Download Download

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Int. J. Econ. Environ. Geol. Vol.Khan 8 (2 )et 9 -al.20 ,/ Int.J.Econ.Envi2017 ron.Geol.Vol. 8(2) 9-20, 2017 Open Access Journal home page: www.econ-environ-geol.org ISSN: 2223-957X Petrographic and Geochemical Analyses of Kirana Hills Shield Rocks around Sargodha and Economic Potential Muhammad Waseem Khan*, Syed Abbas Sultan, Iftikhar Alam, Muhammad Saqib Izhar Atomic Energy Minerals Centre, Lahore-54600, Pakistan *Email: [email protected] Received: 1August, 2016 Accepted: 15 February, 2017 Abstract: The present study deals with geochemical and petrographic analysis of the Kirana Hill shield rocks of Punjab plains from Buland, Hachi, Shaheen Abad, Shaikh and Machh hills. On basis of the current studies certain modifications have been made in the classification and nomenclature of rocks exposed in the study areas. Chemical analyses have also been carried out in order to calculate Cross Iddings, Pirsson, and Washington (CIPW) norms”, to strengthen nomenclature scheme and finally rocks are classified by using “MAGMA SOFTWARE”. Rhyolites predominate over the basalts/dolerites, andesites, and phyllite/ slate. Rhyolitic rocks are light grey, greenish grey and light brown in color, aphanitic in nature. The observed microscopic textures are aphyric, phyric or porphyritic and micropoikilitc. Moreover, some rhyolitic rocks also show flow texture. They are either cryptocrystalline to microcrystalline or microcrystalline to cryptocrystalline. No glassy material has been observed in any thin section. Mafic rocks are characterized by the presence of ferromagnesian minerals with plagioclase. Andesites exhibit mainly porphyritic texture, but aphyric texture has also been observed in few samples. Hydrothermal alterations are also very common in these rocks. Other rock assemblages identified during laboratory studies from Kirana area include: tuffs i.e. (Lithic Crystal Tuff and Lithic Tuff), basaltic andesite, rhyodacite/ dacite, slate/ phyllite, ankeritic rocks/ veins and quartzofeldspathic veins. Our studies also reveal that no evidence of quartzite has been found in the samples collected from above mentioned areas of Kirana, although it has been reported in previous literature. Iron (Fe) has been observed in rhyolite as well as other volcanic rocks of Kirana hills, its presence suggests magma from deep mantle instead of crustal melting / anatexis. In the present analysis some primary and secondary copper minerals including chalcopyrite, atacamite and malachite have been identified. Some anomalous values of the Rare Earth Elements are also observed. Inclusive geological investigations are recommended for better studies to appraise the potential of Iron (Fe), Copper (Cu) and trace/Rare Earth Elements (REE) in the area. Keywords: Mineral, petrographic, chemical analyses, rhyolite, hydrothermal alterations, Kirana Hills. Introduction samples have been analyzed in the mineralogy laboratory of AEMC, Lahore. The outcrops of this complex occur as isolated hillocks around Sargodha covering topographic Geological Setting sheets No. 44A/9, and 41A/3 and lie between longitudes 72˚38'39" to 72˚38'00" and latitudes The present Punjab Foreland basin was developed as 31˚51'00" to 32˚15'00" (Fig. 2). According to extensional basin within Late Proterozoic period of Ahmed (2000, 2004) the Kirana volcanics are a part Northeast Gondwana part of the Greater India, named of Neo-proterozoic Kirana complex. The Kirana as Kirana-Malani Basin (Chaudhry et al., 1999). In Hills form the western extension of the Precambrian this region the rhyolitic mass predominates over shield of India. It represents good example of dolerite/ basalt, andesite and dacite outcrops (Ahmad bimodal continental magmatism. Although the and Chaudhry, 2009). Major outcrops of the Kirana presence of intermediate rocks have been confirmed Hills are located near the city of Sargodha, Chiniot, by mineralogy division of Atomic Energy Minerals Shah Kot and Sangla Hills (Shah, 2009). These areas Centre Lahore. are solely occupied by the exposures of Proterozoic rocks without the occurrences of Phanerozoic However, these rocks are insignificantly small in lithologies. comparison to the acidic and mafic rocks. Present investigation focuses on the chemical and However, it is supposed that this complex supports petrographic analyses of shield rocks exposed in the as basement horizon for the Paleozoic to Eo- form of Kirana Hills to classify the rocks on the Cambrian sedimentary cover sequence exposed 100 bases of laboratory results of this research work. km north in the Salt Range (Fig. 1). The Kirana Hill This study encompasses the collection of more than rocks are very significantly economic sources of three hundred rock samples from surface and aggregates for the construction of road