WEEK OF JUNE 4-10, 2020 www.FloridaWeekly.com Vol. X, No. 31 • FREE

Emmy-winning Florida filmmaker’s latest creative venture is also a vehicle to accomplish good. At Home Feathering our nests in these troubled times. A14 X

PHOTO BY MILA BRIDGER; ILLUSTRATION BY ERIC RADDATZ / FLORIDA WEEKLY BY ERIC RADDATZ PHOTO BY MILA BRIDGER; ILLUSTRATION Peace X is his John Biffar

BY ROGER WILLIAMS rwilliams@fl oridaweekly.com

OHN BIFFAR HAD TO ASCEND, BUT with little time left to do it. Spike Lee’s newest Old story in a new body: His “Da 5 Bloods” and more films J oxygen tank was running dry, fresh to stream. A22 X leaving him airless far below the surface of the Atlantic off Cape Verde, 350 miles east of the Sen- egalese coast of Africa. To compound the problem, Long John, as they call him, had been filming in a cave. And, at 6 feet, 7 inches and about 250 pounds, his body requires a lot of oxygen. “It was the last dive of the trip and I wanted to get as much

SEE PEACE, A10 X Staying focused Lacking self-discipline? Here are five ways to develop it and reach your goals. A16 X

Collector’s Corner The eyes have it with this doll. A wave of ‘Build for Rent’ communities coming to South Florida A23 X BY EVAN WILLIAMS portfolio in Charlotte County for $5.7 mil- ewilliams@fl oridaweekly.com lion, a 63-home portfolio in Fort Myers for $20.2 million, and a 72-home portfolio in With growing demand expected for Cape Coral for $15.1 million, among other rentals, companies are looking to South BFR developments in Florida and the Florida and other parts of the U.S. to cash United States. in on the trend of “Build for Rent” hous- Developers such as Toll Brothers, Neal Download ing — single-family homes developed in COURTESY RENDERING Communities, and ERC Homebuilders are our FREE groups for the purpose of being rented out SVN | SFRhub Advisors is offering “Build for all growing BFR portfolios as well. Rent” housing communities in South Florida. App today instead of sold. “Build for Rent” can apply to a com- A Phoenix, Ariz.-based commercial real pany that builds or manages a whole Available on estate brokerage that specializes in selling Build for Rent (BFR) communities, SVN the iTunes and | SFRhub Advisors is offering a 25-home SEE RENT, A16 X Android App Store.

B4>B4<“4\PX[

Introducing... HOUSE of SCALAMANDRÉ FURNITURE SHOWROOM & WORKROOM AMERICAN BENCH MADE | 8 WEEK DELIVERY | LIFETIME GUARANTEE | 1,000’S OF FABRIC OPTIONS 535 24th Street | WPB Visit our Showroom or Shop Online at MacFabrics.com 561.833.7000 The Center for Spinal Disorders at Nicklaus Children’s provides compassionate care centered around patients and their families. That’s one reason we are among one of the most successful programs in the nation for treating spinal disorders in children and teens. Our expert team of spine specialists have been HMƦTDMSH@KHMSGDCDUDKNOLDMSNERNLDNESGDK@SDRS@MCLNRS innovative techniques in spine and scoliosis surgery.

Our number one priority is the safety and well-being of our patients and their families. We have implemented additional safety precautions, such as arrival screenings and physical distancing measures in the waiting rooms. For parents who wish to make arrangements for their child to see their physician virtually, telehealth options may also be available. For more LQIRUPDWLRQDQGWRƩQGDVHUYLFHORFDWLRQQHDU\RXSOHDVHFDOO 786-624-2225 (BACK) or visit nicklauschildrens.org/spine

Services Available at:

Nicklaus Children’s Hospital Nicklaus Children’s Aventura Care Center Nicklaus Children’s Pediatric Specialists at Coconut Creek Nicklaus Children’s Miramar Outpatient Center Nicklaus Children’s Palm Beach Gardens Outpatient Center Nicklaus Children’s West Kendall Outpatient Center

Nicklaus Children’s Palm Beach Gardens Outpatient Center 11310 Legacy Avenue (Legacy Place) Palm Beach Gardens, FL 33410 561-624-9188 nicklauschildrens.org/spine

Nicklaus-1937 – Florida Weekly – June Ortho Ad_FINAL.indd 1 6/1/2020 12:58:57 PM A4 NEWS WEEK OF JUNE 4-10, 2020 www.FloridaWeekly.com PALM BEACH FLORIDA WEEKLY The D-Day pilot and the flight nurse BY STEPHEN PEDONE LT. COL., USAF, RET. Special to Florida Weekly

Late on the evening of June 5, 1944, two brave young Americans were poised for the greatest challenge of their lives. Both “answered the call” to military service and represent the thousands of others from America’s greatest genera- tion who were in harm’s way on D-Day — June 6, 1944 — the Allied invasion of Normandy, France in Operation Over- lord during World War II. They were my parents, and I am their only son, Lt. Col. Stephen Pedone, USAF, from Naples. My dad was Capt. Vito Pedone, and my mother was First Lieu- tenant Geraldine “Jerry” Curtis, both officers in the U.S. Army Air Force, stationed in England early in the war. My dad, “The Pilot,” was the co-pilot of the lead 9th Air Force Pathfinder Troop Carrier C-47, dropping the first “stick” of 101st Airborne Pathfinder Paratroopers into Drop Zone “A” behind Utah Beach at 0013 hours, June 6, 1944. My mom, “The Flight Nurse,” flew into the Nor- mandy combat area in the same C-47s on June 10, 1944, to care for and evacuate by air the severely wounded soldiers back to hospitals in England. My parents’ story is one of duty, brav- ery and determination in the face of danger, to execute the planned Nor- mandy D-Day Invasion. They were part of the D-Day Airborne Invasion forces that crossed the English Channel to go in first, as the “tip of the spear” to defeat Nazi tyranny and free Europe. They were very successful. Amid all the wartime preparation and danger, theirs is also a love story, and their story begins in 1943, while both were stationed in England preparing for D-Day. My dad arrived in England first, in 1942, and flew 25 8th Air Force combat missions in the single-pilot, twin engine A-20 light bomber attacking Nazi coastal PHOTOS COURTESY OF STEPHEN PEDONE Above: Vito Pedone, standing far right, was the co-pilot of the lead Above: Pictured with an unidentified fellow flight nurse, 1st Lt. targets. In early 1943, he transferred to 9th Air Force Pathfinder Troop C-47, dropping the first “stick” of Jerry Curtis, right, flew into the Normandy combat area on June 10, the newly activated Troop Carrier Path- 101st Airborne Pathfinder Paratroopers behind Utah Beach on 1944, to medically evacuate by air severely wounded soldiers back finder unit to fly C-47s. My mother fol- D-Day, June 6, 1944. to hospitals in England. lowed in early 1943. Although stationed on different bases, they had a common Top: First Lieutenant Geraldine “Jerry” Curtis, a nurse, and Captain Vito Pedone, a pilot, were officers in the U.S. Army Air Force, stationed mission — to fly into combat in C-47s, in England early in WWII. They married in England in 1943 and later participated in the Normandy D-Day invasion in 1944. on D-Day. They met and later married in England, in September 1943. Like so They proceeded inland on the des- their mission. ultimate “Victory in Europe” on May 8, many Americans from different parts ignated navigation heading to the drop My mother’s Medical Air Evacua- 1945. My dad and mom played an impor- of the country, they likely would have zones. The Germans, hearing the sound tion C-47 missions began four days after tant part in our WWII victory, and their never met had it not been for WWII, of the C-47 engines, began to fire into D-Day, on June 10, 1944, when combat story of military service would continue. which brought them together to do a the night’s sky. As my dad’s aircraft conditions were relatively secure enough My dad rose to the rank of colonel dur- tough and dangerous job for our country. approached Drop Zone “A” behind for the first aircraft with a flight nurse ing a distinguished 30-year career in Through the military build-up of inva- Utah Beach, the clouds parted just long on-board to land on dirt fields near the U.S. Air Force, and participated in sion forces during 1943 to mid-’44, my enough for him to visually confirm the the Normandy combat area. The air- many other important moments in our dad and mom planned, prepared and location and the “green jump light” was craft brought urgently needed supplies, nation’s history. My parents’ story ends trained to be ready to execute their turned-on to signal the paratroopers to which were quickly unloaded, so that 14 at a very special place in our nation, D-Day missions. The key lesson learned jump. It was 0013 hours, June 6, 1944. wounded soldiers on stretchers could be Arlington National Cemetery, where from previous airborne assaults, like in The first American forces were on the quickly loaded and stacked three-high they lie together for eternity. There is no Sicily, was that especially trained “Path- ground in Normandy. on side-mounted stretcher straps. The greater honor. finder” C-47 aircrews and paratroopers Once on the ground, their mission was aircraft were the actual C-47s used dur- Last June, to honor my parents and all were essential to lead the way, to find to mark the seven drop zones for the ing the D-Day air assault, and were not who served in WWII, my wife, Xime- and mark the correct drop zones, to follow-on main body of 821 C-47 Troop marked with red crosses. They were on na, and I attended the 75th anniversary ensure successful deployment of all the Carrier aircraft, led by the C-47 “That’s the ground briefly before taking off to D-Day commemorative ceremonies in paratroopers. All Brother,” which were approximate- return over the channel and hospitals in England and Normandy. My dad’s C-47 would lead the tight ly 30 minutes behind the Pathfinders. England. The flight nurse was responsible My parents’ story endures in our his- formation of 20 Pathfinder aircraft, each These C-47s would drop thousands of to care for the wounded soldiers during tory, reflecting our “Greatest Genera- with 18 paratroopers, low across the 101st and 82nd Airborne paratroopers the flight — keeping them alive. My mom tion,” which left a legacy of service and English Channel in total darkness. As the into their specific Normandy drop zones. helped to save many lives and proved the sacrifice to our nation and the world in Pathfinders approached the Normandy Upon landing back in England, my dad worth of air medical evacuation. a terrible time of war, thus securing our coast, a thick bank of clouds obscured and the other pilot were ordered to per- The D-Day “Operation Overlord” air freedom. the sky and view of the ground, which sonally report directly to General Eisen- and sea invasion was a total success, I am forever grateful to them, and made formation flying very dangerous. hower to provide a first-hand account of and marked the beginning of the road to will never forget them. ■

