro Adoption Authors Prof. Jurij Bajec, Prof. Nebojsa Savic, PhD Nikola Fabris, MSc Jelena Galic, Dragana Petrakovic, Milan Kovac This research was supported by a grant from the CERGE-EI Foundation under a program of the Global Development Network. Additional funds for grantees in the Balkan countries have been provided by the Austrian Government through WIIW, Vienna. All opinions expressed are those of the authors(s) and have not been endorsed by CERGE-EI, WIIW, or the GDN. BELGRADE, August 2004 (revised on January and May 2005) THE MEASURES OF PHASE I OF THE ACCESSION OF SERBIA AND MONTENEGRO TO THE EUROPEAN UNION WITHIN THE STABILIZATION AND ASSOCIATION PROCESS Thematic Area: EU Accession Including Euro Adoption C O N T E N T S INTRODUCTION........................................................................................................................................3 I STRATEGIC SIGNIFICANCE OF SM'S ACCESSION TO THE EUROPEAN UNION...........................6 1. SWOT Analysis of Accession to the EU .............................................................................................6 2. The Strategic Objectives of the Forthcoming Economic Development ............................................14 2.1. The Acceleration of Reforms and Transition Processes ............................................................14 2.2. Development through European Integration and Development Processes ...............................17 II THE FIRST PHASE OF ACCESSION TO THE EU .............................................................................23 1. The Process of Harmonization and Measures within the First Phase of Accession to the EU ........23 1.1.
    [Show full text]
  • ANNUAL REPORT Eng.Indd
    1 ANNUAL REPORT 2010 Report of the Chairman of the Board of Directors and Chief Executive Offi cer Report Report of the Chairman of the Board of Directors ear clients, partners and shareholders, DOn behalf of the Board of Directors, I have the honour to present the Annual Report of Hipotekarna banka AD Podgorica for the year 2010. After a period of extreme international fi nancial instability and global economic weakness, conditions improved materially in 2010. The international fi nancial system stabilized and began the journey back to health. The global economy stopped contracting and began to grow, at a pace that surprised many observers. In the euro zone, fi scal tightening and economic rebalancing dampened growth in some countries. New regulatory requirements have become more concrete in the wake of the crisis. The “Basel III” rules, recently approved by the G20, are just the beginning. The Board of Directors worked closely with the management team on a range 2 of issues. The successful execution of our strategy requires us to focus on core market segments, customer engagement, cost leadership, capital effi ciency and a prudent risk and funding profi le. Carried out well, these attributes should enable the Bank to deliver earnings growth and shareholder value while achieving the aim of becoming recognized as one of the best fi nancial services company in the country. We have a great platform for the future and have established a strong fi nancial and operational trajectory and we are confi dent that we will be able to grow the business further over the coming years.
    [Show full text]
  • Special Release Euro: 10 Years of the Single European Currency in Slovenia
    Special Release 23 december 2016 no status Euro: 10 years of the single European currency in Slovenia A decade of euro in Slovenia Ten years ago, on 1 January 2007, Slovenia introduced the euro as the 13th EU Member State. The euro replaced the first monetary currency of our independent state, the Slovenian tolar (SIT), at the exchange rate EUR 1 = SIT 239.64. Steps towards the euro In January 2017 Slovenia will celebrate 10 years of the adoption of the euro. When it became member of the EU, Slovenia also made the commitment to introduce the single European currency and thus to join the Economic and Monetary Union (EMU). Prior to the introduction of the euro, Slovenia had to fulfil certain conditions, and these conditions focused on the stability of public finances, prices, interest rates and the exchange rate. Slovenia will mark the tenth anniversary of euro introduction also by issuing a commemorative €2 coin. The central motif on the coin is 10 swallows flying: each of them represents one of the "springs" since the introduction of the euro, while a bird is the symbol of freedom. At the same time, EU will celebrate the fifteenth anniversary of the introduction of euro banknotes and coins. Globally, euro banknotes maintain the same design, but with euro coins one side is common to all coins and the other (national) side holds a design that is specific to each individual EU Member State. Milestones in the history of euro introduction Sources: BS, ECB Published on: http://www.stat.si/StatWeb/en/News/Index/6414, printed on 28.
