DOCSLIB.ORG

Land Degradation Pattern Spectral and Multi-Temporal Koreas Urban Regeneration Transhumance Pastoralists

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Land Degradation Pattern Spectral and Multi-Temporal Koreas Urban Regeneration Transhumance Pastoralists Online ISSN : 2249-460X Print ISSN : 0975-587X Land Degradation Pattern Koreas Urban Regeneration Spectral and Multi-Temporal Transhumance Pastoralists Global Journal of Human Social Sciences :B Geography Geo -Sciences & Environmental Glo bal Journal of Human Social Sciences :B Geography Geo -Sciences & Environmental Volume 13 Issue 1 (Ver. 1.0) Open Association of Research Society *OREDO-RXUQDORI+XPDQ *OREDO-RXUQDOV,QF Social Sciences. 2013. $'HODZDUH86$,QFRUSRUDWLRQZLWK³*RRG6WDQGLQJ´Reg. Number: 0423089 6SRQVRUV Open Association of Research Society $OOULJKWVUHVHUYHG 2SHQ6FLHQWLILF6WDQGDUGV 7KLVLVDVSHFLDOLVVXHSXEOLVKHGLQYHUVLRQ RI³*OREDO-RXUQDORI+XPDQ6RFLDO 3XEOLVKHU¶V+HDGTXDUWHUVRIILFH 6FLHQFHV´%\*OREDO-RXUQDOV,QF $OODUWLFOHVDUHRSHQDFFHVVDUWLFOHVGLVWULEXWHG *OREDO-RXUQDOV,QF+HDGTXDUWHUV&RUSRUDWH2IILFH XQGHU³*OREDO-RXUQDORI+XPDQ6RFLDO 6FLHQFHV´ &DPEULGJH2IILFH&HQWHU,,&DQDO3DUN)ORRU1R 5HDGLQJ/LFHQVHZKLFKSHUPLWVUHVWULFWHGXVH WKCambridge (Massachusetts)3LQ0$ (QWLUHFRQWHQWVDUHFRS\ULJKWE\RI³*OREDO -RXUQDORI+XPDQ6RFLDO6FLHQFHV´XQOHVV 8QLWHG6WDWHV RWKHUZLVHQRWHGRQVSHFLILFDUWLFOHV 86$7ROO)UHH 86$7ROO)UHH)D[ 1RSDUWRIWKLVSXEOLFDWLRQPD\EHUHSURGXFHG RUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQV 2IIVHW7\SHVHWWLQJ HOHFWURQLFRUPHFKDQLFDOLQFOXGLQJ SKRWRFRS\UHFRUGLQJRUDQ\LQIRUPDWLRQ VWRUDJHDQGUHWULHYDOV\VWHPZLWKRXWZULWWHQ Open A ssociation of Research Society , Marsh Road, SHUPLVVLRQ Rainham, Essex, London RM13 8EU 7KHRSLQLRQVDQGVWDWHPHQWVPDGHLQWKLV United Kingdom. ERRNDUHWKRVHRIWKHDXWKRUVFRQFHUQHG 8OWUDFXOWXUHKDVQRWYHULILHGDQGQHLWKHU FRQILUPVQRUGHQLHVDQ\RIWKHIRUHJRLQJDQG QRZDUUDQW\RUILWQHVVLVLPSOLHG 3DFNDJLQJ &RQWLQHQWDO'LVSDWFKLQJ (QJDJHZLWKWKHFRQWHQWVKHUHLQDW\RXURZQ ULVN *OREDO-RXUQDOV,QGLD 7KHXVHRIWKLVMRXUQDODQGWKHWHUPVDQG FRQGLWLRQVIRURXUSURYLGLQJLQIRUPDWLRQLV )LQGDFRUUHVSRQGHQFHQRGDORIILFHUQHDU\RX JRYHUQHGE\RXU'LVFODLPHU7HUPVDQG &RQGLWLRQVDQG3ULYDF\3ROLF\JLYHQRQRXU ZHEVLWHKWWSJOREDOMRXUQDOVus WHUPVDQG FRQGLWLRQPHQXLG1463/ 7RILQGQRGDORIILFHURI\RXUFRXQWU\SOHDVH HPDLOXVDWORFDO#JOREDOMRXUQDOVRUJ %\UHIHUULQJXVLQJUHDGLQJDQ\W\SHRI DVVRFLDWLRQUHIHUHQFLQJWKLVMRXUQDOWKLV H&RQWDFWV VLJQLILHVDQG\RXDFNQRZOHGJHWKDW\RXKDYH UHDGWKHPDQGWKDW\RXDFFHSWDQGZLOOEH ERXQGE\WKHWHUPVWKHUHRI 3UHVV,QTXLULHVSUHVV#JOREDOMRXUQDOVRUJ $OOLQIRUPDWLRQMRXUQDOVWKLVMRXUQDO ,QYHVWRU,QTXLULHVLQYHVWHUV#JOREDOMRXUQDOVRUJ DFWLYLWLHVXQGHUWDNHQPDWHULDOVVHUYLFHVDQG RXUZHEVLWHWHUPVDQGFRQGLWLRQVSULYDF\ 7HFKQLFDO6XSSRUWWHFKQRORJ\#JOREDOMRXUQDOVRUJ SROLF\DQGWKLVMRXUQDOLVVXEMHFWWRFKDQJH 0HGLD 5HOHDVHVPHGLD#JOREDOMRXUQDOVRUJ DQ\WLPHZLWKRXWDQ\SULRUQRWLFH Incorporation No.: 0423089 License No.: 42125/022010/1186 3ULFLQJ ,QFOXGLQJE\$LU3DUFHO&KDUJHV Registration No.: 430374 Import-Export Code: 1109007027 Employer Identification Number (EIN): )RU$XWKRUV USA Tax ID: 98-0673427 86' %: 86' &RORU <HDUO\6XEVFULSWLRQ 3HUVRQDO ,QVWLWXWLRQDO 200 USD (B/W) & 250 USD (Color) Editorial Board Members (HON.) John A. Hamilton,"Drew" Jr., Dr. Wenying Feng Ph.D., Professor, Management Professor, Department of Computing & Computer Science and Software Information Systems Engineering Department of Mathematics Director, Information Assurance Trent University, Peterborough, Laboratory ON Canada K9J 7B8 Auburn University Dr. Thomas Wischgoll Dr. Henry Hexmoor Computer Science and Engineering, IEEE senior member since 2004 Wright State University, Dayton, Ohio Ph.D. Computer Science, University at B.S., M.S., Ph.D. Buffalo (University of Kaiserslautern) Department of Computer Science Southern Illinois University at Carbondale Dr. Abdurrahman Arslanyilmaz Dr. Osman Balci, Professor Computer Science & Information Systems Department of Computer Science Department Virginia Tech, Virginia University Youngstown State University Ph.D.and M.S.Syracuse University, Ph.D., Texas A&M University Syracuse, New York University of Missouri, Columbia M.S. and B.S. Bogazici University, Gazi University, Turkey Istanbul, Turkey Dr. Xiaohong He Professor of International Business Yogita Bajpai University of Quinnipiac M.Sc. (Computer Science), FICCT BS, Jilin Institute of Technology; MA, MS, U.S.A.Email: PhD,. (University of Texas-Dallas) [email protected] Burcin Becerik-Gerber Dr. T. David A. Forbes University of Southern California Associate Professor and Range Ph.D. in Civil Engineering Nutritionist DDes from Harvard University Ph.D. Edinburgh University - Animal M.S. from University of California, Berkeley Nutrition & Istanbul University M.S. Aberdeen University - Animal Nutrition B.A. University of Dublin- Zoology Dr. Bart Lambrecht Dr. Söhnke M. Bartram Director of Research in Accounting and Department of Accounting and FinanceProfessor of Finance FinanceLancaster University Management Lancaster University Management School SchoolPh.D. (WHU Koblenz) BA (Antwerp); MPhil, MA, PhD MBA/BBA (University of Saarbrücken) (Cambridge) Dr. Miguel Angel Ariño Dr. Carlos García Pont Professor of Decision Sciences Associate Professor of Marketing IESE Business School IESE Business School, University of Barcelona, Spain (Universidad de Navarra) Navarra CEIBS (China Europe International Business Doctor of Philosophy (Management), School). Massachusetts Institute of Technology Beijing, Shanghai and Shenzhen (MIT) Ph.D. in Mathematics Master in Business Administration, IESE, University of Barcelona University of Navarra BA in Mathematics (Licenciatura) Degree in Industrial Engineering, University of Barcelona Universitat Politècnica de Catalunya Philip G. Moscoso Dr. Fotini Labropulu Technology and Operations Management Mathematics - Luther College IESE Business School, University of Navarra University of ReginaPh.D., M.Sc. in Ph.D in Industrial Engineering and Mathematics Management, ETH Zurich B.A. (Honors) in Mathematics M.Sc. in Chemical Engineering, ETH Zurich University of Windso Dr. Sanjay Dixit, M.D. Dr. Lynn Lim Director, EP Laboratories, Philadelphia VA Reader in Business and Marketing Medical Center Roehampton University, London Cardiovascular Medicine - Cardiac BCom, PGDip, MBA (Distinction), PhD, Arrhythmia FHEA Univ of Penn School of Medicine Dr. Mihaly Mezei Dr. Han-Xiang Deng ASSOCIATE PROFESSOR MD., Ph.D Department of Structural and Chemical Associate Professor and Research Biology, Mount Sinai School of Medical Department Division of Neuromuscular