projects and subsurface of the Kirana Hills. Subsequently these 9 Copyright © SEGMITE Khan et al. /Int.J.Econ.Environ.Geol.Vol. 8(2) 9-20, 2017 civil super structures in the Punjab province of Calcium (Ca) and Magnesium (Mg) were estimated in Pakistan (Khan and Chaudhry, 1991; Khan, 2004). the fused sample either by volumetric analysis using EDTA as standard solution with different Ph and indicators or by atomic absorption spectrophotometer with the help of Z8000 Hitachi coupled with graphite furnace Japan, depending on the concentration and interfering environment of the matrix. Alumina (Al2O3) was estimated in the sample prepared by fusion with Aizarin red-S as chromogenic reagent by spectrophotometer. Titanium (TiO2) and phosphorous penta oxide (P2O5) were also estimated from multiacid leach solution by using hydrogen per oxide and ammonium vanado molybedate as chromogenic reagents for the complexion of both constituents respectively in their analysis spectrophotometrically with the help of Helios Epsilon Thermospectronic, single beam USA. Ferrous (Fe+2) was leached with nitric acid and hydrofluoric acid without any heating by keeping the sample over night and estimated volumetrically by using potassium di chromate as standard solution using Fig. 1 Location map of North Pakistan, square showing the Barium Diphenyl amin Sulphonate (BADAS) as study area. indicator. Materials and Methods Total iron (Fe) and manganese (Mn) were estimated through atomic absorption spectrometer (Z8000 Petrographic Analyses Hitachi coupled with graphite furnace, Japan) in multiacid leach solution. However, the iron contents Detailed petrographic studies of three hundred samples may also be determined volumetrically in the multiacid collected from the study area were carried out by using leach solution or fused sample using potassium standard petrographic Olympus BX 51 polarizing dichromate as standard solution and BADAS microscope fitted with Olympus DP12 camera. Several indication depending on the concentration of the iron. rock types have been described based on mineralogy and texture. The modal composition of hypabassal and Sodium (Na) and Potassium (K) were determined in microcrystalline volcanic rocks was volumetrically the multiacid leach solution of the sample on flame determined by recommended comparison charts, while photometer (Jenway PFP-7) with appropriate filter of composition of cryptocrystalline volcanic rocks was respective elements. It is an emission spectrophoto determined with the help of chemical analyses. meter technique. Important features of rocks are illustrated by photomicrographs. Carbon dioxide (CO2) was estimated indirectly in the form of carbonates volumetrically. Carbonates present Chemical Analyses in the samples were digested with excess hydrochloric acid of known strength. The excess acid was titrated Wet chemical analyses of more than two hundred with standard solution of sodium hydroxide using volcanic as well as hypabassal rocks samples were phenolphthalein as indicator. Volume of hydrochloric carried out to classify the rocks based on twelve major acid used for the digestion of carbonates was oxides and Loss on ignition (LOI) content as these determined from the volume of sodium hydroxide used rocks are fine grained, but results of some of the in titration. Data obtained was used to calculate the representative samples of each rock type are selected amount of carbon dioxide present in the sample. for this research work. Wet chemical analysis is a destructive technique and following constituents were Loss on Ignition was determined gravimetrically by estimated by using this technique. using Carbolite Furnace. The weighed sample was o Silica (SiO2) the main constituent of most of rocks was heated up to 900 C for one hour. The loss on weight estimated by gravimetrically. The samples were was calculated as percentage of LOI. digested with Nitric acid which removes all the soluble radicals except silica and separated through filtration. The oxides were converted to minerals, the calculated Finally the silica is estimated from residue with the abundance of the minerals is known as norm. The first treatment of Hydrofluoric acid gravimetrically. norm was devised by the four petrologists Cross, 10 Khan et al. /Int.J.Econ.Environ.Geol.Vol. 8(2) 9-20, 2017 Iddings, Pirsson, and Washington, and thus it is fruitful results. “MAGMA” software follows IUGS commonly referred to as CIPW norms (Philpotts, classification scheme to classify the rocks (Fig. 8). Fig. 2 Geological map of Kirana Hills. Colored rounded spots showing the locations of samples collected from the area, District Sargodha, Punjab (after Ahmed et al, 2007). Table 1. Chemical analysis showing high percentage of Iron (Fe) and low Nickel (Ni)
Recommended publications
  • India-Pakistan Conflicts – Brief Timeline