Download Publisher Production Manager Cindy Giles Alisa Bowman our FREE [email protected] [email protected] App today Editor Operations Manager Scott Simmons Kelli Carico Available on [email protected] [email protected] the iTunes and Published by Florida Media Group LLC Presentation Editor Advertising Operations Manager Android App Store. Palm Beach Florida Weekly Eric Raddatz Megan Roberts 1224 US Highway 1, Suite A [email protected] [email protected] Copyright: The contentsco of the Florida Weekly North Palm Beach, FL 33408 are copyright 20172020 by Florida Media Group, LLC. No portionortion may be reproduced without the express Phone: 561.904.6470 • Fax: 561.904.6456 writtentten consent of Florida Media Group, LLC. FLORIDA WEEKLY WEEK OF JUNE 4-10, 2020 A5 GENERATOR DID YOU KNOW? SPECIALIST The father of modern refrigeration NEVER BE WITHOUT was from the Sunshine State POWER Let us pause for a moment and sweat the details. If you like air conditioning, thank John Gorrie. Were it not for Dr. Gorrie, you might not be sitting in Florida reading this bit of history. That’s because Dr. Gorrie, a resident of Apalachicola in the state’s Panhandle, was the creator of mechanical refrigeration, without which all of us in Florida probably would be melting somplace up North. Dr. Gorrie applied for a patent for his ice machine, which condensed gases, in 1848, three years after Florida became a state. That April, he had a machine fabri- cated at the Cincinnati Iron Works, and in October, he demonstrated its operation. It was described in the Scientific American in September of 1849, according to the John Gorrie Museum and the Apalachicola FREE Area Historical Society. Dr. Gorrie hoped ice made by the machine could be used to ESTIMATES! cool the rooms and the fevers of yellow fever patients. The machine produced ice in quantities, $500 OFF Includes:Includes: GeneratorGenerator,, PermitsPermits,, DeDelivery,lil very, ElElectricallecttriicall & GGasasas IInstallationnssttaalllatatiion but leakage and irregular performance The Purchase of Any Fully Automatic, Runs on Propane or Natural Gas. frequently impaired its operation. The Home Standby Generator good doctor went to New Orleans to Expires 6/30/20 seek venture capital to market the device, but either problems in product demand ARCHITECT OF THE CAPITOL Generator Service and operation, or the opposition of the John Gorrie is commemorated in the U.S. Agreement ice lobby, discouraged backers, historians Capitol Building’s National Statuary Hall Col- Starting at $289 per year lection in Washington, D.C. Includes complete oil change & filter, check say. He never realized any return from baery & fluids, inspect air filter, check amps & Licensed & Insured EC13006279 his invention, according to the historical voltage, test generator, wash & wax generator, plus 2 inspections per year. Special price with SERVING THE EAST COAST OF FLORIDA society, and he died in 1855 at the age of 52. A replica of his ice machine is on dis- this coupon. Expires 6/30/20. Dr. Gorrie’s statue is part of the Nation- play at the John Gorrie State Park. Info: ENERGIZEDGENERATORS.COM al Statuary Hall Collection at the U.S. www.floridastateparks.org/parks-and- Palm Beach Treasure Coast Capitol in Washington, D.C. trails/john-gorrie-museum-state-park. ■ 561-342-5815 772-261-9341 A6 NEWS WEEK OF JUNE 4-10, 2020 www.FloridaWeekly.com PALM BEACH FLORIDA WEEKLY NEWS OF THE WEIRD BY THE EDITORS AT ANDREW MCMEEL Distributed by Universal Press Syndicate Government in action Oh, Florida In 2013, Chad Dearth of Overland number on a commercial semi-truck Police in Miramar are still trying to ing areas of the school, the Miami Herald Park, Kan., purchased his dream car, — the one photographed by one of identify a man who was caught on sur- reported — all while stark naked, except a 1964 Chevy Impala, and got an the authorities demanding payment veillance video ransacking Miramar High for headphones. School officials put the “antique” license plate for it. Since for toll violations. Lee Ann Phelps, School on May 25. The suspect spent cost of the damages at about $100,000. then, he has sold the car and moved to vehicle services manager for the Kan- nearly 24 hours destroying computers, a new neighborhood, but earlier this sas Department of Revenue, told Fox4 painting graffiti on the walls and flood- year he received word that seven to she doesn’t know why the state uses 10 collection letters a day were arriv- identical numbers, but there are about ing at his old address from state turn- 625,000 plates in the state that share The allure of junk food pike authorities up and down the East a number. Kansas has issued a new ■ San Diego police responding to a bur- Zach Morris was cleaning up storm dam- Coast. That’s when Dearth learned that license for the truck, but in the mean- glar alarm at a Wells Fargo bank in Chol- age in Wynne, Ark., at the city’s sports Kansas is one of a few states that assign time, the bills continue. Dearth most las View, Calif., around 3:30 a.m. on May complex on May 24 when he noticed that identical numbers to different catego- recently got a letter from the Delaware 27, found a broken window by the bank’s someone had broken into the concession ries of specialty license plates, and his Turnpike Authority seeking $479. drive-through. Alarm company personnel stand. “The whole place was just looted,” old antique plate number matched the told officers surveillance cameras showed Morris told WREG. The stand had been a man inside the bank’s break room, using fully stocked for games scheduled before the microwave. Police gained entry to the COVID-19 lockdowns began, and thieves Monkey business bank and arrested the unnamed man, who helped themselves to drinks and candy, Egyptian talk show host Lobna Asal starred with El-Samman on his latest told KGTV he had gone into the bank even taking the time to prepare nachos abruptly fled the studio mid-interview project, and at first settled in Asal’s lap only to warm up his Hot Pockets. Asked and popcorn before they left. Police are on May 27 after being attacked by for several minutes, calmly listening if the Hot Pockets were worth the arrest, hoping the culprits will confess. “The the monkey brought to the set by to the conversation, but then jumped the man said, “Hell yeah it was worth it.” right thing to do is take responsibility for her interview subject, actor Ibrahim down and attacked her legs. As she ran ■ City Parks and Recreation employee the mistakes you made,” Morris said. El-Samman, United Press Internation- off, another person arrived to wrangle al reported. Appearing on Egyptian the primate. channel Al Hayat, the monkey co- Green eggs, no ham A.K. Shihabudheen of Malappuram, a few have started to lay eggs and those India, and his wife cracked an egg from yolks are also green in color.” The eggs Another job threatened one of their chickens about nine months taste like other eggs and cause no health Massachusetts-based Boston Dynam- be controlled remotely as it guides sheep ago and were surprised to see a dark problems, the family said. Experts from ics has partnered with the New Zealand through mountainous and difficult terrain, green yolk, rather than the standard Kerala Veterinary and Animal Sciences robotics company Rocos to develop a according to the company. “It just needs yellow. “All the eggs which the hen laid University suspect the feed given to the robotic dog, Spot, to herd sheep. “The to walk with intent toward the sheep ... were this kind,” Shihabudheen told birds may be behind the phenomenon, age of autonomous robots is upon us,” and they seem to respond,” said Richard The News Minute, “and so we started according to Dr. S. Sankaralingam, but Rocos chief executive David Inggs told Stinear, Rocos chief technology officer. In to incubate the eggs. Out of the six Shihabudheen says he gives all his birds United Press International. The dog can other words, they act like sheep. chicks which hatched from these eggs, the same feed. ■

Our 5-star commitment to you: HMO plans with Medicare’s highest rating

Helping you get through these tough times is our 5-star commitment to you. In addition to our outstanding customer service, accurate pricing and patient safety, and comprehensive network of doctors and hospitals, QWTUVCT/GFKECTG#FXCPVCIG*/1RNCPUJCXGVJGDGPGƂVU[QWPGGFVQJGNRMGGR[QWCV[QWTJGCNVJKGUV First-rate benefits you can expect to receive:

• $0 plan premium and copay for primary care doctor visits • $5,000 out-of-pocket maximum • $0 copay for additional dental coverage • Additional vision and hearing coverage • $0 copay for Tier 1 prescription drugs at preferred retail pharmacies •SilverSneakers®ƂVPGUURTQITCO

/GFKECTGWUGUCUVCTSWCNKV[U[UVGO QPGUVCTDGKPIVJGNQYGUVCPFƂXGDGKPIVJGJKIJGUV VQTCVGJGCNVJCPF prescription drug plans. Florida Blue Medicare HMO plans have received a 5-star rating two years in a row— and that means quality for you.

Switch to a 5-star Medicare HMO plan today. Call 1-888-514-1331 (TTY: 1-800-955-8770) or visit us online at ƃQTKFCDNWGOGFKECTGEQOUGTXKEG to explore your options.

'XGT[[GCT/GFKECTGGXCNWCVGURNCPUDCUGFQPCUVCTTCVKPIU[UVGO#RRNKECDNGVQCPF*/1RNCPU#NNDGPGƂVUNKUVGFPQVCXCKNCDNGKPCNNRNCPU(NQTKFC$NWG/GFKECTGKUCP*/1RNCPYKVJC/GFKECTGEQPVTCEV 'PTQNNOGPVKP(NQTKFC$NWG/GFKECTGFGRGPFUQPEQPVTCEVTGPGYCN*/1EQXGTCIGKUQHHGTGFD[(NQTKFC$NWG/GFKECTG+PE&$#(NQTKFC$NWG/GFKECTGCP+PFGRGPFGPVQHVJG$NWG%TQUUCPF$NWG5JKGNF#UUQEKCVKQP 6KXKV[*GCNVJCPF5KNXGT5PGCMGTUCTGTGIKUVGTGFVTCFGOCTMUQTVTCFGOCTMUQH6KXKV[*GCNVJ+PECPFQTKVUUWDUKFKCTKGUCPFQTCHƂNKCVGUKPVJG75#CPFQTQVJGTEQWPVTKGU1WVQHRQEMGVOCZKOWOCRRNKGUVQ/GFKECTG 2CTVU#CPF$EQXGTGFUGTXKEGU9GEQORN[YKVJCRRNKECDNG(GFGTCNEKXKNTKIJVUNCYUCPFFQPQVFKUETKOKPCVGQPVJGDCUKUQHTCEGEQNQTPCVKQPCNQTKIKPCIGFKUCDKNKV[QTIGPFGT#6'0%+¯05KJCDNCGURCÍQNVKGPGCUW FKURQUKEKÏPUGTXKEKQUITCVWKVQUFGCUKUVGPEKCNKPIØÉUVKEC.NCOGCN 66; #6#05;105KYRCNG-TG[ÎN#[KU[GPIGPUÄXKUÄFRQWNCPIMKFKURQPKDITCVKURQWQW4GNG 66;   $NWG%TQUUCPF$NWG5JKGNFQH(NQTKFC+PE&$#(NQTKFC$NWG#NNTKIJVUTGUGTXGF (9% ;AA/%/5#EEGRVGF PALM BEACH FLORIDA WEEKLY www.FloridaWeekly.com WEEK OF JUNE 4-10, 2020 NEWS A7 Community Foundation awards over $1 million in scholarships

The Community Foundation for Palm application, academic resume, essays als, including creating and editing videos. School, received three scholarships total- Beach and Martin Counties recently grant- and interviews. She plans to pursue a bachelor’s degree in ing $22,000 to attend Florida State Uni- ed over $1 million in scholarships to 88 Among the standouts were: marketing and an MBA. Her younger sister versity. The Belle Glade resident is a first local students through a competitive pro- Alondra Bravo, Palm Beach Central High has Prader-Willi Syndrome and has left the generation American, whose parents immi- cess. The average award is over $11,000 School, who received a $10,000 scholarship family with high medical bills. grated from Haiti. She was in the Top 10 of each for students from Palm Beach and to attend the University of Central Florida. Sebastian Fernandez, Dreyfoos School the class and has been very involved in the Martin counties. The Royal Palm Beach resident has con- of the Arts, received a $10,000 scholarship local community. “The Community Foundation is thank- tributed to the community through com- to attend Dartmouth College to study envi- The organization has awarded over $15 ful to our generous donors and fundhold- munity service initiatives and also worked ronmental journalism. He is a Royal Palm million in scholarship grants since 1983, ers who make these scholarship awards at Publix during the COVID-19 pandemic. Beach resident. and helped over 2,400 students. possible,” Brad Hurlburt, president and Paige Kercheville, Seminole Ridge High Shanice Lodge, Jupiter High School, The foundation manages 100 scholar- CEO of the Community Foundation, said in School, who received a $10,000 scholarship received two scholarships totaling ship funds established by donors who are a statement. “Their investment in the edu- to attend Florida College. She graduated $10,000 to attend Florida State University. committed to education, and often named cation of our young people has impacted Top 5 in her class and started her own mar- The Jupiter resident was involved in the in the memory of a loved one. each student’s future.” keting company called MarketAura. The school theater program, volunteered with For more information on the program, Students are evaluated by an advisory Royal Palm Beach resident has an Adobe environmental programs and worked at or about establishing a charitable fund, call committee of board members and com- certification and has helped nonprofits and Publix during the COVID-19 crisis. 561-659-6800 or visit www.yourcommunity munity volunteers based on a formal small businesses with marketing materi- Michely Julno, Glades Central High foundation.org. ■

From sprained ankles to life-threatening injuries, Palm Beach Children’s Hospital’s dedicated pediatric emergency department and Level 1 trauma center are ready to face anything from a common injury to a life-threatening condition. Our team is comprised of fellowship-trained pediatric emergency medicine physicians, with treatment procedures designed specifically for the needs of children.

• Level 1 trauma center • Board-certified and fellowship- trained pediatric emergency physicians • Pediatric medical and surgical specialists available around the clock • PICU transport team staffed by pediatric critical care nurses and physicians • On-call medical specialists available around the clock • Online check-in available

From sprained ankles to life-threatening injuries. We Treat More Kids Than Any Other Hospital in Palm Beach County*.

We heal for them. *Based on discharge data from the Florida Agency for Healthcare Administration.

For a physician or specialist visit palmbeachchildrenshospital.com or call 833.280.0431. A8 NEWS WEEK OF JUNE 4-10, 2020 www.FloridaWeekly.com PALM BEACH FLORIDA WEEKLY HEALTHY LIVING Gardens Medical Center marks Men’s Health Month

Teresa URQUHART CEO, Palm Beach Gardens Medical Center

During Men’s Health Month in June, Palm Beach Gardens Medical Center, part of the Palm Beach Health Network, wants to raise awareness of preventable health problems, and encourage early detection and treatment of diseases that are more prevalent in the male popula- tion. According to the Centers for Disease Control, men die at higher rates than women from 9 of the top 10 causes of death, including heart disease, cancer and accidents caused by traumas. Many men may be less likely to seek care or checkups that they would normally have at this time due to the COVID-19 pandemic. That’s why it is important to not delay care and focus on the impor- tance of treatment and early diagnosis of chronic and new conditions that may have developed over the course of the and outpatient centers are safe. We are ogy available to date, one of the most encourage all of the men in the commu- last few months in particular. ready to care for patients who have important factors in positive medical nity, and the family members who love Men’s Health Month in June is a great chronic and new illnesses that require outcomes is recognizing the warning them, to get caught up on checkups and time to remind all of the men in our immediate medical attention through signs, and getting treatment as quickly screenings. community to make an appointment completely separate pathways from as possible once it’s identified. Rest assured, we have taken the prop- this month for a screening or check- COVID-positive patients. Men can be more likely to ignore er steps to ensure patients who come to up they may have missed due to the While our hospital has saved many warning signs of things like strokes any of our hospitals for any screenings COVID-19 pandemic. The benefits of lives because of our talented cardiac and and heart attacks, and we are seeing or procedures will be taken care of in a an early diagnosis can greatly outweigh neuroscience, trauma and teams, and patients come in who are waiting too safe and secure environment. For more any risks, and we have implemented access to some of the most advanced long to seek care. Patient outcomes information, go to our website at www. protocols to ensure that our hospitals diagnostic and interventional technol- improve with early intervention, so I pbgmc.com. ■