Center Medicine Ph.D., Etvs Lornd University Davee Department of Neurology and Clinical Postdoctoral Training, NeuroscienceNorthwestern University New York University Feinberg School of Medicine Dr. Pina C. Sanelli Dr. Michael R. Rudnick Associate Professor of Public Health M.D., FACP Weill Cornell Medical College Associate Professor of Medicine Associate Attending Radiologist Chief, Renal Electrolyte and NewYork-Presbyterian Hospital Hypertension Division (PMC) MRI, MRA, CT, and CTA Penn Medicine, University of Neuroradiology and Diagnostic Pennsylvania Radiology Presbyterian Medical Center, M.D., State University of New York at Philadelphia Buffalo,School of Medicine and Nephrology and Internal Medicine Biomedical Sciences Certified by the American Board of Internal Medicine Dr. Roberto Sanchez Associate Professor Dr. Bassey Benjamin Esu Department of Structural and Chemical B.Sc. Marketing; MBA Marketing; Ph.D Biology Marketing Mount Sinai School of Medicine Lecturer, Department of Marketing, Ph.D., The Rockefeller University University of Calabar Tourism Consultant, Cross River State Tourism Development Department Dr. Wen-Yih Sun Co-ordinator , Sustainable Tourism Professor of Earth and Atmospheric Initiative, Calabar, Nigeria SciencesPurdue University Director National Center for Typhoon and Dr. Aziz M. Barbar, Ph.D. Flooding Research, Taiwan IEEE Senior Member University Chair Professor Chairperson, Department of Computer Department of Atmospheric Sciences, Science National Central University, Chung-Li, AUST - American University of Science & TaiwanUniversity Chair Professor Technology Institute of Environmental Engineering, Alfred Naccash Avenue – Ashrafieh National Chiao Tung University, Hsin- chu, Taiwan.Ph.D., MS The University of Chicago, Geophysical Sciences BS National Taiwan University, Atmospheric Sciences Associate Professor of Radiology President Editor (HON.) Dr. George Perry, (Neuroscientist) Dean and Professor, College of Sciences Denham Harman Research Award (American Aging Association) ISI Highly Cited Researcher, Iberoamerican Molecular Biology Organization AAAS Fellow, Correspondent Member of Spanish Royal Academy of Sciences University of Texas at San Antonio Postdoctoral Fellow (Department of Cell Biology) Baylor College of Medicine Houston, Texas, United States Chief Author (HON.) Dr. R.K. Dixit M.Sc., Ph.D., FICCT Chief Author, India Email: [email protected] Dean & Editor-in-Chief (HON.) Vivek Dubey(HON.) Er. Suyog Dixit MS (Industrial Engineering), (M. Tech), BE (HONS. in CSE), FICCT MS (Mechanical Engineering) SAP Certified Consultant University of Wisconsin, FICCT CEO at IOSRD, GAOR & OSS Technical Dean, Global Journals Inc. (US) Editor-in-Chief, USA Website: www.suyogdixit.com [email protected] Email:[email protected] Sangita Dixit Pritesh Rajvaidya M.Sc., FICCT (MS) Computer Science Department Dean & Chancellor (Asia Pacific) California State University [email protected] BE (Computer Science), FICCT Suyash Dixit Technical Dean, USA (B.E., Computer Science Engineering), FICCTT Email: [email protected] President, Web Administration and Luis Galárraga Development , CEO at IOSRD J!Research Project Leader COO at GAOR & OSS Saarbrücken, Germany Contents of the Volume i. Copyright Notice ii.