    India-Pakistan Conflicts – Brief Timeline

    India-Pakistan Conflicts – Brief timeline Added to the above list, are Siachin glacier dispute (1984 beginning – 2003 ceasefire agreement), 2016- 17 Uri, Pathankot terror attacks, Balakot surginal strikes by India Indo-Pakistani War of 1947 The war, also called the First Kashmir War, started in October 1947 when Pakistan feared that the Maharaja of the princely state of Kashmir and Jammu would accede to India. Following partition, princely states were left to choose whether to join India or Pakistan or to remain independent. Jammu and Kashmir, the largest of the princely states, had a majority Muslim population and significant fraction of Hindu population, all ruled by the Hindu Maharaja Hari Singh. Tribal Islamic forces with support from the army of Pakistan attacked and occupied parts of the princely state forcing the Maharaja Pragnya IAS Academy +91 9880487071 www.pragnyaias.com Delhi, Hyderabad, Bangalore, Tirupati & Pune +91 9880486671 www.upsccivilservices.com to sign the Instrument of Accession of the princely state to the Dominion of India to receive Indian military aid. The UN Security Council passed Resolution 47 on 22 April 1948. The fronts solidified gradually along what came to be known as the Line of Control. A formal cease-fire was declared at 23:59 on the night of 1 January 1949. India gained control of about two-thirds of the state (Kashmir valley, Jammu and Ladakh) whereas Pakistan gained roughly a third of Kashmir (Azad Kashmir, and Gilgit–Baltistan). The Pakistan controlled areas are collectively referred to as Pakistan administered Kashmir. Pragnya IAS Academy +91 9880487071 www.pragnyaias.com Delhi, Hyderabad, Bangalore, Tirupati & Pune +91 9880486671 www.upsccivilservices.com Indo-Pakistani War of 1965: This war started following Pakistan's Operation Gibraltar, which was designed to infiltrate forces into Jammu and Kashmir to precipitate an insurgency against rule by India.
  • Pakistan's Rise to Nuclear Power and the Contribution of German Companies

    Pakistan's Rise to Nuclear Power and the Contribution of German Companies

    PRIF-Report No. 118 Pakistan's Rise to Nuclear Power and the Contribution of German Companies Klaus-Peter Ricke the Translation: Matthew Harris © Peace Research Institute Frankfurt (PRIF) 2013 Address: PRIF x Baseler Straße 27–31 x 60329 Frankfurt am Main, Germany Phone: +49 (0) 69 95 91 04–0 x Fax: +49 (0) 69 55 84 81 E-mail: [email protected] x Internet: www.prif.org ISBN: 978-3-942532-50-1 € 10.00 Summary The amendment of the Foreign Trade and Payments Act (Außenwirtschaftsgesetz) has prompted the preparation of this paper because of concerns over potential setbacks in advances achieved over the past twenty years in regulating German exports to non-EU countries and shipments to member states of the EU and the watering down of export restrictions to correspond to the low standards in place at the EU level (with the objective of streamlining the Foreign Trade and Payments Act and nullifying special German re- quirements which place German exporters at a disadvantage compared with their Euro- pean competitors, according to a spokesperson of the German Federal Ministry of Economics and Technology). This would send the wrong signal on combating prolifera- tion. From the 1970s to 1990s the Federal Republic of Germany played an extremely negative role because it opened the doors wide to the proliferation of weapons of mass destruction through lax legislation and even more slipshod enforcement. Alarmed by several scandals, in recent years the German government has taken the lead regarding this issue and it would be appropriate for it to continue to fulfill this role.
  • India-Pakistan Relations: the Story of Unsolved Conflicts