    [Show full text]
  • Inflation Report.Indd
    PUBLISHED BY: Central Bank of Montenegro Bulevar Svetog Petra Cetinjskog 6 81000 Podgorica Telephone: +381 81 665 331 Fax: +381 81 665 336 WEBSITE: http://www.cb-cg.org PREPARED BY: Research and Statistics Department Nikola Fabris, PhD, Chief Economist Danijela Vukajlović Grba, assistant director Vesna Saveljić, chief of Real Sector Developments Analysis and Research Division Milica Vlahović, chief of Monetary Research and Statistics Division Svetlana Cerović, chief of Fiscal Analysis Division Boris Kilibarda, chief of Balance of Payments Division TRANSLATED BY: Lidija Ćirović Popadić DESIGNED BY: Andrijana Vujović Users of this publication are requested to make reference to the source of information whenever they use data from the Report. CONTENTS 1. INTRODUCTION .....................................................................................................5 2. INFLATION INDICATORS ......................................................................................6 3. INFLATION FORECASTS .......................................................................................12 4. INFLATION DETERMINANTS ..............................................................................14 4.1 Demand .............................................................................................................14 4.1.1. Movement of Salaries and Other Available Demand Determinants ......14 4.1.2. Budget Analysis .......................................................................................17 4.1.3. External Demand and Current Account
    [Show full text]
  • Fiscal Impact Assessment of Structural Reforms
    With fiscal space limited in South East European economies, this book is very Fiscal Impact Assessment of Structural Reforms Editors: Mojmir Mrak, Robert Bauchmüller, Paul McClure timely. Structural reforms remain crucial to unlock growth in the region, but they frequently entail budgetary costs. Assessing and managing these costs requires a strengthening of capacity, as well as a better integration with budgetary projections and EU planning documents. This volume draws very skillfully on case studies from across the region to explore the operational challenges that this entails, including the need for capacity-building in line ministries as well as ministries of finance. Its conclusions distil important lessons, and offer a practical guide for policy-makers as they approach these problems. The book fills a gap in our understanding of Fiscal Impact public financial management, and it deserves a wide readership. Max Watson Visiting Fellow and Coordinator of South East European political economy studies, Assessment of European Studies Centre, St Antony’s College, Oxford This book is an invaluable resource for those who are seeking to understand how Structural Reforms essential structural reforms in South East European countries are coordinated with fiscal planning processes. Written by those who have been intimately involved with the reforms, the book offers key insights into the challenges that have been overcome and those that still remain. I think it is a great achievement. Case Studies on South East Europe Brian Olden Deputy Division Chief, Fiscal Affairs Department, International Monetary Fund Ministry of Finance Montenegro ISBN 978-961-92845-1-3 Fiscal Impact Assessment of Structural Reforms Case Studies on South East Europe Ljubljana 2013 © 2013, Center of Excellence in Finance (CEF) All rights reserved.
    [Show full text]
  • Annual Report 2005
    guerre énergiestratégienégociation énergiecriseénergie avenirgouvernancegouvernance stratégie guerre 2005 annual report négociationsstratégienégociation ; guerreénergie gouvernance! stratégieénergiecrise gouvernancenégociationcrisestratégieavenir guerreguerre 27 rue de la Procession - 75740 Paris Cedex 15 gouvernanceavenir avenir Tél. : 33 (0) 1 40 61 60 00 - Fax : 33 (0) 1 40 61 60 60 négociation www.ifri.org gouvernancestratégie Contents page 2 Message from the President page 5 France’s Pioneer Foreign Policy “think tank” page 6 2005: The world according to Ifri page 10 In2005, Ifri was notably host to… page 12 Ifri and its partners page 17 Research page 37 Publications page 41 Public discussion meetings page 44 Staff page 46 Financial Annex t r o p e r l a Message from u n n a 5 0 0 2 the President Throughout 2005, Ifri continued its evolution toward the achievement of two key objectives: becoming more of a European institution while preserving its French identity, and growing in size to compare with its American counterparts. Ifri’s mission is to provide expert analysis of international affairs . Currently, the Institute’s main fields of research are: - Globalization (its governance, the corporate response, etc.) and r e l l o energy issues; R r e i v i - Classic security issues based on the rivalry between states and the l O : o proliferation of weapons of mass destruction; t o h - New security issues like international terrorism, the possibility of p global pandemics, and the risk of climate change; - The European continent (including Russia — the evolution of which will have major ramifications for the international system — and the new independent states created after the breakup of the Soviet Union), the on-going construction of the European Union (both its institutional and social dimensions), and transatlantic relations; - East Asia and the Indian subcontinent; 2 - The Greater Middle East (including Afghanistan).
    [Show full text]