Load more

Recommended publications
  • India-Pakistan Conflicts – Brief Timeline
    India-Pakistan Conflicts – Brief timeline Added to the above list, are Siachin glacier dispute (1984 beginning – 2003 ceasefire agreement), 2016- 17 Uri, Pathankot terror attacks, Balakot surginal strikes by India Indo-Pakistani War of 1947 The war, also called the First Kashmir War, started in October 1947 when Pakistan feared that the Maharaja of the princely state of Kashmir and Jammu would accede to India. Following partition, princely states were left to choose whether to join India or Pakistan or to remain independent. Jammu and Kashmir, the largest of the princely states, had a majority Muslim population and significant fraction of Hindu population, all ruled by the Hindu Maharaja Hari Singh. Tribal Islamic forces with support from the army of Pakistan attacked and occupied parts of the princely state forcing the Maharaja Pragnya IAS Academy +91 9880487071 www.pragnyaias.com Delhi, Hyderabad, Bangalore, Tirupati & Pune +91 9880486671 www.upsccivilservices.com to sign the Instrument of Accession of the princely state to the Dominion of India to receive Indian military aid. The UN Security Council passed Resolution 47 on 22 April 1948. The fronts solidified gradually along what came to be known as the Line of Control. A formal cease-fire was declared at 23:59 on the night of 1 January 1949. India gained control of about two-thirds of the state (Kashmir valley, Jammu and Ladakh) whereas Pakistan gained roughly a third of Kashmir (Azad Kashmir, and Gilgit–Baltistan). The Pakistan controlled areas are collectively referred to as Pakistan administered Kashmir. Pragnya IAS Academy +91 9880487071 www.pragnyaias.com Delhi, Hyderabad, Bangalore, Tirupati & Pune +91 9880486671 www.upsccivilservices.com Indo-Pakistani War of 1965: This war started following Pakistan's Operation Gibraltar, which was designed to infiltrate forces into Jammu and Kashmir to precipitate an insurgency against rule by India.
    [Show full text]
  • Pakistan's Rise to Nuclear Power and the Contribution of German Companies
    PRIF-Report No. 118 Pakistan's Rise to Nuclear Power and the Contribution of German Companies Klaus-Peter Ricke the Translation: Matthew Harris © Peace Research Institute Frankfurt (PRIF) 2013 Address: PRIF x Baseler Straße 27–31 x 60329 Frankfurt am Main, Germany Phone: +49 (0) 69 95 91 04–0 x Fax: +49 (0) 69 55 84 81 E-mail: [email protected] x Internet: www.prif.org ISBN: 978-3-942532-50-1 € 10.00 Summary The amendment of the Foreign Trade and Payments Act (Außenwirtschaftsgesetz) has prompted the preparation of this paper because of concerns over potential setbacks in advances achieved over the past twenty years in regulating German exports to non-EU countries and shipments to member states of the EU and the watering down of export restrictions to correspond to the low standards in place at the EU level (with the objective of streamlining the Foreign Trade and Payments Act and nullifying special German re- quirements which place German exporters at a disadvantage compared with their Euro- pean competitors, according to a spokesperson of the German Federal Ministry of Economics and Technology). This would send the wrong signal on combating prolifera- tion. From the 1970s to 1990s the Federal Republic of Germany played an extremely negative role because it opened the doors wide to the proliferation of weapons of mass destruction through lax legislation and even more slipshod enforcement. Alarmed by several scandals, in recent years the German government has taken the lead regarding this issue and it would be appropriate for it to continue to fulfill this role.
    [Show full text]
  • India-Pakistan Relations: the Story of Unsolved Conflicts
    ISSN: 2455-2631 © May 2017 IJSDR | Volume 2, Issue 5 INDIA-PAKISTAN RELATIONS: THE STORY OF UNSOLVED CONFLICTS Dr. Saroj Choudhary Assistant Professor ALS, Amity University Madhya Pradesh, Gwalior – 474005 INTRODUCTION Since, India became independent and divided by the British government the relationship between these two countries has been mostly unstable with ever growing distrust on each other. Both countries have fought wars in the South Asia region at different fronts and continue to face problems like border terrorist activities, infiltrations, low intensity wars and intelligence/spy operations that seem unstoppable as both will continue to consider each other as an untrustworthy enemy.1 It is seen that after the end of cold war, it has become one of the most dangerous and volatile regions in the international politics for which several reasons are responsible such as pre-independence hostility between the Muslim League and the Indian national Congress and bloodletting riots in post independence period at the time of partition. Moreover, disputes over waters flowing from India to Pakistan and finally, Kashmir which remains a subject of conflicts and bone of skirmishes between these two countries. However, there are many changes in the field of technology, global political economy and social networks took place particularly after the disintegration of Soviet Union. With this, the controversial and disappointing relationship between India and Pakistan has worsened as both have become nuclear states. In recent years, infiltration, proxy war and civilian attacks by Pakistan are increasing which is taking both states far away from the negotiation table. So many times, Pakistan took resort to International Organizations to solve the matters which in turn creates space for external powers as well.