    India-Pakistan Relations: the Story of Unsolved Conflicts

    ISSN: 2455-2631 © May 2017 IJSDR | Volume 2, Issue 5 INDIA-PAKISTAN RELATIONS: THE STORY OF UNSOLVED CONFLICTS Dr. Saroj Choudhary Assistant Professor ALS, Amity University Madhya Pradesh, Gwalior – 474005 INTRODUCTION Since, India became independent and divided by the British government the relationship between these two countries has been mostly unstable with ever growing distrust on each other. Both countries have fought wars in the South Asia region at different fronts and continue to face problems like border terrorist activities, infiltrations, low intensity wars and intelligence/spy operations that seem unstoppable as both will continue to consider each other as an untrustworthy enemy.1 It is seen that after the end of cold war, it has become one of the most dangerous and volatile regions in the international politics for which several reasons are responsible such as pre-independence hostility between the Muslim League and the Indian national Congress and bloodletting riots in post independence period at the time of partition. Moreover, disputes over waters flowing from India to Pakistan and finally, Kashmir which remains a subject of conflicts and bone of skirmishes between these two countries. However, there are many changes in the field of technology, global political economy and social networks took place particularly after the disintegration of Soviet Union. With this, the controversial and disappointing relationship between India and Pakistan has worsened as both have become nuclear states. In recent years, infiltration, proxy war and civilian attacks by Pakistan are increasing which is taking both states far away from the negotiation table. So many times, Pakistan took resort to International Organizations to solve the matters which in turn creates space for external powers as well.
  • Geology and Geophysics of the Foreland Fold-Thrust Belt of Northwestern Pakistan 1

    Geology and Geophysics of the Foreland Fold-Thrust Belt of Northwestern Pakistan 1

    AN ABSTRACT OF THE THESIS OF James W. McDougall for the degree of Doctor of Philosophy in Geology presented on September 29. 1988 Title: Geology and Geophysics of the Foreland Fold-Thrust Belt of Northwestern Pakistan 1 Abstract approved: Robert S. Yeats Himalayan collision produced frontal and lateral ramps and associated Pliocene to Quaternary tectonic geomorphic features in the foreland fold-thrust belt of northwestern Pakistan. The transpressional right-lateral Kalabagh tear fault zone displaced the emergent Surghar Range frontal thrust from the western Salt Range by 16-19 km since 1.9-2.1 Ma: the age of youngest Siwalik molasse strata erosionally truncated during the southward advance of decollement thrusting. Folds and fanglomerate deposits resulting from decollement thrusting were also cut by the Kalabagh fault. North of the eastern Surghar Range, the N15W-trending Kalabagh fault bends to the west into north-dipping thrust faults that sole out beneath the southern Kohat Plateau. Foreland subsidence associated with the southward advance of thrusting controlled the distribution of Indus River conglomerates during the late Pliocene and Quaternary. Uplift in the northern Kalabagh fault zone diverted the Indus river eastward to its present course. South of the Main Boundary thrust (MBT) and west of the Indus River, decollement thrusting dominated by layer-parallel slip of as much as 32 km on a single thrust fault emplaced blind thrust sheets and fault-bend folds. Balanced cross sections show over 50% line-length shortening in sedimentary strata between the top of the basement and the base of the elastic wedge of the Murree and Kamlial formations and the Siwalik Group.
  • 247. Arsenic and Manganese Contamination of Groundwater in Punjab Plain, Pakistan