Congratulations Class of 20/20! FLORIDA WEEKLY WEEK OF JUNE 4-10, 2020 A9 Jupiter Medical Center raises nearly $1.8 million for COVID-19 relief 2020 In the height of the COVID-19 pan- Church and Temple Beth Am of more than Pet Lovers demic, Jupiter Medical Center Founda- $45,000. Additional donors contributed & PHOTO tion received nearly $1.8 million in philan- through #GivingTuesdayNow and through CONTEST! thropic donations. other efforts, which enabled the hospital to Issue “We are extremely grateful for the gen- buy equipment needed for FDA-approved erosity of the community and our donors rapid molecular testing. Jupiter Medical during this uncertain time,” Liv Vesely, Center was also able to acquire a telehealth Florida Weekly president of Jupiter Medical Center Foun- cart for intensive care unit physicians to dation, said in a statement. “Gifts received communicate with isolated patients, which Celebrates Your Pets! are helping to offset losses because of reduced their exposure to the virus. Other (DOGS, CATS,CAT HAMSTERS, HORSES, EXOTIC decreased volumes and have allowed us donated money was used to buy two addi- OORR WHATEVERWH YOUR PETS MAY BE) to purchase additional medical equip- tional Tru-D light disinfecting robots. The ment to address the hospital’s highest hospital also received thousands of dollars priority needs.” in restaurant gift cards and meal dona- All the best, funniest and The hospital received multiple dona- tions for front-line workers, and an anony- tions as the community rallied to support mous donor made a $500,000 cash dona- cutest photos will publish the foundation’s COVID-19 Relief Fund. tion directed toward the hospital’s greatest Pet Photo Contest!t! Thursday, July 23rd, 2020 Through ClubsHELP, an organization that need to care for coronavirus patients. Staff judges choose three connects golf organizations with local The COVID-19 Relief Fund is part of winners. $450 in prizes!pr SubmitS your pet photo on communities to provide critical resources Jupiter Medical Center Foundation’s $300 Palm Beach Florida Weekly Facebook in times of need, Jupiter Medical Center million Vision. Innovation. Impact. Cam- page under the contest tab before was “adopted” by the Seminole Golf Club. paign, which is guided by a vision to bring Sunday, July 12th by 11:59pm. Members stepped up collectively, raising world-class clinical programs to the com- more than $250,000 for the foundation’s munity, while providing the highest stan- COVID-19 Relief Fund. The foundation dards of quality, safety and patient experi- also received an interfaith donation from ence. To date, more than $210 million has JupiterFIRST Church, St. Peter Catholic been raised. ■ Palm Beach Outlets to host OneBlood donation drive

Palm Beach Outlets will host a One- Because of the social distancing mea- Blood donation drive from 11 a.m. to 5 sures OneBlood has in place, all donors p.m. Saturdays, June 6, June 13 and June are required to make an appointment to *>“Ê i>V ÊUÊ*>“ £ÓÓ{Ê1°-°Êˆ} Ü>ÞÊ£]Ê-ՈÌiÊ
ÊUÊ œÀÌ Ê*>“Ê i>V ]ÊÊÎÎ{änÊUÊxÈ£°™ä{°È{Çä 20 near the PetSmart parking lot. donate. Visit online at www.FloridaWeekly.com Each donation will be tested for the Appointments can be made coronavirus antibody and donors will online at OneBlood.org or by calling be informed of test results. 1-888-9DONATE. ■

During these challenging times, we remain open and dedicated to safely serving our cancer patients.

You don’t plan for a cancer diagnosis. You begin to worry about your family, friends, work and health. Florida Cancer Specialists will be by your side — throughout the journey. Our doctors and nurses provide personalized, targeted treatment and clinical expertise so you can have peace of mind. And with world-class care that’s close to home, we’re always here to help.

We’ll give you the strength to move forward — every step of the way.

Proud to serve patients at our four Palm Beach County locations.

Barry S. Berman, MD, MS Shachar Peles, MD Elizabeth A. Byron, MD Marilyn M. Raymond, MD Todd A. Gersten, MD Neal E. Rothschild, MD Howard M. Goodman, MD Napoleon Santos, DO Robert J. Green, MD Avram J. Smukler, MD Antonella Leary, MD Daniel L. Spitz, MD, FACP Elisabeth A. McKeen, MD, FACP Sumithra Vattigunta-Gopal, MD, FACP Rina Patel, MD Gerald Zemel, MD Carisa Pearce, MD Your treatment. Our Journey.

FLCancer.com

FCS-2029_Noellia_Florida_Weekly_10x7.68.indd 1 5/29/20 3:31 PM A10 NEWS WEEK OF JUNE 4-10, 2020 www.FloridaWeekly.com PALM BEACH FLORIDA WEEKLY PEACE From page 1 footage as possible,” recalled Mr. Biffar, owner of DreamTime Entertainment, winner of nine Emmy Awards and oth- ers for documentary films made all over the world, showcased in such venues as the History Channel, the Travel Chan- nel, HBO and PBS, among others. Now, his new venture, PeaceVision (www.peacevision.com), is a storytell- ing platform for people in an “untapped market” eager and even aching to em- brace sophisticated, intense report- age that is only “positive” — both Mr. Biffar’s stories and the work of other art- ists and documentarians at the tops of their games. MILA BRIDGER / FLORIDA WEEKLY John Biffar takes a dip in the Gulf of Mexico off Captiva Island. Positive stories are not necessarily safe or comfortable, he notes, and they teau, the late marine explorer and sci- will never be merely sugary, superficial entist whom Mr. Biffar knew and once or shallow. He’s aiming for transcen- filmed, but Michelle Condesse, who dence, stories sparked from the anvil of saved his life. grace, compassion, courage and love in “We immediately went below the sur- human behavior. face and started buddy breathing to ex- Those things are real and they remain pel the carbon from my body. It all hap- underreported or even unidentified by pened so fast I didn’t have time to get most media, he suggests, just like com- scared. Only after I was back in my hotel panies or corporations operating “with did the fear take over.” a conscience. We call them ‘B’ or Ben- efit corporations. They’re also trying to The reason why make their communities better, while Fear is a reasonable thing, sometimes, profiting.” but nothing that seems to have definedd Those are the companies he’s seeking Mr. Biffar’s professional or for that as investors who will back PeaceVision, matter his personal life. a Fort Myers-based for-profit venture He’s deeply devoted to his three COURTESY OF JOHN BIFFAR aimed at doing well while doing good. now-adult sons, all supporters of JohnJo Biffar with his three sons, David, Sean, Ambitious as that is, all of it almost PeaceVision who appear in some of aandn Scott, then and now, all on board with became none of it for Mr. Biffar, age 61. his camera work — Sean, Scott and ttheh latest mission — PeaceVision. He was carefully watching his pres- David. But about love, for example, sure gauge, he remembers, starting he’d offer no advice, to them or anyone $175$ a week, he says — where he later his return from the last dive, when it else. “I wouldn’t tell them anything, as foundedf DreamTime Entertainment. dropped to 500 pounds. Unfortunate- clearly I’m not qualified,” he says. He’s made documentaries, commercial ly, he miscalculated how much time it Born in New York City into a family films commissioned by companies, would take him to get back out of the of seven children, his father once com-- and in 1995 he wrote and directed the cave before swimming for the surface. manded the fire boats for the New Yorkk feature film, “Captiva Island,” starring “I was still in over 100 feet of water City Fire Department (the old man laterr ErnestE Borgnine. (when) I felt the unmistakable sign of learned to windsurf at 70, something hee There is this about him, too, adds Mr. my tank running out of air as I sucked was still doing at 90, Mr. Biffar notes in 1977 with Bob Hite, a deeply expe- Hite, who even had a minor role in “Cap- on the regulator,” he said. proudly). rienced reporter in Vietnam who later tiva Island:” The camera was still rolling. When his parents split up, he moved became the many-year anchor at NBC’s “Of all the men I know, he’s prob- “When we got back and played back with his mother and two siblings to Fort WFLA-Channel 8, in Tampa. ably the finest. He’s the real thing. He’s the tape, I realized it took me over a Lauderdale, on the beach. That was 51 Mr. Hite retired from television in a spiritual man. John would be a much minute to make it to the surface. I just years ago; he is now 61. The beach be- 2007, but he’s thrown his hat into the wealthier person if he didn’t spend so kept thinking, ‘breathe out,’ knowing if I came his life, in part. The other part was ring at PeaceVision. much of his own money doing docu- didn’t my lungs would explode.” a camera. “I don’t know any other man as well mentaries out of his own pocket about It was far too close for comfort. “Right “There was really nothing to do grow- as I know John,” he says. “Throughout people or organizations that need help.” before I reached the surface I lost my ing up there but hang out on the beach,” these many years, what he’s produced Others echo that sentiment. vision but not consciousness. When I he recalled. “But when I was 12, I conned for TV has mostly been positive news. His longtime friend Bill Boggs, a for- did hit the surface I heard a loud explo- my older sister into getting me a video On commercial, local TV in Tampa you mer news anchorman for WNBC in New sion, which was the air coming out of my camera — my parents wouldn’t do it, but have three stations, and they do murder, York, a host of talk shows and author, lungs.” she did.” mayhem, death and destruction. John first met Mr. Biffar high in the Swiss He suffered the bends. The nearest The camera became an appendage, a has usually been ‘the kicker’ — in televi- Alps when Biffar filmed him in the snow bends room, a decompression chamber, third arm, and for years he struggled to sion, that’s what they call the last news- and ice by hiring a helicopter and shoot- was in Portugal. It might as well have scrape together money every time he cast that leaves viewers with a smile.” ing while leaning out the door. been on the moon. shot footage for the $20 tabs to develop “He’s one of the most spiritually cen- “My vision returned (as) my French single rolls of film. The kicker tered people I know. He cares about do- dive partner got to me,” he said. He earned a degree in film from USF, The kicker started with a full-time job ing good in the world,” he says. His dive partner wasn’t Jacques Cous- doing an internship in Tampa starting for WINK TV in Fort Myers — pay was “I just respect him as a human. What-

In the KNOW

John Biffar — a movie missionary through the years:

» With Jacques Cousteau, Erik Lindberg, Bill Boggs, Norma Miller and Chip Yeates. PALM BEACH FLORIDA WEEKLY www.FloridaWeekly.com WEEK OF JUNE 4-10, 2020 NEWS A11 ever he does, he does with heart and “He just has a huge heart. He’s a kind soul. Hopefully he’s right for his time, of a south Florida pirate, always seeking and the world will be drawn to this kind to find and illuminate stories — particu- of programming at PeaceVision.” larly stories of positive change.” John Lack, now a Palm Beach County Those are his treasures. Mr. Lindbergh resident and friend, was instrumental in met Mr. Biffar with Walter Cronkite founding MTV. To do it, he identified about two decades ago when Mr. Biffar another market of people untapped who made his documentary, “Uncommon wanted something new and different, Friends,” narrated by Mr. Cronkite. roughly the same thing Mr. Biffar aims It details the close friendship of the to do now. late Jim Newton (the film title came But Mr. Biffar’s effort includes a moral from Mr. Newton’s book) with Thomas edge. Edison, Henry Ford and Harvey Fires- “He’s always had that feeling about tone. Newton, with his wife, Ellie, later life — you have to give back, you’ve got befriended the famous aviators (and in to do good — whether in documentaries her case a writer), Charles and Anne or some other way,” Mr. Lack said. “He’s Morrow Lindbergh. looking for the people angle and how They spent months and years on the to tell the people story. He believes he southwest coast, and they were Erik’s can do stories that are uplifting, that can grandparents. (teach) others a better way to live.” “PeaceVision is born from John’s He teaches them simply by being near heart, he’s been talking about it for years them, too, apparently. SPECIAL TO FLORIDA WEEKLY and putting bits of it together,” explains Julie McEnroe, whose husband, Capt. John Biffar in studio with David Essel bringing PeaceVision to fruition. Mr. Lindbergh, an aeronautical engineer Finbar Gittelman, built and commands his policy was, “one for them, one for Traveling to L.A., he’d been routed whose company, Verdego Aero, based a two-masted schooner based in Key me” — he gave the income from every through Atlanta that day. “But it was in Daytona Beach near Embry-Riddle West, “The Wolf,” designated flagship of other performance to charity. only two weeks later that my assistant Aeronautical University, is building the Conch Republic, sailed recently into “I have equally admired the work that informed me she’d originally booked me electric propulsion systems for aviation Cuba with Mr. Biffar and a crew. They Harry Chapin was doing with his music through Boston, but switched the ticket that represent what he calls potentially made the last trip just before the Trump and his efforts to feed the hungry, so I because it was a middle seat. Since I’m “a big disruption coming in aviation, and administration closed the door on that actually look up to them both, him and 6-foot, 7 inches, she knew that wouldn’t a billion-dollar market.” opportunity. Kari,” Mr. Biffar said. work.” For Mr. Biffar, adds the 55-year-old Mr. Mr. Biffar’s documentary about the The Boston-based plane left without Lindbergh, “having the gift of time as a goodwill journey and the Cuban people Close to his heart Mr. Biffar. A short time later that morn- result of the coronavirus lockdown has will appear in the fall on PBS, which He also won awards and praise for ing it hit the north tower of the World let him do this now. committed to buying the story, Ms. (among others) such documentaries as Trade Center. “I’m so excited to see that. I think McEnroe says. “The Queen of Swing,” about a long- There were no rental cars available in there’s enough polarization in the world She’s known him since the 1990s, time Las Vegas performer he rediscov- Atlanta, so he got one of the last three today that at we need to focus on where when her brother, John McEnroe, oper- ered, the late Norma Miller, and “The seats on a Greyhound bus, back to Fort we can come together, where we can ated a riverfront watering hole called Fire Boats of 9/11,” describing what the Myers. learn how to talk to other people, the Victoria Pier. NYPD’s marine division did following Mr. Biffar appeared startled when OTHER people, quote unquote.” Both Mr. McEnroe and Mr. Biffar were the terrorist attack. asked if he considered himself a risk- Mr. Biffar sums up what he aims to single dads at the time, together, she After making “The Queen of Swing,” taker. do this way, on his new website, www. said. he and Ms. Miller remained friends for “I never thought of it that way, but peacevision.com: “He’s like that magic person. I call him the rest of her life. She died last May at now you mention it, I was called that “The world has become a place where my magic person. He’s done so much 99, having stretched her remarkable ca- once in court by a lawyer who sued me,” the news is unbalanced, at best, and ev- good. He was in Guatemala, he’d gone to reer, in part with Mr. Biffar’s help and he said. eryone is constantly bombarded with find this American woman, Kari Engen, encouragement, from 1932 all the way to He’d been filming a couple of figure negativity. We believe this creates an op- who started a school for kids who were 2019, singing to the end. skaters, moving with them on the ice, portunity to give people what they really living in the dump (in the most dire pov- And he made “The Fire Boats of 9/11” when he slipped and fell, bringing them want — a better and more connected life erty imaginable), in Guatemala City.” to honor first responders, who had once down with him, embarrassing the cou- experience.” The documentary he made from that included his father. ple. They claimed he did it on purpose, “To give people what they want” is journey, “Children of the Fourth World” Since his dad had commanded the and took him to court. the same vision of Roger Ailes, the late — he won an Emmy for best writing — NYFD’s marine division and knew the But that’s as far from his style as it chairman and CEO of Fox News, who re- changed his life, he says. firefighter who stepped into that role gets, says Mr. Boggs, who remembers signed four years ago after allegations of On that trip he identified one of the later, Mr. Biffar was able to get on the not only his professional do-good in- sexual assault by 23 women. two heroes in his life, spiritual mentors boats and see for himself, he said. stinct, but his personal tenderness and But Ailes’ vision of what people ac- of sorts who take action to make the But his relationship with the tragic caring for suffering people. tually want diverged radically from Mr. world better. events of 9/11 is even more personal than “We were filming in Fiji and three- Biffar’s vision of what they want. “Meeting Kari Engen in Guatemala that. quarters of the crew got desperately ill,” “We will provide engaging video con- and seeing the work she was doing af- “I was in the air on 9/11 with a script in Mr. Boggs recalls. “So did I. John didn’t tent free from negativity, politics, and fected me more than I can ever say. She my hand for a show we were wrapping get sick, but I can still remember him violence,” he explains, ”instead show- was for me an example of what it is to up called, ‘The Nazi Plan to Bomb New patting my head down so gently with casing paths toward positive change. truly Love, and what can happen when York City,’ for the History Channel,” he a cool towel. I was hallucinating at the “We’ll also curate documentaries, you commit yourself to something com- recalls. moment, convinced I was selling sun- films and messages from inspiring non- pletely.” “Someone got on the plane and told glasses on the boardwalk in New Jersey.” profits — purpose-driven corporations, And there was also Harry Chapin, the me they saw President Bush’s plane in artists, influencers and world-class film- singer whose father, a drummer with Sarasota on their way down that morn- The road less traveled makers that we partner with. whom Mr. Biffar played and to whom he ing. When we landed in Atlanta, a news All of that experience in life personal- “Our goal is to provide people with ac- grew close, introduced him. crew came up to me and started asking ly and professionally makes up the man tionable ways to achieve more peace in Harry Chapin’s most famous song may me questions like, “What did they tell now raising the anchor and embarking their lives.” be “Cat’s in the Cradle,” but his most you happened?” We knew nothing of the on his newest do-good venture, PeaceV- You probably can’t do better than that glorious moment in Mr. Biffar’s mind tragedy until then.” ision, says Erik Lindbergh. in a media life. ■ came when he told Bruce Springsteen