    [Show full text]
  • Geology and Geophysics of the Foreland Fold-Thrust Belt of Northwestern Pakistan 1
    AN ABSTRACT OF THE THESIS OF James W. McDougall for the degree of Doctor of Philosophy in Geology presented on September 29. 1988 Title: Geology and Geophysics of the Foreland Fold-Thrust Belt of Northwestern Pakistan 1 Abstract approved: Robert S. Yeats Himalayan collision produced frontal and lateral ramps and associated Pliocene to Quaternary tectonic geomorphic features in the foreland fold-thrust belt of northwestern Pakistan. The transpressional right-lateral Kalabagh tear fault zone displaced the emergent Surghar Range frontal thrust from the western Salt Range by 16-19 km since 1.9-2.1 Ma: the age of youngest Siwalik molasse strata erosionally truncated during the southward advance of decollement thrusting. Folds and fanglomerate deposits resulting from decollement thrusting were also cut by the Kalabagh fault. North of the eastern Surghar Range, the N15W-trending Kalabagh fault bends to the west into north-dipping thrust faults that sole out beneath the southern Kohat Plateau. Foreland subsidence associated with the southward advance of thrusting controlled the distribution of Indus River conglomerates during the late Pliocene and Quaternary. Uplift in the northern Kalabagh fault zone diverted the Indus river eastward to its present course. South of the Main Boundary thrust (MBT) and west of the Indus River, decollement thrusting dominated by layer-parallel slip of as much as 32 km on a single thrust fault emplaced blind thrust sheets and fault-bend folds. Balanced cross sections show over 50% line-length shortening in sedimentary strata between the top of the basement and the base of the elastic wedge of the Murree and Kamlial formations and the Siwalik Group.
    [Show full text]
  • 247. Arsenic and Manganese Contamination of Groundwater in Punjab Plain, Pakistan
    ARSENIC AND MANGANESE CONTAMINATION OF GROUNDWATER IN PUNJAB PLAIN, PAKISTAN – EFFECTS OF WATER‐ROCK INTERACTION Mitsuo Yoshida1 and Mirza Naseer Ahmad2 E‐mail: [email protected] 1 Environmental Research Laboratory, International Network for Environmental and Humanitarian Cooperation (iNehc), Nonprofit Inc., Tokyo, Japan 2 Earth Science Department, Abdus Salam School of Sciences, Nusrat Jahan College, Rabwah, District Chiniot, Punjab, Pakistan INTRODUCTION: Punjab plain is the most populous province in Pakistan, as its population reaches more than 100 million, where is characterized by a semi-arid climate, and in most area, drinking water and agricultural water are obtained from groundwater wells. Due to rapid population growth and expansion of agricultural fields, there has been a drastic increase in groundwater exploitation resulting in lowering of water tables and deterioration of water quality. District Chiniot, north central part of Punjab plain is one of the typical areas where such deterioration of water quality is significant. In the District, the Kirana Hills are located which Source: Petroleum systems and hydrocarbon potential of the North‐West Himalaya exhibits a peculiar terrain of a series of Precambrian basement of India and Pakistan. ‐ Craig J. et al. (2018) rock masses sporadically exposed on the Punjab plain. Figure1: Thematic geologic cross section of the study zone (red-colored box) and its surroundings, middle-northern Pakistan. Table 1: Results of ICP-MS trace element analysis for groundwater samples GROUNDWATER QUALITY: Previous study reported that groundwater distributed around the Kirana Hills showed high electric conductivity (averaged EC = 4,584 μS/cm), high total dissolved solid (averaged TDS = 2,505 mg/l), and high hardness (averaged Hardness = 827 mg/l), and high salinity (Cl = 1,241 mg/l).