    247. Arsenic and Manganese Contamination of Groundwater in Punjab Plain, Pakistan

    ARSENIC AND MANGANESE CONTAMINATION OF GROUNDWATER IN PUNJAB PLAIN, PAKISTAN – EFFECTS OF WATER‐ROCK INTERACTION Mitsuo Yoshida1 and Mirza Naseer Ahmad2 E‐mail: [email protected] 1 Environmental Research Laboratory, International Network for Environmental and Humanitarian Cooperation (iNehc), Nonprofit Inc., Tokyo, Japan 2 Earth Science Department, Abdus Salam School of Sciences, Nusrat Jahan College, Rabwah, District Chiniot, Punjab, Pakistan INTRODUCTION: Punjab plain is the most populous province in Pakistan, as its population reaches more than 100 million, where is characterized by a semi-arid climate, and in most area, drinking water and agricultural water are obtained from groundwater wells. Due to rapid population growth and expansion of agricultural fields, there has been a drastic increase in groundwater exploitation resulting in lowering of water tables and deterioration of water quality. District Chiniot, north central part of Punjab plain is one of the typical areas where such deterioration of water quality is significant. In the District, the Kirana Hills are located which Source: Petroleum systems and hydrocarbon potential of the North‐West Himalaya exhibits a peculiar terrain of a series of Precambrian basement of India and Pakistan. ‐ Craig J. et al. (2018) rock masses sporadically exposed on the Punjab plain. Figure1: Thematic geologic cross section of the study zone (red-colored box) and its surroundings, middle-northern Pakistan. Table 1: Results of ICP-MS trace element analysis for groundwater samples GROUNDWATER QUALITY: Previous study reported that groundwater distributed around the Kirana Hills showed high electric conductivity (averaged EC = 4,584 μS/cm), high total dissolved solid (averaged TDS = 2,505 mg/l), and high hardness (averaged Hardness = 827 mg/l), and high salinity (Cl = 1,241 mg/l).
  • Provenance of Thal Desert Sand

    Provenance of Thal Desert Sand

    Revised Manuscript with Changes Marked 1 Provenance of Thal Desert sand: focused erosion in the western 1 2 Himalayan syntaxis and foreland-basin deposition driven by latest 3 4 Quaternary climate change 5 6 7 8 9 10 1* 1* 1 2 11 Eduardo Garzanti , Wendong Liang , Sergio Andò , Peter D. Clift , Alberto 12 1 3 1 13 Resentini , Pieter Vermeesch , Giovanni Vezzoli . 14 15 16 17 1 18 Laboratory for Provenance Studies, Department of Earth and Environmental Sciences, 19 20 University of Milano-Bicocca, Milano 20126, Italy 21 2 Department of Geology and Geophysics, Louisiana State University, Baton Rouge, LA 70803, 22 23 USA 24 25 3London Geochronology Centre, Department of Earth Sciences, University College London, 26 27 London, C1E 6BT, UK 28 29 30 * Corresponding authors (e-mail: [email protected] and [email protected]) 31 32 33 34 Keywords: Sand petrography and geochemistry; Detrital-zircon geochronology; Variability of 35 Nd values; Focused erosion; Himalaya-Karakorum; Kohistan Arc; Indus River, Delta, and Fan. 36 37 38 39 Highlights: 40 41 The Thal Desert is an inland archive of Indus sand from the western Himalaya syntaxis 42 43 44 Sand stored in the Thal dunefield reveals major detrital supply from the Kohistan arc 45 46 High variability of Nd values is controlled by minimal changes in monazite content 47 48 49 The Thal Desert formed in a dry landscape between the LGM and the wet early Holocene 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 2 Abstract 1 2 3 4 As a latest Pleistocene repository of Indus River sand at the entry point to the Himalayan foreland 5 6 basin, the Thal dune field in northern Pakistan stores crucial information that can be used to 7 8 9 reconstruct the erosional evolution of the Himalayan-Karakorum orogen and the changes in the 10 11 foreland-basin landscape that took place between the Last Glacial Maximum and the early Holocene.
  • Land Degradation Pattern Spectral and Multi-Temporal Koreas Urban Regeneration Transhumance Pastoralists

    Land Degradation Pattern Spectral and Multi-Temporal Koreas Urban Regeneration Transhumance Pastoralists