» With Walter Cronkite, Arte Johnson and Ernest Borgnine, John Glenn, Pope Benedict and John Lack. A12 NEWS WEEK OF JUNE 4-10, 2020 www.FloridaWeekly.com PALM BEACH FLORIDA WEEKLY RENT From page 1 stand-alone community of single family houses or acquires houses on scattered lots. The Marietta, Georgia-based FirstKey Homes acquires single-family homes for the purpose of renting them out, wheth- er they are newly built or older homes. FirstKey offers rentals from Florida’s Southwest Coast to West Palm Beach, and other parts of the U.S. A sign on one of their company vehicles advertises “Pet Friendly” rentals. “(Build for Rent) is defi nitely not a fad,” said Glenn Palmer, executive vice president at SVN International Corp. - First Coast Commercial in Jacksonville. “It’s a market sector that’s here to stay. And it’ll take business not just from single family home sales but from the multifamily market as well.” COURTESY RENDERING After the federal lender Freddie Mac SVN | SFRhub Advisors is offering “Build for Rent” housing communities in South Florida. began backing loans for BFR companies over the last year, it helped clear the way approximately two-thirds the cost per for their development and garnered the square foot as in conventional. And interest of Wall Street banks, Mr. Palmer they develop and open for rent so much said. sooner. We just now contracted a par- SVN and Lotus Commercial Real cel outside Tampa for 60 manufactured Estate Advisors is working with builder homes and that will develop and rent out Neal Communities on Mangrove Estates, very quickly.” the 63-home portfolio in Fort Myers SVN touts BFR as attractive to invest slated to be complete in 2021. The pro- in for several reasons, including that jected $20 million community will offer tenants stay longer compared to multi- three-bedroom plans of 1,531 square feet family/apartment rentals. In apartments and four-bedroom plans of 1,812 to 2,064 the average stay is less than two years square feet. compared to about fi ve to eight years SVN estimates that the owner-opera- among single-family home renters, says tor of Mangrove Estates would charge an Mark Peterson, director of SVN’s Build average monthly rent of $2,570 and make for Rent Division. a net operating income of $1.26 million “The stickiness we refer to it as, of the per year based on current market values. tenants in a rental home, is fundamen- It’s hard to say what market segment tally longer,” he said. ■ BFR communities will command across the U.S. in coming years, but The Urban Institute says growth in rental house- holds will exceed that of homeowners by “(Build for Rent) is 4 million from 2010 to 2030. According to SVN, demand for single- definitely not a fad. It’s family home rentals is being driven by millennials who can’t afford the costs a market sector that’s of buying a home because of factors here to stay. And it’ll take such as unemployment, student debt, and economic uncertainty; and baby The Marietta, Georgia-based FirstKey Homes acquires single-family homes for the purpose of business not just from boomers looking for a “lock and leave, renting them out, whether they are newly built or older homes. FirstKey offers rentals from single family home sales maintenance-free lifestyle.” Florida’s Southwest Coast to West Palm Beach, and other parts of the U.S. A sign on one of The pandemic may also encourage their company vehicles advertises “Pet Friendly” rentals. but from the multifamily the trend as more people look to work at home and avoid crowded apartment in to the rental price. Tampa, ERC Homebuilders is set to market as well.” buildings. Middle to lower-priced homes work create BFR communities across several Florida’s tax “friendly” status com- better with the BFR model, but not high market segments. — Glenn Palmer, executive vice pared to states such as New York also cost housing where “land cost is so exor- “We are developing a combination president at SVN International make it an attractive place for develop- bitant, the cost of the homes is so high, of conventional construction, modular Corp. — First Coast Commercial ers of BFR communities, which are usu- you couldn’t really rent them effective- and manufactured housing communi- in Jacksonville ally managed by a third party, similar to ly,” said Mr. Palmer. “(BFR) can work in ties,” wrote Gerald “Jerry” D. Ellenburg, many multifamily housing units. Ame- lower, middle; we’re not sure they work chairman of ERC. nities such as smart home technology, in the luxury market.” “We like the manufactured housing pools, and other upgrades are often built A developer based in Riverview, near rental model since the resident can pay

PRIVATE CHARTER SALES & ACQUISITIONS MANAGEMENT & MAINTENANCE Need Your Car Home Quickly? PRIVATE AIR TRAVEL SAME DAY OR NEXT DAY PICK UP GUARANTEED! FROM YOUR LOCAL AIRPORT CALL AMERICAN We’ll get you to New England NOW!

RE A E A N W +6KLS4XLFNO\1DWLRQZLGH ESSENTIAL +*XDUDQWHHG3ULFHV

SERVICE ! +'DLO\7ULSVWR1HZ(QJODQG R P E L AD HE +'RRUWR'RRURU&RQYHQLHQW Y TO Fly Private With Shoreline: 'URSRIIDW3%,$LUSRUW • Board directly from car to waiting aircraft • Be confident that your aircraft is sanitized and enhanced protocols are in place ‡)DVW‡5HOLDEOH‡6DIH‡&RQYHQLHQW • Avoid unstable commercial airline schedules and Palm Beach • Marshfield • Bedford interactions associated with public transportation

In these trying times, our dedicated team is standing by to assist. Contact us today to discuss how private flights on our fleet of pristine aircraft can support your business and The Snowbird’s Favorite personal travel needs. Since 1980 800-800-2580‡shipcar.com We are licensed brokers USDOT #385723. 888-291-JETS ( 5387) | [email protected] | www.shorelineaviation.net PALM BEACH FLORIDA WEEKLY www.FloridaWeekly.com WEEK OF JUNE 4-10, 2020 NEWS A13 Ibis Charities Foundation continues fundraising

Usually, Ibis Charities Foundation meals for families and a chance for them to many people are facing because of the Ms. Bross said her fellow residents at holds its annual charity breakfast this stay with their critically ill children. pandemic is extraordinary. The Club at Ibis The Club at Ibis will continue their fund- time of year, distributes the money to When Sweet Dreams, a Palm Beach has proven to be a community with a heart raising and will distribute money to area local nonprofits and starts raising money County-based nonprofit that provides beds because the donations keep coming in.” nonprofits such as The Lord’s Place, Palm for next year. for children who share a bed with siblings Dr. Barbara Abernathy, POST’s CEO/ Beach Harvest, Feeding South Florida and But courtesy of the coronavirus pan- — or sleep on the floor — needed financial president, said in the statement that the Healthy Mothers, Healthy Babies. demic, there’s nothing normal or usual help, another $5,000 check was written. donations from Ibis Charities Foundation “I can’t think of one food bank in the about this year. With most of the county’s food banks not only feed parents, but the children county that isn’t being stressed with their So even though Ibis Charities Founda- running low because people have lost jobs undergoing cancer treatments. resources,” Ms. Bross said. “You cannot tion had raised over $320,000 this year, or making a lot less money, it was time to “Oh, my God, it’s so incredible,” she said. have people going hungry at any time, ICF President Sharon Bross knew Palm make more phone calls. “When we bring the meals to the hospitals, much less during a pandemic.” Beach County needed more help. You can never give enough to charities the kids will press their noses against the Ibis Charities Foundation was selected When Ms. Bross learned parents would during a pandemic. glass so they can see what we’re bringing as the Outstanding Philanthropic Founda- have to remain outside the oncology unit “There are so many people in our today. Is it lasagna? Is it subs? Is it pizza? tion of the Year in 2018 by the Palm Beach at St. Mary’s Medical Center for 48 hours if community who lack the basic essen- “This is a way to lift their spirits and County Chapter of the Association of Pro- they left for food, Ibis Charities Foundation tials such as food, housing and medical wrap a virtual hug around them. They are fessional Fundraisers. sent a $5,000 check to the Pediatric Oncol- needs,” Ms. Bross said in a statement. so excited to see people thinking about ICF has donated more than $1 million in ogy Support Team (POST) to provide “They need help now. The challenges them. They don’t feel so alone.” the last four years. ■

Emergencies still happen. We are here to safely care for you.

Keeping you and your family safe and healthy has always been our priority. That has not changed. In this time of uncertainty, it is vital to take care of your health. We do understand there is concern about COVID-19 and we want you to know that we have strict policies and procedures in place to keep our patients safe. We have appropriate testing for COVID-19 with dedicated units – a separate and safe environment. If you find yourself in need of medical care, please do not hesitate. We are open and safely caring for all patients. For more information, please visit stmarysmc.com. PALM BEACH FLORIDA WEEKLY AT HOME

JUNE 2020 THE PALM BEACH HOME REDEFINED | A14

“To make my space more comforting, I have created a clubby library out of my spare bedroom. ... It’s a place of my own to watch the news, read a book, catch up on emails and enjoy a cocktail or two at the end of the day.” — Joseph Pubillones, a Palm Beach interior designer who has a home in West Palm Beach

COURTESY PHOTOS Joseph Pubillones transformed a spare bedroom into a clubby library, complete with a bar (left) and bookcase (right). Feathering our nests Area tastemakers and designers share how they’ve made their homes more hospitable, now that folks are spending more time at home.