    [Show full text]
  • Provenance of Thal Desert Sand
    Revised Manuscript with Changes Marked 1 Provenance of Thal Desert sand: focused erosion in the western 1 2 Himalayan syntaxis and foreland-basin deposition driven by latest 3 4 Quaternary climate change 5 6 7 8 9 10 1* 1* 1 2 11 Eduardo Garzanti , Wendong Liang , Sergio Andò , Peter D. Clift , Alberto 12 1 3 1 13 Resentini , Pieter Vermeesch , Giovanni Vezzoli . 14 15 16 17 1 18 Laboratory for Provenance Studies, Department of Earth and Environmental Sciences, 19 20 University of Milano-Bicocca, Milano 20126, Italy 21 2 Department of Geology and Geophysics, Louisiana State University, Baton Rouge, LA 70803, 22 23 USA 24 25 3London Geochronology Centre, Department of Earth Sciences, University College London, 26 27 London, C1E 6BT, UK 28 29 30 * Corresponding authors (e-mail: [email protected] and [email protected]) 31 32 33 34 Keywords: Sand petrography and geochemistry; Detrital-zircon geochronology; Variability of 35 Nd values; Focused erosion; Himalaya-Karakorum; Kohistan Arc; Indus River, Delta, and Fan. 36 37 38 39 Highlights: 40 41 The Thal Desert is an inland archive of Indus sand from the western Himalaya syntaxis 42 43 44 Sand stored in the Thal dunefield reveals major detrital supply from the Kohistan arc 45 46 High variability of Nd values is controlled by minimal changes in monazite content 47 48 49 The Thal Desert formed in a dry landscape between the LGM and the wet early Holocene 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 2 Abstract 1 2 3 4 As a latest Pleistocene repository of Indus River sand at the entry point to the Himalayan foreland 5 6 basin, the Thal dune field in northern Pakistan stores crucial information that can be used to 7 8 9 reconstruct the erosional evolution of the Himalayan-Karakorum orogen and the changes in the 10 11 foreland-basin landscape that took place between the Last Glacial Maximum and the early Holocene.
    [Show full text]
  • Reclamation by Tubewell Drainage in Rechna Doab and Adjacent Areas, Punjab Region, Pakistan
    Reclamation by Tubewell Drainage in Rechna Doab and Adjacent Areas, Punjab Region, Pakistan By GLENN T. MALMBERG CONTRIBUTIONS TO THE HYDROLOGY OF ASIA ANE OCEANIA GEOLOGICAL SURVEY WATER-SUPPLY PAPER 1608-O Prepared in cooperation with the West Pakistan Water and Power Development Authority under the auspices of the United States Agency for International Development UNITED STATES GOVERNMENT PRINTING OFFICE, WASHI1 TGTON : 1975 UNITED STATES DEPARTMENT OF THE INTERIOR STANLEY K. HATHAWAY, Secretary GEOLOGICAL SURVEY V. E. McKelvey, Director Library of Congress Cataloging in Publication Data Malmberg, Glenn Thomas, 1952- Reclamation by tubewell drainage in Rechna Doab and adjacent areas, Pun­ jab region, Pakistan. (Contributions to the hydrology of Asia and Oceania) (Geological Survey water-supply paper; 1608-O) "Prepared in cooperation with the West Pakistan Water and Power Develop­ ment Authority under the auspices of the United States Agency for Inter­ national Development." Bibliography: p. Includes index. Supt. of Docs, no.: I 19.13:1608-0 1. Drainage Pakistan Rechna Doab. 2. Wells Pakistan Rechna Doab. I. West Pakistan. Water and Power Development Authority. II. Title. III. Series. IV. Series: United States. Geological Survey. Water-supply paper; 1608-0. TC801.U2 no. 1608-0 [TC978.P32] 627'.08s [631.6'2'0954914] 74-20536 For sale by the Superintendent of Documents, U.S. Government Printing Office Washington, D.C. 20402 Stock Number 024-001-02634-3 CONTENTS Page Abstract ______________________________________ Ol Introduction ____________________________ 2 Purpose and scope of the hydrologic monitoring program ____ 7 Acknowledgments _____________.__________ 8 General features of the area _________________________ 9 Water resource development _______________________ 11 Ground water _________________________________.