    Online ISSN : 2249-460X Print ISSN : 0975-587X Land Degradation Pattern Koreas Urban Regeneration Spectral and Multi-Temporal Transhumance Pastoralists Global Journal of Human Social Sciences :B Geography Geo -Sciences & Environmental Glo bal Journal of Human Social Sciences :B Geography Geo -Sciences & Environmental Volume 13 Issue 1 (Ver. 1.0) Open Association of Research Society *OREDO-RXUQDORI+XPDQ *OREDO-RXUQDOV,QF Social Sciences. 2013. $'HODZDUH86$,QFRUSRUDWLRQZLWK³*RRG6WDQGLQJ´Reg. Number: 0423089 6SRQVRUV Open Association of Research Society $OOULJKWVUHVHUYHG 2SHQ6FLHQWLILF6WDQGDUGV 7KLVLVDVSHFLDOLVVXHSXEOLVKHGLQYHUVLRQ RI³*OREDO-RXUQDORI+XPDQ6RFLDO 3XEOLVKHU¶V+HDGTXDUWHUVRIILFH 6FLHQFHV´%\*OREDO-RXUQDOV,QF $OODUWLFOHVDUHRSHQDFFHVVDUWLFOHVGLVWULEXWHG *OREDO-RXUQDOV,QF+HDGTXDUWHUV&RUSRUDWH2IILFH XQGHU³*OREDO-RXUQDORI+XPDQ6RFLDO 6FLHQFHV´ &DPEULGJH2IILFH&HQWHU,,&DQDO3DUN)ORRU1R 5HDGLQJ/LFHQVHZKLFKSHUPLWVUHVWULFWHGXVH WKCambridge (Massachusetts)3LQ0$ (QWLUHFRQWHQWVDUHFRS\ULJKWE\RI³*OREDO -RXUQDORI+XPDQ6RFLDO6FLHQFHV´XQOHVV 8QLWHG6WDWHV RWKHUZLVHQRWHGRQVSHFLILFDUWLFOHV 86$7ROO)UHH 86$7ROO)UHH)D[ 1RSDUWRIWKLVSXEOLFDWLRQPD\EHUHSURGXFHG RUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQV 2IIVHW7\SHVHWWLQJ HOHFWURQLFRUPHFKDQLFDOLQFOXGLQJ SKRWRFRS\UHFRUGLQJRUDQ\LQIRUPDWLRQ VWRUDJHDQGUHWULHYDOV\VWHPZLWKRXWZULWWHQ Open A ssociation of Research Society , Marsh Road, SHUPLVVLRQ Rainham, Essex, London RM13 8EU 7KHRSLQLRQVDQGVWDWHPHQWVPDGHLQWKLV United Kingdom. ERRNDUHWKRVHRIWKHDXWKRUVFRQFHUQHG 8OWUDFXOWXUHKDVQRWYHULILHGDQGQHLWKHU FRQILUPVQRUGHQLHVDQ\RIWKHIRUHJRLQJDQG
  • Reclamation by Tubewell Drainage in Rechna Doab and Adjacent Areas, Punjab Region, Pakistan

    Reclamation by Tubewell Drainage in Rechna Doab and Adjacent Areas, Punjab Region, Pakistan By GLENN T. MALMBERG CONTRIBUTIONS TO THE HYDROLOGY OF ASIA ANE OCEANIA GEOLOGICAL SURVEY WATER-SUPPLY PAPER 1608-O Prepared in cooperation with the West Pakistan Water and Power Development Authority under the auspices of the United States Agency for International Development UNITED STATES GOVERNMENT PRINTING OFFICE, WASHI1 TGTON : 1975 UNITED STATES DEPARTMENT OF THE INTERIOR STANLEY K. HATHAWAY, Secretary GEOLOGICAL SURVEY V. E. McKelvey, Director Library of Congress Cataloging in Publication Data Malmberg, Glenn Thomas, 1952- Reclamation by tubewell drainage in Rechna Doab and adjacent areas, Pun­ jab region, Pakistan. (Contributions to the hydrology of Asia and Oceania) (Geological Survey water-supply paper; 1608-O) "Prepared in cooperation with the West Pakistan Water and Power Develop­ ment Authority under the auspices of the United States Agency for Inter­ national Development." Bibliography: p. Includes index. Supt. of Docs, no.: I 19.13:1608-0 1. Drainage Pakistan Rechna Doab. 2. Wells Pakistan Rechna Doab. I. West Pakistan. Water and Power Development Authority. II. Title. III. Series. IV. Series: United States. Geological Survey. Water-supply paper; 1608-0. TC801.U2 no. 1608-0 [TC978.P32] 627'.08s [631.6'2'0954914] 74-20536 For sale by the Superintendent of Documents, U.S. Government Printing Office Washington, D.C. 20402 Stock Number 024-001-02634-3 CONTENTS Page Abstract ______________________________________ Ol Introduction ____________________________ 2 Purpose and scope of the hydrologic monitoring program ____ 7 Acknowledgments _____________.__________ 8 General features of the area _________________________ 9 Water resource development _______________________ 11 Ground water _________________________________.
  • Nuclear Proliferation International and Regional Challenges for Pakistan and Iran