BY SCOTT SIMMONS ing, I have created a ssimmons@fl oridaweekly.com clubby library out of my spare bedroom,” ne thing is for sure. There Joseph Pubillones, a has not been anything like Palm Beach interior the COVID-19 pandemic in designer who has a most of our lifetimes. home in West Palm O We endured two months Beach, wrote in an of shutdowns. Most of us email. “It’s a place PUBILLONES stayed home. of my own to watch Things are reopening, but many of us the news, read a book, are spending more time at home. That catch up on emails and enjoy a cock- means cooking more for ourselves and tail or two at the end of the day.” creating sanctuaries of our own. Another designer, Joseph Paul Davis, For this writer, that spirit of nesting is cleaning up. meant clearing out cupboards, giving or “I’m cleaning my kitchen counters of putting things away, bringing out other useless things and keeping my big mixer treasures and surrounding myself with and Cuisinart out because I’m cooking orchids and other fresh flowers. a lot,” he noted. He has an office in the Turns out, I’m not alone. Paramount Building in Palm Beach, but Local tastemakers and designers also frequently works from his West Palm are creating sanctuaries of their own. “To make my space more comfort- SEE NESTS, A15 X PALM BEACH FLORIDA WEEKLY www.FloridaWeekly.com JUNE 2020 At Home A15 NESTS From page 14

Beach home. That meant installing a printer and making the place more accommodating for being home full time. “I’m getting fresh orchids instead of artificial ones, as I’m home to water and nurse them now,” he wrote. He took the notion of nesting literally. “I just bought a new cashmere bed blanket because I’ve always wanted one and I’m in bed so much now.” It’s amazing what a few plants or new pillows or a blanket, for that matter, can DAVIS do to update a space. “Personally, I gave my sectional at home a new look, adding a collection of updated color way deco- rative pillows,” Sandy Costello of Mac Fabrics in West Palm Beach wrote in an email. “In addition, I filled them with comfortable down fillers for luxurious nesting to accommodate the additional hours of use.” She’s not alone. “The common thread we are hearing is, ‘I have spent so much time at home, I am so ready for a new look in my living space,’” she wrote. “It is amazing how COURTESY PHOTO just a few new pillows, rug or chair can New pillows, like these by Sandy Costello of Mac Fabrics, offer an easy opportunity to inexpensively transform a space. make a room.” Customers are recognizing that they lifetime.” perfect temperature for the ‘sweat’ factor.” ever-changing business, and we have need comfortable Others have made accommodations That space will soothe both body and certainly learned in the last two months new furniture or for the shutdown. soul for Mr. Pubillones’ client. the connection between our well-being need to give older “Because we live in a condo, and the Or as Ms. Costello, of Mac Fabrics, and our home space.” pieces a facelift. closures of the gym and pool were so observes: “Interior design is an exciting Truer words never were spoken. ■ It’s not just inside, frustrating, we actually rented a little either. house with a pool for the duration, just “In addition, we to have someplace to go! It was a life- are seeing an upsurge saver,” noted Steven Stolman, a Palm of recovering out- Beach resident and the former president COSTELLO door cushions,” Ms. of Scalamandre. Costello noted. “This The condo he shares with spouse is a result of spending more time at Rich Wilkie already was comfortable. home around the pool and family barbe- “We haven’t done a lot to make our cues. This category is always important own place more livable during lock- in Florida, but more so today with the down,” he wrote in an email. “Our condo challenge of converting our home space graciously moved the spin bike that we into more of a comfortable entertain- purchased for our gym into our unit ment area for our families.” when they closed Mac has the products to make that the gym, so it sits in happen, with style, she said. our bedroom. I hate “The new fabrics in the market today the way it looks, but are sunny and happy for our South Flor- I am grateful to have ida market, and our clients are drawn it.” to these color palettes,” Ms. Costello Still, the spin bike observed. “The new Crypton perfor- boasted an animal mance fabrics make recovering a sofa print hand towel or chair the perfect solution, as the hanging from its STOLMAN colors are endless to choose from and handlebar, point- the performance of these fabrics last a ing to Mr. Stolman’s roots in the design industry. “I’m not an interior designer nor do I play one on TV,” he mused. “I’m strictly an amateur. I do marketing and PR for SHEERS & SHADINGS designers and I’ve served as president CELLULAR HONEYCOMB SHADES of a textile company, but that’s kind of ROMAN SHADES it. I call myself an author and designer, ROLLER & SOLAR SHADES but I designed clothing when I did it for WOVEN WOODS a living.” SHUTTERS The spin bike was one accommoda- VERTICAL BLINDS tion Mr. Stolman had to make to endure the pandemic lockdown. He also created WOOD & METAL BLINDS a hand-washing station in his kitchen. PLEATED SHADES “We enter through the kitchen door DRAPERY AND VALANCES and go right for the soap!” he wrote. MOTORIZED WINDOW COVERINGS One of Mr. Pubillones’ clients is tak- WALLPAPER ing things further. INSTALLATIONS AND REPAIRS “I am in the process of turning an INTERIOR DESIGN CONSULTATIONS unused garage for a client who loves Bikram (hot) yoga, so he can practice UPHOLSTERY alone,” Mr. Pubillones wrote. “I am outfit- CARPETING AND FLOORING ting the floor with a rubber floor, install- ing a wall-to-wall mirror, adding a large interiorsbylaura.com (561) 747-5527 COURTESY PHOTO flat screen for online instruction and 185 EAST INDIANTOWN ROAD „ SUITE 213 „ JUPITER, FL The spin bike at Steven Stolman’s condo finally, adding a heater to achieve the boasts an animal print towel. PALM BEACH FLORIDA WEEKLY BUSINESS

A16 | WWW.FLORIDAWEEKLY.COM WEEK OF JUNE 4-10, 2020

“Self-discipline is the ability to motivate and coordinate our efforts to improve our quality of life, but unfortunately most people are not taught it.” — Rob Carter III, physiology expert and author Staying

Lacking self-discipline? Here are five ways to develop it and reach your goals

______SPECIAL TO FLORIDA WEEKLY

MERICANS ARE KNOWN TO OVEREAT, abuse credit cards and marinate for hours in social media. Self- discipline doesn’t seem to be a A national strength. And achieving self-discipline — and the success that can come with it — may never have been harder than it is in this instant-gratification age, says Rob Carter III. “Self-discipline is an undervalued trait in a modern society that wants every- thing now,” says Mr. Carter, co-author

SEE FOCUSED, A17 X

“B4>B4< “4\PX[

www.FloridaWeeklyDigital.com 561.904.6470 PALM BEACH FLORIDA WEEKLY www.FloridaWeekly.com WEEK OF JUNE 4-10, 2020 BUSINESS & REAL ESTATE A17

“Self-discipline includes ■ Plan for every outcome. structured planning, organiza- FOCUSED Plans go awry when people let tion, delayed gratification, and From page 16 excuses get in the way. the willingness to step outside “An example is having a goal your comfort zone,” Mr. Carter of running in the morning for 30 says. “These things can appear with his wife, Kirti Salwe Carter, of minutes, but you have bailouts scary, but don’t worry, you’re “The Morning Mind: Use Your Brain such as it’s raining, cold or you not alone. And once you take to Master Your Day and Supercharge don’t feel like it,” Mr. Carter the first step, you have ventured Your Life” (www.themorningmind. says. “Developing self-discipline onto a beautiful path that offers com). “Self-discipline is the ability to is recognizing and planning many rewards.” motivate and coordinate our efforts to for these self-created obstacles improve our quality of life, but unfor- and actively choosing to work tunately most people are not taught it. through them. So when you set — Dr. Rob Carter III and “It is, however, a skill that everyone a goal to achieve, have a chart in Dr. Kirti Salwe Carter are co- can learn. Self-discipline is the skill that place listing ‘Even ifs.’ authors of The Morning Mind: will allow you to reach any goal you “List the potential obstacles to Use Your Brain to Master Your set.” achieving your goal and counter Day and Supercharge Your Life Mr. Carter offers five ways to develop each one with a promise to your- (www.themorningmind.com). self-discipline. self that you’ll achieve your goal Rob Carter is a lieutenant colo- even if these challenges arise.” nel in the U.S. Army, an expert in ■ Be aware of your resistance. human performance and physi- Resistance, Mr. Carter says, is the big- ■ Prepare to give something ology, and has academic appoint- gest obstacle to developing self-disci- up in order to gain. ments in emergency medicine at pline, and it often comes in the form of Mr. Carter suggests compiling the University of Texas Health discouraging internal self-talk such as, a list of the pros and cons of sac- Science Center at San Antonio, “I can’t do it” or “Why should I have to rificing for a certain goal. in public health and health sci- change?” “The next time you embark on “To reach your goal, you will ences at Los Angeles Pacific Uni- a new project that causes resistance,” more than likely have to impose versity, and in nutrition at the Mr. Carter says, “fight it by asserting or certain limitations on yourself in University of Maryland, Univer- writing down your intended goal and order to gain something. These sity College. He holds a PhD in the benefits it will bring.” limitations could be less free biomedical sciences and medi- time, socializing, money or tele- cal physiology and an MPH in vision. The upside is that seeing chronic disease epidemiology. the rewards of the sacrifice on the pros ■ Break your goal down Kirti Carter was born in Pune, India, list will keep you motivated and disci- into manageable steps. and received her medical education plined.” “If you break your goal down into in India, where she practiced as an bite-sized steps,” Mr. Carter says, intensive-care physician before mov- ■ Reward yourself with “you’re much more likely to stay disci- ing to Texas to complete postgraduate self-compensation. plined enough to complete every sub- training in public health. She is a fellow “Rewards are an incredibly powerful goal. Each step accomplished gives you of the American Institute of Stress, has tool for motivating yourself to reach an encouraging boost. Consider using more than 18 years of experience in your goals. Consider them the carrot SMART goals — specific, measurable, meditation and breathing techniques, on the stick. Have a reward in place attractive, realistic, timed. This makes and has been facilitating wellness semi- the goal more definitive and puts the COURTESY PHOTO for when you achieve a goal or part of nars for the past decade. ■ Kirti Salwe Carter and Rob Carter III a goal, and make sure it’s appropriate.” steps in tangible action.”

Keep your family safe with Boomer Naturals Reusable 30-Day Face Covers Face covers are highly suggested, if not required, for all public activities now.

Ultra-soft and available in a variety of colors and fun patterns, our protective face covers come in both adult and children’s sizes.

Boomer Face Covers are soft, airy and highly breathable. Designed to fully cover the nose and mouth, we guarantee them to be comfortable, hypoallergenic, non-toxic, and suitable for all-day wear. Our soft, safe material is a 65% cotton/35% polyester blend with three layers - an inner hydrophilic layer, a middle filter layer, and an outer hydrophobic layer - to help prevent droplets from spreading.

Plus, our Reusable 30-Day Face Covers offer even more protection, because they are made with cotton treated with stable silver nanoparticles, which adds an antibacterial effect! Use code FLWeekly15 for 15% off your entire purchase order For more information, please visit boomernaturals.com A18 BUSINESS & REAL ESTATE WEEK OF JUNE 4-10, 2020 www.FloridaWeekly.com PALM BEACH FLORIDA WEEKLY EARL ON CARS Open letter to Florida car dealers: Eliminate hidden fees

not always proud. But I have evolved as my customers have evolved. My cus- tomers’ expectations, level of educa- Earl STEWART tion and sophistication are much higher today. Your customers are no different. [email protected] 561-358-1474 As I began treating my customers and employees, better I discovered that they Dear fellow Florida car dealer, began treating me better. Yes, I used to I started in the retail auto business in charge a dealer fee ($495), and when I 1968, about 52 years ago, and I have seen stopped charging it many years ago, it a lot of changes in the way we dealers was scary. But I did it because I could sell cars and the expectations of our no longer, in good conscience, mislead customers. I’m not trying to tell you my customers. how to run your business; I’m suggest- Now here’s the good news: My profit ing a change that will reward both you per car did drop by about the amount and your customers. of the dealer fee when I stopped charg- Virtually every car dealer in Florida ing it. But when my customers realized adds a multiple, hidden charges to the that I was now giving them a fair shake price of cars, variously referred to as and quoting the complete out-the-door a “dealer fee,” “doc fee,” “dealer prep totally unaware that they are paying being able to count on an extra $500 to price with no “surprises,” word spread. fee,” “tag agency fee,” “electronic fil- this. Usually they negotiate the car pur- $3,000 in profit, you can advertise and My volume rose. Sure, I was making ing fee,” dealer services fee,” etc. This chase on your “worksheet,” which is quote prices below cost and end up mak- hundreds of dollars less per car, but I was extra charge is printed on your buy- not a legal document. The legal buyer’s ing a big profit. Or, if the price you quote selling a lot more cars! My bottom line is er’s orders and is programmed into order is only “revealed” in the finance the customer does pay you a nice profit, far better than it was when I was charg- your computers. It has been regulated office, when it’s spit out of the com- you can increase that profit by several ing a dealer fee. You can do the same! and minimized in many states, includ- puter with dozens of other documents hundred or thousands of dollars. I’m not going to tell you that I think ing California. Florida has virtually no the buyer must sign. Who reads the This “extra, unseen” profit is even of myself as the new marshal who has regulation and no regulation that is voluminous paperwork associated with better for you, because you don’t pay come to “clean up Dodge.” Lots of peo- enforced. You charge these hidden fees buying a car? Those few buyers who do your salesmen a commission on it. ple will read this letter to you and learn to every customer, and it ranges from question the fee are often told that your That’s being unfair to your employees, why they should buy a car from me, not a few hundred dollars to thousands. dealership must charge this fee on very as well as your customers. When the you. And, I’m also aware that most deal- Florida law requires that you disclose car, which is untrue. These astute buy- rare buyer objects to the hidden fees, ers who read this will either get angry in writing on the vehicle buyer’s order ers also are told that all other car deal- you can simply decrease the quoted and ignore it or not have the courage to that these charges represent profit to ers charge similar fees. This is almost price of the car by the amount of the follow my lead. But maybe you will be the dealer. Florida law also requires that true, but my dealership does not. hidden fees. This would have the same the exception. If you have any interest you include these fees in all advertised The reason you charge this fee is sim- net effect of removing it. The salesman in following my lead, call me any time. I prices. You almost never do this, and ply to increase the price of the car and won’t do this because he’ll lose his com- don’t have a secretary and I don’t screen this is another way that you get around your profit in such a manner that it’s mission (typically 25%) on the decrease any of my phone calls. I would love to the law by limiting the number of adver- hidden from your customer. This is just in his commissionable gross profit. chat with you about this. My personal tised vehicles (typically one). plain wrong. Dealers will admit this to me I don’t profess to be some “holier cell phone number is 561-358-1474. The argument I hear from most car in private conversations and some will than thou” car dealer who always was dealers is that the hidden fees are fully admit that they have considered eliminat- perfect. Although, I never did anything Sincerely, disclosed to the buyer on the vehicle ing the fee, but are afraid of the drastic illegal, when I look at some of my adver- Earl Stewart ■ buyer’s order. But most car buyers are negative impact to their bottom line. By tising and sales tactics 30+ years ago, I’m PET TALES Pets of the WEEK