    [Show full text]
  • Nuclear Proliferation International and Regional Challenges for Pakistan and Iran
    NUCLEAR PROLIFERATION INTERNATIONAL AND REGIONAL CHALLENGES FOR PAKISTAN AND IRAN A DOCTORAL DISSERTATION By M. UMAIR RAFIQUE DEPARTMENT OF POLITICAL SCIENCE UNIVERSITY OF KARACHI KARACHI – PAKISTAN 2014 NUCLEAR PROLIFERATION INTERNATIONAL AND REGIONAL CHALLENGES FOR PAKISTAN AND IRAN A DISSERTATION SUBMITTED TO THE UNIVERSITY OF KARACHI IN FULFILLMENT OF THE REQUIREMENTS FOR THE DEGREE OF DOCTOR OF PHILOSOPHY IN POLITICAL SCIENCE By M. UMAIR RAFIQUE UNDER THE SUPERVISION OF PROF. DR. TANWEER KHALID DEPARTMENT OF POLITICAL SCIENCE UNIVERSITY OF KARACHI KARACHI – PAKISTAN 2014 CERTIFICATE Certified that Mr. Muhammad Umair Rafique S/O Rafique Ahmed has written this thesis titled, “Nuclear Proliferation: International and Regional Challenges for Pakistan and Iran” from Department of Political Science, University of Karachi towards the fulfillment of the requirement of Ph.D. degree. To the best of my knowledge the dissertation is based on original research. Prof. Dr. Tanweer Khalid Research Supervisor Department of Political Science University of Karachi DEDICATED TO MY PARENTS MIAN RAFIQUE AHMED & TANWEER KAUSAR Thank you for your appreciation and love without your support I wouldn't have been able to acquire this milestone TABLE OF CONTENTS Page No TABLE OF CONTENT………………………………………………………... i-x LIST OF TABLES……………………………………………………………... Xi ACNOWLEDGMENT………………………………………………………… Xii ABSTRACT……………………………………………………………….......... xiii-xiv INTRODUCTION……………………………………………………………… 1-8 CHPTER: 1 1. NUCLEAR PROLIFERATION: A STRATEGY FOR POWER………. 9-10 1.1. NUCLEAR WEAPONS: POTENTIAL AND IMPACT……………. 10-12 1.2. EVOLUTION OF NUCLEARIZATION……………………………. 12-13 1.3. HORIZONTAL PROLIFERATION………………………………… 13-15 1.4. VERTICAL PROLIFERATION…………………………………….. 15-16 1.5. THEORIZING OF NUCLEAR PROLIFERATION……………….. 16 1.5.1. LIBERAL THEORY ON NUCLEAR PROLIFERATION 16 1.5.2.
    [Show full text]
  • Engineering and Petrographic Properties of Meta Dolerite Aggregates of Kirana Hills of Sargodha, Punjab, Pakistan
    Journal of Himalayan Earth Sciences Volume 54, No. 1, 2021 pp. 1-10 Engineering and petrographic properties of meta dolerite aggregates of Kirana Hills of Sargodha, Punjab, Pakistan Muhammad Nawaz Chaudhry1*, Muzaffar Majid2, and Uzma Ashraf1 1Department of Environmental Sciences and Policy, Lahore School of Economics, Lahore 2College of Earth and Environmental Sciences, University of the Punjab, Lahore *Corresponding author's email: [email protected] Submitted date: 21/02/2017 Accepted date: 24/02/2021 Published online: 31/03/2021 Abstract Kirana, Rabwa and Chiniot areas of the Punjab province, Pakistan has a number of isolated hills jutting out of a flat alluvial plain. These rocks are Upper Proterozoic in age. The exposed volcano-sedimentary sequence is slightly metamorphosed (lower greenschist facies). The dolerites have also undergone auto metasomatic changes. The Kirana Hills are the main resource of aggregate in southern and middle Punjab. These aggregates are used in subbase, base course, in rail ballast, as riprap and for the cement and asphalt concrete. The main lithologies in Kirana Hills are dolerites and rhyolites, lithic greywackes, volcanogenic slates and quartz wackes. This paper deals only with the dolerites and their petrographic composition and engineering properties, as well as adhesion values. The variably auto metasomatized dolerites are now composed of variable amounts of plagioclase, chlorite, calcite and amphibole with quartz, magnetite, hydro mica, K-feldspar, epidote and sphene as subordinate to accessory minerals. Flakiness, Elongation, Specific Gravity, Water Absorption, Soundness, Los Angeles, Aggregate Crushing, Aggregate Impact and Adhesion Values are all within ASTM limits. Therefore, the dolerite aggregates of Kirana area have excellent Engineering Properties.
    [Show full text]
  • Pakistan's Nuclear Policy and Its Impact on India's National Security
    International Journal of Engineering and Management Research, Vol. 2, Issue-2, April 2012 ISSN No.: 2250-0758 Pages: 35-37 www.ijemr.net Pakistan’s Nuclear Policy and Its Impact on India’s National Security Dr. Yatish Prasad Assistant Professor, Department of Military Science, Govt. P.G. College Gopeshwar (Chamoli), INDIA ABSTRACT Pakistan also received assistance from states, Pakistan asserts the origin of its nuclear power especially China. Beginning in the late 1970s Beijing programmes lies in its adversarial relationship with India. provided Islamabad with various levels of nuclear and Initially steps toward the development of Pakistan’s nuclear missile related assistances, including centrifuge equipment, programme date to the late 1950s, including with the warhead designs, HEU, components of various missile establishment of the Pakistan Atomic Energy Commission systems and technical expertise. (PACE) in 1956. President Z.A. Bhutto Force fully Advocated the nuclear option and famously said in 1965 that Eventually from the 1980s onwards, the Khan “If India builds the bomb, we will eat grass or network diversified. Its activities and illicitly transferred leaves, ever go hungry but we will get one of our own”. nuclear technology and expertise to Iran. North Korea and Libya. The Khan network was officially dismantled in Keywords-- Nuclear Policy, India, Pakistan, National 2004, although questions still remain concerning the extent Security of the Pakistani political and military establishment’s involvement in the network’s activities. I. INTRODUCTION Pakistan Atomic Energy Commission popularly known as PAEC, is an administrative, governmental and After December 1971 defeat in the conflict with autonomous science and technology research institution, India, Bhutto issued a directive instructing the country’s responsible for the development of nuclear power sector in nuclear establishment to build a nuclear detonation of a Pakistan.