    Nuclear Proliferation International and Regional Challenges for Pakistan and Iran

    NUCLEAR PROLIFERATION INTERNATIONAL AND REGIONAL CHALLENGES FOR PAKISTAN AND IRAN A DOCTORAL DISSERTATION By M. UMAIR RAFIQUE DEPARTMENT OF POLITICAL SCIENCE UNIVERSITY OF KARACHI KARACHI – PAKISTAN 2014 NUCLEAR PROLIFERATION INTERNATIONAL AND REGIONAL CHALLENGES FOR PAKISTAN AND IRAN A DISSERTATION SUBMITTED TO THE UNIVERSITY OF KARACHI IN FULFILLMENT OF THE REQUIREMENTS FOR THE DEGREE OF DOCTOR OF PHILOSOPHY IN POLITICAL SCIENCE By M. UMAIR RAFIQUE UNDER THE SUPERVISION OF PROF. DR. TANWEER KHALID DEPARTMENT OF POLITICAL SCIENCE UNIVERSITY OF KARACHI KARACHI – PAKISTAN 2014 CERTIFICATE Certified that Mr. Muhammad Umair Rafique S/O Rafique Ahmed has written this thesis titled, “Nuclear Proliferation: International and Regional Challenges for Pakistan and Iran” from Department of Political Science, University of Karachi towards the fulfillment of the requirement of Ph.D. degree. To the best of my knowledge the dissertation is based on original research. Prof. Dr. Tanweer Khalid Research Supervisor Department of Political Science University of Karachi DEDICATED TO MY PARENTS MIAN RAFIQUE AHMED & TANWEER KAUSAR Thank you for your appreciation and love without your support I wouldn't have been able to acquire this milestone TABLE OF CONTENTS Page No TABLE OF CONTENT………………………………………………………... i-x LIST OF TABLES……………………………………………………………... Xi ACNOWLEDGMENT………………………………………………………… Xii ABSTRACT……………………………………………………………….......... xiii-xiv INTRODUCTION……………………………………………………………… 1-8 CHPTER: 1 1. NUCLEAR PROLIFERATION: A STRATEGY FOR POWER………. 9-10 1.1. NUCLEAR WEAPONS: POTENTIAL AND IMPACT……………. 10-12 1.2. EVOLUTION OF NUCLEARIZATION……………………………. 12-13 1.3. HORIZONTAL PROLIFERATION………………………………… 13-15 1.4. VERTICAL PROLIFERATION…………………………………….. 15-16 1.5. THEORIZING OF NUCLEAR PROLIFERATION……………….. 16 1.5.1. LIBERAL THEORY ON NUCLEAR PROLIFERATION 16 1.5.2.
  • Engineering and Petrographic Properties of Meta Dolerite Aggregates of Kirana Hills of Sargodha, Punjab, Pakistan

    Engineering and Petrographic Properties of Meta Dolerite Aggregates of Kirana Hills of Sargodha, Punjab, Pakistan

    Journal of Himalayan Earth Sciences Volume 54, No. 1, 2021 pp. 1-10 Engineering and petrographic properties of meta dolerite aggregates of Kirana Hills of Sargodha, Punjab, Pakistan Muhammad Nawaz Chaudhry1*, Muzaffar Majid2, and Uzma Ashraf1 1Department of Environmental Sciences and Policy, Lahore School of Economics, Lahore 2College of Earth and Environmental Sciences, University of the Punjab, Lahore *Corresponding author's email: [email protected] Submitted date: 21/02/2017 Accepted date: 24/02/2021 Published online: 31/03/2021 Abstract Kirana, Rabwa and Chiniot areas of the Punjab province, Pakistan has a number of isolated hills jutting out of a flat alluvial plain. These rocks are Upper Proterozoic in age. The exposed volcano-sedimentary sequence is slightly metamorphosed (lower greenschist facies). The dolerites have also undergone auto metasomatic changes. The Kirana Hills are the main resource of aggregate in southern and middle Punjab. These aggregates are used in subbase, base course, in rail ballast, as riprap and for the cement and asphalt concrete. The main lithologies in Kirana Hills are dolerites and rhyolites, lithic greywackes, volcanogenic slates and quartz wackes. This paper deals only with the dolerites and their petrographic composition and engineering properties, as well as adhesion values. The variably auto metasomatized dolerites are now composed of variable amounts of plagioclase, chlorite, calcite and amphibole with quartz, magnetite, hydro mica, K-feldspar, epidote and sphene as subordinate to accessory minerals. Flakiness, Elongation, Specific Gravity, Water Absorption, Soundness, Los Angeles, Aggregate Crushing, Aggregate Impact and Adhesion Values are all within ASTM limits. Therefore, the dolerite aggregates of Kirana area have excellent Engineering Properties.
  • Pakistan's Nuclear Policy and Its Impact on India's National Security