Hot dog: How to manage and prevent heat injury

BY KIM CAMPBELL THORNTON movement, resting in place, choosing to sit Andrews McMeel Syndication or lie down, or sprawling on cool ground. If you call them, they might be slow to We all love having fun in the sun, return to you — as if saying, “I’ll do it if dogs included. And some dogs aren’t you ask me to, but I really don’t want to.” just playing; they’re seeking lost hikers, Tongue length and uncontrolled pant- partnering with police or training for ing — when the dog is unable to stop high-action dog sports. Whether they’re — can also signal heat stress. When that playing or working, though, it’s impor- tongue is out long and wide, the dog is tant to be aware of signs of heat injury maximizing surface and airway area to » Gilmore is an 8-year-old, 68-pound male and know how to treat it. Every dog’s heat tolerance is different. Small increase evaporation and heat dissipation. mixed breed dog, described as a “sweet, You may already know that signs of dogs tend to be less heat tolerant than large When you see these signs, take action. gentle soul in search of a FurEver Home with heatstroke include excessive panting, dogs, and short-faced (brachycephalic) dogs That might mean having your dog sit and great napping potential.” He gets along well staggering, bloody diarrhea, collapse, are prone to airway disease, so be vigilant about cool down on her own, or making use of with dogs, cats and humans. seizures and shock. But what Leo Egar, their exposure to high temperatures. air conditioning or a fan. Sue is an 8-year-old female cat who will VMD, wants you to know is how to rec- Active cooling techniques include hos- » happily ask for attention with a gentle a gentle ognize signs of heat stress early. “There’s too much variance between dogs, ing down the dog, putting him in water Dr. Egar, who practices in Phoenix, headbutt, or even give you a kitty kiss. She’s a conditions and measurement methods.” or putting ice packs on him. Armpits are big cuddler, too. has been part of the veterinary medical So knowing your dog’s “normal” is the best places to apply active cooling response to several major disasters and important. For dogs, normal resting because they’re less insulated by fur and spoke at the K9 Sport and Scent Work temperature can range from 99 to 102.5 have a lot of large blood vessels. Ears can Conference in Palm Springs, California, degrees Fahrenheit. Fit dogs at a moderate also be good, for the same reasons. in January. activity level might have a body tempera- It’s OK to cool dogs rapidly, and it’s OK “We want dogs to be able to tolerate ture ranging from 104 to 107, depending to use cold water. some degree of thermal stress as they on individual dog’s metabolism, intensity “It’s a common myth that if you take work and play,” he says. “Heat stress, or of activity and ambient temperature. a hot dog and you cool him too quickly, mild heat injury, is a normal reaction to “This particular range is normal for you’ll cause shock,” Dr. Egar says. “Not increased exercise or ambient heat.” many fit working dogs during moderate true. Not a single clinical study vali- When dogs are working or playing, the work and has no adverse effect,” Dr. Egar dates that.” body produces heat. Thermoregulation is says. “We don’t have a well-defined set On a hike or during play on a hot day, the body’s attempt to balance heat gain point for dogs, but you should know what take a time out so your dog can drink and heat loss. A body temperature greater your dog’s normal is.” water and stay hydrated. Flavored water than 104 degrees Fahrenheit is defined as One sign of heat stress to watch for is may encourage him to drink more, but To adopt or foster a pet heat stress; more than 105 as heat exhaus- decreased moisture on nose tissue, caused electrolyte supplements don’t provide any Peggy Adams Animal Rescue League tion; and more than 106 as heat stroke. by dehydration. Dogs who are dehydrated special benefit. is at 3100/3200 N. Military Trail in West Palm Beach. For adoptable pets and other But the first thing to know is that tem- tire more quickly and have less interest in Finally, don’t rely on gadgets such as information, visit www.PeggyAdams.org or perature isn’t everything. rewards such as treats or play. fans, alarms, or cooling vests or mats. “You cannot predict heat injury based call 561-686-3663. Services are limited and Other signs of thermal stress include Anything can break, so always check on adoptions are by appointment until further on body temperature alone,” he says. seeking shade, calming down, limiting your dog. ■ notice. ■ PALM BEACH FLORIDA WEEKLY REAL ESTATE

WEEK OF JUNE 4-10, 2020 WWW.FLORIDAWEEKLY.COM | A19

COURTESY PHOTOS Palm Beach classic

SPECIAL TO FLORIDA WEEKLY

This move-in ready family home, a classic Palm Beach Monterey-style design, is on a double lot in the heart of the Sea Streets. There are light-filled rooms at every cor- ner. The main house has four bedrooms, four baths, a first floor powder room, renovated chef’s kitchen and master bath. Aroad awninged terrace at rear faces a new lap pool, two-car garage with studio apart- ment upstairs and pool cabana with its own full bath, bedroom and living room. This is close to everything — it’s one block to Palm Beach Public School and Palm Beach Day Academy, and a stone’s throw to The Society of the Four Arts and Seaview Tennis and Rec Center, or a short Lake Trail stroll to Worth Avenue and Royal Poinciana restau- rants. For those errands when you need a car, a wide circular drive makes off-street parking a breeze. There is deeded beach access via Sea Streets beach gate at Seaspray. It’s offered at $6,295,000 by Sotheby’s. ■ Info: John Cregan, 847-651-7210, [email protected] Lisa Cregan, 847-910-1303, [email protected] 2725 PGA BLVD Please Stay Home & Save Lives. PALM BEACH GARDENS FL 33410

NEWLY LISTED SOLD NEWLY LISTED

PRESERVE AT IRONHORSE COUNTRY CLUB PRESERVE AT IRONHORSE COUNTRY CLUB PRESERVE AT IRONHORSE COUNTRY CLUB PRESERVE AT IRONHORSE COUNTRY CLUB

7965 FAIRWAY LANE 6690 OAKMONT WAY 7452 IRONHORSE BLVD 7725 PRESERVE DR 4,128 under air/built on estate lot ;`Yjeaf_+:J$,:9$gh]fÛggjhdYf$na]okg^ 3 Bedrooms/2.5 Bathrooms/ 2.5 Car Garage 2/2.5/2.5 car gar/ 2,299 under air/ 2,960 tot new roof/heated pool- screened Arthur Hills designed golf course, pool, accordion 2,477 under air 2 Story Guest Suite 788 Under Air. Built on large property/ screened in patio in patio new landscaping shutters. Country club community, membership not >mjfak`]\$na]okg^l`] Upgrades to kitchen- guest bedroom and half mandatory. Arthur Hills designed golf course and lake. :9$Yddf]oÛggjaf_

NEWLY OFFERED AT $979,000 OFFERED AT $499,999 OFFERED AT $725,000 NEWLY OFFERED AT $450,000

Whether you are looking for a vacation home, or a change within your own neighborhood. The Alawn Rockoff Group will Meet and surpass your needs. We work with our clients to make their lifestyle dreams a reality. The Alawn Rockoff Group is your full-service, turn-key real estate solution. Some of our numerous offerings: U7œÀ`܈`iÀi>V ÜˆÌ œÕÀ`ˆ}ˆÌ>>˜`«Àˆ˜Ì“>ÀŽï˜}ÃÌÀ>Ìi}ˆið Alawn Rockoff and her Illustrated Properties concierge team are committed UƂ>ܘ>˜`ÕÃÌÀ>Ìi`*Àœ«iÀ̈ià >Ûi>Vœ“Lˆ˜i`iÝ«iÀˆi˜ViœvÇäÞi>Àð to using their experience and knowledge to make your move the very best U-ÌÀiÃÇvÀiiiÝ«iÀˆi˜ViÜˆÌ œÕÀˆ˜˜œÛ>̈Ûi>˜`VÀi>̈Ûi>««Àœ>V ̜ÃiޜÕÀ œ“i° U"«Ìˆœ˜vœÀ«ÀœviÃȜ˜>ÃÌ>}ˆ˜}̜i˜ >˜ViÌ iLi>ÕÌÞœvޜÕÀ œ“i>˜`ÃiµÕˆVŽÞ° one ever. Our team is looking forward to exceeding your expectations. U œiV̈ÛiÛ>ÕiÃœv`i«i˜`>LˆˆÌÞ]Vœ“«>ÃȜ˜>˜`Vœ““ˆÌ“i˜Ì°

AlawnA Rockoff ABR, GRI, TRC, SRES Alison Biddulph Realtor Associate

561.801.02105 | [email protected] 561.465.6010 | [email protected] www.buyandsellwithalawn.comw | www.alawnrockoff.ipre.com [email protected]

Malloy Home Team For Every Move You Make DANANDDAWN.COM NEW LISTING PALM BEACH LIFE PENDING

ATRIUM OF PALM BEACH Palm Beach living at its finest in this fabulous oceanfront building featuring 3 spacious bedrooms, 3 full bathrooms, updated kitchen, full size washer and dryer, a 96 ft. wraparound balcony with Intracoastal and ocean views 2379 TREASURE ISLE DRIVE #22, and 1 garage space. PALM BEACH GARDENS IN MARINERS COVE Call 561-370-5736 for details. Offered for $299,000 Offered for $1,040,000 EVERGRENE UNDER CONTRACT IN 4 DAYS UNDER CONTRACT IN 5 DAYS RESORT STYLE AMENITIES

Fabulous 4 Bedroom, 3.5 Bath Extended Magnolia Model with a pool on an awesome private preserve lot in the sought after resort community of Evergrene. To schedule your private tour or video tour CALL 561-370-5736. Offered for $649,000

WESTWOOD GARDENS EVERGRENE Dan and Dawn are Evergrene Residentsnts Offered for $280,000 Offered for $369,724. and have been helping Evergrene sellerserrs and buyers since 2006! ALL OF OUR LISTINGS HAVE A 3D TOUR AVAILABLE. To have your Evergrene home SOLDD TEXT 561-876-8135 YOUR NAME, YOUR EMAIL call 561-876-8135. Ready to buy a neweww ADDRESS AND THE PROPERTY ADDRESS home visit DanAndDawn.com AND WE WILL SEND YOU THE 3D TOUR. When you want a SOLD sign CALL 561-876-8135 Premier Brokers International 9123 N. Military Trail Suite 104, Palm Beach Gardens Florida 33410 #1 PRODUCER FOR ILLUSTRATED PROPERTIES IN 2019

THE RITZ-CARLTON RESIDENCES FRENCHMAN’S CREEK, PBG

Singer Island, TS 7A I 4BR/5.1BA I 7,445 SF I $8.69M Best Contemporary I 5BR/6.1BA I 8,420 SF I $7.95M TEQUESTA LAND/RESIDENTIAL BEACHFRONT PH-N, JUNO BEACH SOLD

3 Acres Directly on Intracoastal I $3.625M Directly on the Sand I 3BR/4.1BA I 3,534 SF I $2.95M FRENCHMAN’SADMIRALS COVE, CREEK, JUPITER PBG FRENCHMAN’SADMIRALS COVE, CREEK, JUPITER PBG

Feels Like New I 3BR/4.1BA I 3,325 SF I $2.195M Totally Renovated I 4BR/4.1BA I 3,218 SF I $1.895M

WATER CLUB VILLA 108 N, NPB WATER CLUB #1002 N, NPB

Waterfront Villa I 3BR/4BA I 3,226 SF I $1.795M Endless Views I 2BR/2.1BA I 1,959 SF I $1.325M

VINCE MAROTTA 561.847.5700 [email protected] LOCALLO LUXURY EXPERT All Prices Shown are List Price PALM BEACH FLORIDA WEEKLY ARTS & ENTERTAINMENT

A22 | WWW.FLORIDAWEEKLY.COM WEEK OF JUNE 4-10, 2020 HAPPENINGS

COURTESY PHOTO THROUGH The Armory Art Center will offer in- person classes this summer. Armory to offer camps, reopen at end of June EYES ______FLORIDA WEEKLY STAFF We’ve sheltered in place. And we’ve learned to live virtually. But come June 29, our kids can