    [Show full text]
  • Riparian Rights: a Case Study of India and Pakistan
    RIPARIAN RIGHTS: A CASE STUDY OF INDIA AND PAKISTAN By Muhammad Nawaz Roll No. PKS-08-03 Supervised By Prof. Dr. Muhammad Farooq A thesis submitted in fulfilment of the requirement for the Degree of Doctor of Philosophy in Pakistan Studies Department of Pakistan Studies, Bahauddin Zakariya University, Multan, Pakistan Dedicated to My Parents ii Abstract Fresh water is vital to the economies and societies of countries, especially to those which lie in the arid climatic regions. The issue of water scarcity in certain regions of the world has led to an expectation of international conflict based upon the increasing competition for fresh water. One example is the confrontation between India and Pakistan over shared waters of the Indus River System. This study aims to enhance our understanding regarding the Indus Water dispute. Immediately, after the partition of Indian sub-continent into two independent and sovereign states of India and Pakistan in 1947, water became a focal point between the two nations. Being an upper riparian and having the control of headworks, India stopped water into all canals flowing into Pakistan. This action made Pakistan more conscious about its water rights because the Indus River System is source of life for Pakistan. In this context, this study traces the origin of water dispute between Pakistan and India from the partition of the Punjab. It further explores how water dispute was settled under the auspices of the World Bank and Indus Water Treaty was signed in 1960. It also provides a detailed picture of consequent developments of water infrastructure in the region and emerging challenges to Indus Water Treaty.
    [Show full text]
  • Petrography and Mineralogy of Dolerites of Hachi Volcanics, Kirana Hills Area, Pakistan
    55 Geol. Bull. Punjab Univ. 44, 2009. PETROGRAPHY AND MINERALOGY OF DOLERITES OF HACHI VOLCANICS, KIRANA HILLS AREA, PAKISTAN BY ZAHID KARIM KHAN, NAVEED AHSAN Institute of Geology, University of the Punjab, Quaid-i-Azam Campus, Lahore-54590 Pakistan ABDUL MATEEN Department of Environmental Sciences, COMSATS Institute of Information Technology, Abbottabad, Pakistan AND MUHAMMAD NAWAZ CHAUDHRY College of Earth and Environmental Sciences, University of the Punjab, Lahore, Pakistan Abstract: The Kirana Hills outcrop in the Punjab plains and represent remnants of the widespread Precambrian igneous activity within the Kirana-Malani basin of NE Gondwana. These volcanics comprise mainly of mafic and felsic rocks belonging to the tholeiitic basalt-rhyolite magma association with intercalated meta-sediments. Present study deals with petrography and mineralogy of the dolerites from the Hachi volcanics representing Precambrian bimodal volcanism. The dolerites suffered hydrothermal alteration and low-grade metamorphism. Electron-microprobe analyses were carried out of plagioclase, pyroxene, amphibole, chlorite, epidote, opaque oxides and calcite. Petrography and compositional variations of mineral phases are discussed in terms of metamorphic and hydrothermal alteration, igneous differentiation and temperature - pressure estimations. INTRODUCTION in two distinct petrotectonic environments and represent two distinct petrotectonic assemblages (Ahmad et al., The Kirana Hills volcanics, Neoproterozoic in age, 2000). represent isolated outcrops of volcanic and sedimentary rocks scattered in the Punjab plain areas from Chiniot to The Hachi Group is comprised of volcanics that Sargodha (Shah, 1977). The volcanics are the remnants of contain felsic and mafic volcanics. Felsic volcanics are the widespread Precambrian igneous activity within the composed of andesites, dacites, dacitic tuff, rhyolites and Kirana-Malani basin of NE Gondwana (Chaudhry et al., rhyolitic tuff and mafic volcanics are comprised of dolerites 1991).
    [Show full text]