    Pakistan's Nuclear Policy and Its Impact on India's National Security

    International Journal of Engineering and Management Research, Vol. 2, Issue-2, April 2012 ISSN No.: 2250-0758 Pages: 35-37 www.ijemr.net Pakistan’s Nuclear Policy and Its Impact on India’s National Security Dr. Yatish Prasad Assistant Professor, Department of Military Science, Govt. P.G. College Gopeshwar (Chamoli), INDIA ABSTRACT Pakistan also received assistance from states, Pakistan asserts the origin of its nuclear power especially China. Beginning in the late 1970s Beijing programmes lies in its adversarial relationship with India. provided Islamabad with various levels of nuclear and Initially steps toward the development of Pakistan’s nuclear missile related assistances, including centrifuge equipment, programme date to the late 1950s, including with the warhead designs, HEU, components of various missile establishment of the Pakistan Atomic Energy Commission systems and technical expertise. (PACE) in 1956. President Z.A. Bhutto Force fully Advocated the nuclear option and famously said in 1965 that Eventually from the 1980s onwards, the Khan “If India builds the bomb, we will eat grass or network diversified. Its activities and illicitly transferred leaves, ever go hungry but we will get one of our own”. nuclear technology and expertise to Iran. North Korea and Libya. The Khan network was officially dismantled in Keywords-- Nuclear Policy, India, Pakistan, National 2004, although questions still remain concerning the extent Security of the Pakistani political and military establishment’s involvement in the network’s activities. I. INTRODUCTION Pakistan Atomic Energy Commission popularly known as PAEC, is an administrative, governmental and After December 1971 defeat in the conflict with autonomous science and technology research institution, India, Bhutto issued a directive instructing the country’s responsible for the development of nuclear power sector in nuclear establishment to build a nuclear detonation of a Pakistan.
  • Riparian Rights: a Case Study of India and Pakistan

    Riparian Rights: a Case Study of India and Pakistan

    RIPARIAN RIGHTS: A CASE STUDY OF INDIA AND PAKISTAN By Muhammad Nawaz Roll No. PKS-08-03 Supervised By Prof. Dr. Muhammad Farooq A thesis submitted in fulfilment of the requirement for the Degree of Doctor of Philosophy in Pakistan Studies Department of Pakistan Studies, Bahauddin Zakariya University, Multan, Pakistan Dedicated to My Parents ii Abstract Fresh water is vital to the economies and societies of countries, especially to those which lie in the arid climatic regions. The issue of water scarcity in certain regions of the world has led to an expectation of international conflict based upon the increasing competition for fresh water. One example is the confrontation between India and Pakistan over shared waters of the Indus River System. This study aims to enhance our understanding regarding the Indus Water dispute. Immediately, after the partition of Indian sub-continent into two independent and sovereign states of India and Pakistan in 1947, water became a focal point between the two nations. Being an upper riparian and having the control of headworks, India stopped water into all canals flowing into Pakistan. This action made Pakistan more conscious about its water rights because the Indus River System is source of life for Pakistan. In this context, this study traces the origin of water dispute between Pakistan and India from the partition of the Punjab. It further explores how water dispute was settled under the auspices of the World Bank and Indus Water Treaty was signed in 1960. It also provides a detailed picture of consequent developments of water infrastructure in the region and emerging challenges to Indus Water Treaty.