ERIC RADDATZ / FLORIDA WEEKLY take courses in person, courtesy of Spike Lee at the 2016 Sundance Film Festival. His lat- the Armory Art Center’s “Summer est film “Da 5 Bloods” premieres June 12 on Netflix. Art Experience 2020.” And come July 6, so can adults. “We are so very pleased to once BY ERIC RADDATZ again open our doors and invite eraddataz@fl oridaweekly.com our artist community of talented instructors and students back to the Armory,” Tom Pearson, executive PIKE LEE IS FOR REAL. AND HE always seems to keep it real. director of the Armory Art Center, Ever since he burst onto said in a statement. “This summer is the stage with the indie film exploding with creativity, and with success “She’s Gotta Have It” choices to get involved with us in- in 1986, the NYU Film School person, or virtually — we are excited His new joint “Da 5 Bloods” grad (now NYU Film School to remain an integral part.” S professor and The in-person courses, added to and more fresh out to watch MasterClass expert) has the Armory’s array of virtual class- had a stream of films that es, is designed with weekly themes speak to the truth. True and age-appropriate activities invites to the times. True to his young artists to create, learn and get voice. True to his cause. social through Aug. 7. “Do The Right Thing” In-person courses for junior artists (1989), “Mo’ Better Blues” and teens start June 29, with cours- (1990), “Malcolm X” es offered in digital media, ceram- (1992), “Chi-Raq” (2015), ics, jewelry, sculpture, costume “Michael Jackson’s Jour- design. The Armory’s all-new Kin- ney from Motown to derArt course, for kids aged 4-5, will Off the Wall” (2016) and not be offered live and in-person; it six-time Oscar nominated will remain virtual. “BlacKkKlansman” (2018), to name Adult artists can choose from a just a few, have catapulted Lee to variety of hands-on courses set to being known as one of the most suc- begin in person, at the Armory on cessful and recognizable directors of July 6. our era. (Watch all of these films.) Set The Armory will follow CDC NETFLIX IMAGE to head the Cannes Film Festival jury guidelines regarding sanitation, tem- Spike Lee with the cast on the set of “Da 5 Bloods,” which this year (which was cancelled, so he perature checks, masks and social comes to Netflix June 12. will do it next year), he is poised to be distancing measures. Its galleries will remain closed until a later date, to be determined. SEE STREAM, A26 X Weeklong sessions in June offer artists hands-on exploration of vari- ous creative, diverse techniques, and opportunities to sharpen skills Florida Weekly arts writer wins playwriting contest and tap into new interests. Cours- es offered in the Armory’s in-per- BY ROGER WILLIAMS writing. ductions, the Laboratory Theater of son, and virtual studios through- rwilliams@fl oridaweekly.com Her one-act Florida, in Fort Myers. out the summer, include the new drama, “Rest Stops The play details the experience of program KinderArt for children Nancy Stetson, Florida Weekly’s of America,” took two formerly estranged sisters, Ruby 4-5 years old (virtual courses once longtime arts and entertainment the prize in a crowd- and Pearl, who embark together on a week only); and drawing, jewelry reporter, has begun making stuff up. ed competition of a cross-country journey by car to making, painting, digital media, and Fabrication is anathema to jour- veteran playwrights find someplace to spread the ashes of more for junior artists, teens and nalists, but Ms. Stetson, winner of judged blindly, Ruby’s late husband. adults. numerous awards for her insightful, hosted by a regional “Ruby is feeling somewhat lost Weekly themes for junior artists fact-centric reporting, recently was STETSON and cultural power- in life. It’s about that relationship named winner of The Louise Wiggles- house in stage pro- worth Award for Excellence in Play- SEE WRITING, A25 X SEE HAPPENINGS, A24 X PALM BEACH FLORIDA WEEKLY www.FloridaWeekly.com WEEK OF JUNE 4-10, 2020 ARTS & ENTERTAINMENT A23 COLLECTOR’S CORNER The eyes have it with this doll; vase takes a cue from Mae West

palette in her left hand. She’s clearly The doll clearly has had a quite pleased with the painting she once rough go of it — the cos- held in her right hand — tume is spotted from years of Scott SIMMONS alas, the picture has van- improper storage. But, oh, the ished. She’s also quite stories it could tell. [email protected] pleased with herself, One thing is for sure: It’s defi- hence the humor of nitely an eyeful. Beauty is in the eye of the beholder. the piece. So said my mother to me when I was But this latest find, Pottery part 9 or 10 and lending a critical eye to for which I paid $3 of family history something in an antiques shop. at Fleamaster’s in Fort Ron Risner, a Palm Beach That axiom always has Myers, is a doctor. County resident, is descended stuck in my hind brain and I first thought it was a from the Ransbottom family that I’ve thought of it when- dentist, holding a tray was part of the famous Robinson ever someone has shared of teeth. Turns out, Ransbottom Pottery of Ohio. a decorative item or a col- it’s a physician of “I have an 18-inch-tall Mae West lection that was not to my some sort holding handpainted vase in the Sun and Moon taste. a tray of eyeballs pattern,” he writes. “The vase is named It came to me again this and grasping after her because it is bosom shaped.” winter, after I purchased another eye- It certainly is curvaceous. a Klumpe doll, made in ball in a pair It’s part of Mr. Risner’s history. Spain in the 1950s or of large for- “The Mae West vase was given to ’60s. ceps. me by my Uncle Jr and Aunt Lexie in Many of the dolls One can pon- Indiana because they know I am a gene- are so ugly, they’re der the imagery and look alogy guy. He was a direct descendant cute. back half a century to and he too liked genealogy,” he writes. But the details — 1950s Spain, then marking “Aunt Lexie will be 92 in October and is the painting of the 20 years under the dicta- going strong. She likes genealogy, too.” faces, the costum- torship of Francisco Fran- ing — are quite nice. co. It also was a time in Share your treasures! And the facial expres- which Surrealist artist Salva- Please email a clear photo to COURTESY PHOTO sions are beautifully dor Dali enjoyed international [email protected] and tell Ron Risner’s Robinson Ransbottom Pottery painted and can be quite fame, despite the dictatorship. me the story of how you acquired the “Mae West” vase evokes the film star’s hourglass figure. It’s about 18 inches tall and witty. piece and what makes it interesting or SCOTT SIMMONS / FLORIDA WEEKLY was made in Ohio. I acquired one doll last This Klumpe doll was made in special to you. I will share these with year. It depicts an art- Barcelona between the 1950s and other readers — think of it as show and ist — a tall, lean woman 1970. It measures about 10 inches tell in the time of social distancing. ■ in capri pants holding a tall. A24 ARTS & ENTERTAINMENT WEEK OF JUNE 4-10, 2020 www.FloridaWeekly.com PALM BEACH FLORIDA WEEKLY

chase general admission tickets using a HAPPENINGS credit card or PayPal and will be lim- Wrapping up Round 3 ited to four tickets per purchase. Walk- From page 22 up ticket sales will not be permitted BY CINDY PIERCE until further notice. The museum also cpierce@fl oridaweekly.com is adopting timed entry. All visitors will ages 6-11 include “Wonderful Wizards be required to choose their entry date Round 3 of the 10th annual Florida & Unicorns,” “Gaming Geeks,” “Mad and time when prepurchasing general Weekly Writing Challenge continues this Scientists Meet Art” and “Buggin’ Out.” admission tickets. week. Participants are encouraged to regis- General admission tickets are avail- The challenge invites you to craft short ter for as many weeks as desired; $20 able for advance purchase now. stories based on photo prompts selected discount provided for multiple enroll- As part of the museum’s new pro- by our editors. ments within immediate families, or tocols, visitors (both children and You have until 5 p.m. Sunday, June 7, to for one camper over multiple weeks. adults) touring the property will now send us your original fiction inspired by the PHOTO JANE PIERCE / COURTESY Tuition assistance may be available, be required to follow a one-way, fixed photos shown here. Next week’s paper will upon approval. route, starting with a contactless point have two new prompts for Round 4, and For a full list of classes, and to register, of entry. Because of social distancing we’ll continue with a new round every two visit www.armoryart.org. guidelines, group and docent-led tours weeks. We hope you step up and write to have been replaced with self-guided whichever prompts stir your creative muse. Flagler Museum to reopen tour options. Just be sure to do it by the deadline specified The Henry Morrison Flagler Museum As it was before the closure, the visi- for each round. announced it will reopen to the public tor experience will continue to include We haven’t declared an end date ERIC STRACHAN PHOTO on Tuesday, June 9, after a brief closure the first and second floors of White- (although you can count on the challenge because of the COVID-19 pandemic. hall, its grounds and the Flagler Kenan going through summer and early fall at word count. And no poetry, thank you. “We are proud of our strong reputa- Pavilion, which houses Flagler’s Railcar least) or a grand prize yet (last year’s first- Use upper and lower case, never ALL tion as a pristine and beautifully main- No. 91. The Exhibition Gallery on the place winner had her choice of an online CAPS. tained institution, which has stood the second floor also will be open, as the Gotham Writers Workshop course, about Run every entry through Spellcheck. test of time as a symbol of history museum’s winter exhibition, “Walk This a $500 value). Ideally, have a real person other than and accomplishment,” Erin Manning, Way: Historic Footwear from the Stuart And who knows? We might print some yourself proofread it, too. Once you send the Flagler Museum’s executive direc- Weitzman Collection,” has been extend- of our favorites during the course of the it in, corrections or revisions won’t be tor, said in a statement. “During this ed until further notice. challenge, instead of waiting until the accepted. period of closure, we have identified a All visitors over the age of 2 must whole thing wraps up to share. Put a brief description of the photo that new purpose — to provide safe spaces bring their own mask or face covering, The Writing Challenge has grown inspired each entry — for example, “cem- for our community to enjoy and learn which will be required for entry. Masks every year, with last year’s total of four etery in fall” or “crossing the street” for and connect. or face coverings must be worn at all photo prompts motivating more than 300 this round’s prompts — at the top (just in To manage traffic flow and ensure the times by all visitors, who must practice writers from far and wide. Many were case it’s not obvious to our editors). Also safety of visitors, the museum has modi- safe social distancing of 6 feet while in repeat participants from earlier years, and at the top: your full name, phone number, fied its hours of operation to Tuesday the presence of others. we hope to hear from them again this year. email address and city/state you live in. through Saturday, from 10 a.m. to 4 p.m. For more information, call the Flagler We especially would like to hear from the Give your masterpiece a title and then until further notice. Museum at 561-655-2833 or visit www. gifted writer who turned in a really great email it, either attached as a Word docu- All visitors will be required to prepur- flaglermuseum.us. ■ story that, at 1,000-plus words, was dis- ment or simply pasted into the message qualified because it exceeded the word area, to [email protected]. count. This is important: Put the words So here’s how it works: WRITING CHALLENGE in the subject In each round, you can submit one line of your email. You will receive an story or two, but only one for each photo acknowledgment of receipt. — and nothing that combines the prompts Snail mail offerings cannot be consid- into one story. ered. Keep your entries to a maximum of 750 Questions? Email cpierce@flori- words each, please. There is no minimum daweekly.com. We’ll get back to you. ■ PUZZLE ANSWERS

COURTESY PHOTO Painting at Summer Camp Armory Art Center asdf asdf sdf asdf adsfdas fadsf dsaf dsf sd. THE DELIVERY DISH: Highlights from local takeout menus

The Dish: Chicken Basil The Place: Thai Lotus, 12100 U.S. The chicken basil dish was loaded Highway 1, North Palm Beach; 561-626- with plenty of vegetables — onions, 8218 or www.thailotusflorida.com. mushrooms, peas, red and green pep- The Prices: $8.95. pers and zucchini — plus plenty of its The Details: Here’s the great thing namesake poultry, all cooked tender. about much of the Thai fare offered in The basil sauce was aromatic, suf- our area. fusing my car and my office with its It’s fresh. It’s flavorful. And, for the delicate scent and making me forget, for most part, it’s good for you. a moment, about all that’s troubling the It was with that in mind that I did take- world. ■ out for lunch from Thai Lotus, which is — Scott Simmons, just up the road from my office. [email protected]

SCOTT SIMMONS / FLORIDA WEEKLY PALM BEACH FLORIDA WEEKLY www.FloridaWeekly.com WEEK OF JUNE 4-10, 2020 ARTS & ENTERTAINMENT A25 WRITING CONTRACT BRIDGE From page 22 Famous hand between two sisters and that feeling of being lost,” Ms. Stetson explained. BY STEVE BECKER Born and raised in the Bay Ridge neighborhood of Brooklyn, Ms. Stet- Not all deals played in tourna- son has three older brothers she visits ments are models of efficiency. The each year. She spends many hours in plain fact is that some deals serve a car with one who moved to New better as examples of inefficiency, as England, she said. demonstrated by this case from the “The conversation goes all over the World Pair Championship in 1966. place when we’re together. Things The final contract at most tables that happened when we were young, was four hearts, which was virtually current events, something funny, or a a laydown. But our story concerns movie. I was hoping to try to capture itself with the table where — believe that — the way siblings talk.” it or not — the bidding went as She did, and with little previous shown, and South got to six hearts. experience as a playwright. Luckily for declarer, West’s open- “Artistically, it’s a great example of ing lead was the jack of diamonds narrative storytelling. The charac- rather than a club. Seizing this ters are relatable and their story is golden opportunity, South played interesting and truthful. And tech- dummy’s queen, which won, and nically it’s well structured, with a continued with the ace, discarding strong character arc for the protago- the 10-8 of clubs from his hand. nist,” said Annette Trossbach, found- Declarer now could have made the MILA BRIDGER / FLORIDA WEEKLY er and producing artistic director of slam, but he fell from grace when he Florida Weekly’s longtime arts and entertain- led the jack of spades from dummy the Lab Theater. “She’s been at this ment reporter Nancy Stetson was named and finessed. for less than two years. I’m so pleased winner of The Louise Wigglesworth Award for West won with the king and for her.” Excellence in Playwriting. But Ms. Stetson has frequented the returned the king of diamonds, Lab Theater, sitting in the audience for The News-Press in Fort Myers allowing East to shed his remaining seats in front of the stage, since its who also fabricates for the stage, spade, and there was now no way inception 12 years ago. with another former reporter, Franc- for declarer to make the slam. When “I estimate I see over 60 plays esca Donlan, had first encouraged Ms. South ruffed the diamond return a year for my job as an arts and Stetson to take the playwriting class, and played the ace of spades, planning at trick three was totally unnecessary. entertainment writer and critic, and I as they had done. to trump the eight of spades with the Instead, declarer should have led the nine enjoy seeing them and writing about “Melanie had said the same exact ace on the next round, East ruffed to put of spades to the ace and returned a low them and analyzing them. I don’t do thing the first time she had to do an the contract down one. spade to dummy’s jack. West would win it because I secretly want to write assignment,” Ms. Stetson admitted. Perhaps justice was served by the out- with the king, but regardless of his return, plays,” she acknowledged. “As journalists, we’re taught to get the come, but it is nevertheless clear that declarer could not be stopped from ruff- Ms. Wigglesworth, a playwright and facts, and to never make anything up. South should have made the slam after the ing the spade eight with dummy’s ace and actor for whom the competition is So it really went against the grain of opening diamond lead. The spade finesse scoring the rest of the tricks. ■ named, was one of the judges — and my training.” also the first teacher Ms. Stetson had Laurie Lorusso, a Naples-based when friends talked her into taking a playwright and actor, taught the most writing class and trying her hand. At recent class Ms. Stetson joined and that point she’d been writing about worked with her as she developed the arts for newspapers in New York, “Rest Stops of America.” Chicago and Southwest Florida for Her talent, Ms. Lorusso said, lies almost 30 years. in her capacity to see and create “The play is just an outstanding characters, and to fashion dialogue example of the storytelling art. And so seemingly real that a person could with Lab Theater doing a lot more hear it on the street without realizing virtual work, it shaped the way Nancy it wasn’t real. wrote the play,” Ms. Wigglesworth “The essence of a good story starts said. “It’s mostly telling, not show- with characters, and they have to be ing.” relatable so the audience can sym- Since the competition was “blind” pathize with them,” Ms. Lorusso for the judges, Ms. Wigglesworth, explained. who lives in Maryland, had no idea “Someone who writes learns to pay who’d written “Rest Stops of Amer- attention to that. She’s been a writer ica.” for so long, and she pays attention Ms. Stetson will now polish the play so closely to everything, I think she in workshops before the Lab Theater doesn’t even realize she’s doing it. produces it. Previously, she’s written She just has a very good ear for the two 10-minute plays for the Lab The- characters and their dialogue. That’s ater’s Festival of Tens and another hard to write. You can have good short drama for the new Tiny The- ideas, good characters, but if you atre, described as “live professional can’t write the dialogue, you won’t theatre in the time of self-isolation have a good play.” brought to you by husband and wife And now, Ms. Stetson joins the team, Brendan Powers and Rachel ranks of those who may be hearing Here’s to the people, voices in their heads. places and things that make Burttram,” who broadcast their work our area so special from home. “After a while, I discovered that it’s She first took a playwriting class, true, what some novelists and play- she said, because “I want to be open wrights have told me: Characters do

COVER ART BY NAOMI MILLER to new experiences. I thought this show up and start talking to you. Or, COVER ART BY XXXXXXXXXXXXXXX could be helpful in teaching me about they start talking to each other, and Florida Weekly’s Best Awards - The FlFlamingosamingos 20220200 plays from the inside. At the very let you eavesdrop,” she said. / ˆÃʈÃʜÕÀÊÌ>Žiʜ˜ÊܓiʜvÊÌ iÊLiÃÌ]ʜvÊVœÕÀÃi]ÊLÕÌÊ>ÃœÊܓiʜvÊÌ iÊÜ>VŽˆiÃÌ]ʓœÃÌÊܜ˜`ÀœÕÃ]Ê least, it could help me with my writ- “To work with someone like Nancy, >˜`ÊiÛi˜ÊÃV>˜`>œÕÃÊ«iœ«iÊ>˜`ÊÌ ˆ˜}ÃÊÌ >Ìʓ>ŽiʜÕÀÊ>Ài>ÊÃÕV Ê>Ê}Ài>ÌÊ«>ViÊ̜ʏˆÛi° ing.” or with Melanie Payne — still deeply But in the beginning, it didn’t feel involved in their careers — for them DEADLINES/DATES right to write plays. to be spreading their wings and try- *ÕLˆV>̈œ˜Ê >ÌiÃ\ÊœÀÌÊ ÞiÀÃ\ÊJULY 22, 2020 “The first time Louise Wiggles- ing a whole different kind of writing >«iÃÉ œ˜ˆÌ>Ê-«Àˆ˜}Ã]Ê >ÀœÌÌiÊ œÕ˜ÌÞ]Ê>˜`Ê*>“Ê i>V \ÊJULY 23, 2020 -«>ViÉ Ài>̈Ûi\ÊJUNE 24, 2020 by 5 p.m°ÊÊÊÊ >“iÀ>ÊÀi>`ÞÊ>`Ã\ÊJULY 8, 2020 by 4 p.m° worth gave me an assignment, she is very exciting for a teacher. Very told me to write a scene between two exciting for me,” Ms. Wigglesworth Contact your Account Executive today! people talking to each other. I looked said. “I feel like I’m pushing them off at her and said, ‘You mean, MAKE the cliff and saying, ‘Now, I want to IT UP???!’ I was kind of appalled. It see you fly.’” was a gut reaction. I said it without Nancy Stetson is good with that. “I did it to challenge myself, because Fort MyersÊUÊÓn™£Ê i˜ÌiÀÊ*œˆ˜ÌiÊ ÀˆÛi]Ê-ՈÌiÊÎääÊUÊœÀÌÊ ÞiÀÃ]ÊÊÎΙ£ÈÊUÊÓΙ°ÎÎΰӣÎxÊ thinking. And Melanie (Payne) start- Naples/Bonita SpringÃÊUʙäx£Ê/>“ˆ>“ˆÊ/À>ˆÊ œÀÌ ]Ê-ՈÌiÊÓäÓÊUÊ >«iÃ]ÊÊÎ{£änÊUÊÓΙ°ÎÓx°£™ÈäÊ ed laughing.” I was curious. But I didn’t know I Charlotte CountyÊUÊ£ÓäxÊ ˆâ>LiÌ Ê-ÌÀiiÌ]Ê-ՈÌiÊÊUÊ*՘Ì>ÊœÀ`>]ÊÊÎΙxäÊUʙ{£°ÈÓ£°Î{ÓÓÊ Ms. Payne, an investigative reporter would love this as much as I do.” ■ Palm Beach CountyÊUÊ£ÓÓ{Ê1°-°Êˆ} Ü>ÞÊ£]Ê-ՈÌiÊ
ÊUÊ œÀÌ Ê*>“Ê i>V ]ÊÊÎÎ{änÊUÊxÈ£°™ä{°È{ÇäÊ œÀÊۈÈÌʜ˜ˆ˜iÊ>ÌÊÜÜÜ°œÀˆ`>7iiŽÞ°Vœ“ A26 ARTS & ENTERTAINMENT WEEK OF JUNE 4-10, 2020 www.FloridaWeekly.com PALM BEACH FLORIDA WEEKLY STREAM From page 22 the first black person to lead the jury in its 73-year history. His latest film “Da 5 Bloods” is a story about four African-American veter- ans — Paul (Delroy Lindo), Otis (Clarke Peters), Eddie (Norm Lewis) and Mel- vin (Isiah Whitlock Jr.) — who bond as they fight side by side during the Vietnam war, returning decades later to find the remains of their fallen squad leader (Chadwick Boseman) and a for- tune in gold he helped them hide. Start- ing with photos and footage confronting America’s prejudiced past (think the last few minutes of “BlacKkKlansman”), Lee proves again his ability to powerfully move an audience with an unequaled gift of storytelling and editing. (In addition to being a talented creative genius, Lee has proven his works to be based on what is historically factual, as well as being recognized as a huge voice for social justice.) “I’m a big historian,” Lee said. “I was taught that African-Americans fought for this country from day one.” Co-written by Lee with Danny Bilson, NETFLIX IMAGE Paul DeMeo and Kevin Willmott, the Isiah Whitlock Jr. as Melvin, Norm Lewis as Eddie, Clarke Peters as Otis, Delroy Lindo as Paul, Jonathan Majors as David in Spike Lee’s new film film, shot on location in the cities of Chi- “Da 5 Bloods,” set to stream on Netflix June 12. ang Mai, Bangkok and Ho Chi Minh City, is set to premiere June 12 on Netflix. ■ “Artemis Fowl” Drawing inspiration from war-themed Disney+ brings “Artemis Fowl” to stream- classics like “Bridge on the River Kwai,” ing June 12. Based on the book by Eoin “The Treasure of the Sierra Madre” and Colfer, the film follows 12-year-old boy “Apocalypse Now,” Lee used a distinctly genius Artemis Fowl on a spellbinding different approach. journey through underground civilizations, “No disrespect to any film that’s been fairy lands and ultimately the Aculos, a done before about the Vietnam War, but powerful magical device, to save his father, we wanted to do this through the per- who has been kid- spective of the black soldiers … we knew napped. The adven- that we had not seen brothers like this in ture climaxes in a war a Vietnam film.” of the wits with the The film offers a powerful and emo- most powerful fairies tional narrative, confronting America’s around. The family racist history while celebrating the patri- fantasy film directed otism of African-American soldiers on by Kenneth Branagh the frontlines of the Vietnam War with stars Ferdia Shaw, relatable, imperfect heroes. Six songs Lara McDonnell, Josh from Marvin Gaye’s “What’s Going On” Gad, Tamara Smart, album are also featured in the film. Nonso Anozie, Josh Lee’s past contributions have also McGuire and Nikesh included less serious television commer- Patel, with Adrian Scarborough, Colin Far- cials, most famously with Michael Jordan NETFLIX IMAGE rell and Judi Dench. PG. 1h 55m. in Nike’s Air Jordan campaign (“Is it Anna Brewster as Shelby Dupree in “Last Days Of American Crime” set to stream June 10 on Netflix. the shoes?”) as well as commercials for ■ “The King of Staten Island” Converse, Taco Bell and Ben & Jerry’s. Directed, written a masterpiece in the movie “You Don’t Originally set to open the 2020 SXSW His production company, 40 Acres and and starring Damon Nomi,” complete with archival footage Film Festival (which was cancelled) and a Mule Filmworks, is located in Fort Gameau, the film from the original picture, interviews with also slated for a public celebration at Greene, Lee’s childhood neighborhood in looks at how envi- the bigger players involved in its cre- Tribeca (also cancelled), this film from Brooklyn. R; 2h 34m. ronmental concerns ation and conversations with cinephiles director Judd Apatow (“Trainwreck,” Here are a few more fresh-to-stream- could be addressed regarding the raw appeal. After taking “Knocked Up” and “The 40-Year-Old Vir- ing selections for consideration: to provide the film- the film festival route in 2019, including gin”) stars Saturday Night Live break- maker’s daughter the prestigious Tribeca Film Festival, the out Pete Davidson. ■ “Spelling the Dream” a more hopeful doc’s premiere to streaming is planned “The King of Staten Directed by Sarasota native and film- future. Releasing in for June 9. 1h 32m. Island,” a comedy maker Sam Rega, this film played at the virtual theaters on about love, loss, Denver and Cleveland film festivals in June 5. 1h 32m. ■ “The Last Days of American mental health and 2018. It follows four Crime” laughter on Staten students as they Island, will now ■ “You Don’t Nomi” How could America ever part with compete to realize premiere on VOD Some say “Showgirls,” an erotic drama crime? In this Netflix action thriller slat- their dream of win- June 12. In a story film directed by Paul Verhoeven and ed to stream June 10, the U.S. government ning the prestigious very close to the starring Elizabeth Berkley, was one of has managed to devise the broadcast Scripps National life of Davidson, the worst movies ever made. Total trash of an invisible sig- Spelling Bee. Follow his character Scott, even. Despite nal, which makes their journey with who lost his fire- being the biggest it impossible to do perspectives from fighter father when NC-17 movie ever anything unlawful CNN’s Dr. Sanjay he was seven, has reached his mid-20s, released, it was or illegal. Enter Gra- Gupta and Fareed achieving little but dreaming of starting a nominated for 13 ham Bricke (played Zakaria, comedian tattoo restaurant. Living with his exhaust- Razzie Awards. by Edgar Ramírez), Hari Kondabolu, ed ER nurse mother (Marisa Tomei) Film critic Roger a career criminal ESPN’s Kevin Negandhi (1999 Scripps and spending most days hanging with Ebert may have who teams up with National Spelling Bee winner), and more the guys smoking weed, his life changes summed up the gangster Kevin Cash as the doc set to stream on Netflix June when a firefighter named Ray (Bill Burr) public and profes- (Michael C. Pitt) 3 explores the reasons why the competi- enters his life. Also starring Steve Bus- sional sentiment and Shelby Dupree tion has been won by Indian-Americans cemi as Papa, a veteran firefighter who in one of the more (Anna Brewster) to for the last 12 years. 1h 22m. takes Scott under his wing, Bel Powley positive reviews journey to commit the last, and larg- and Pamela Adlon. The film’s executive when he said, “The est, criminal heist before the signal goes ■ “2040” producers are Pete Davidson, Michael film is not, in short, quite unredeem- live. Directed by Olivier Megaton and Having played Seattle, Stockholm, Ber- Bederman and Judah Miller. R; 2h 16m. ■ ably bad.” Still, after the wild outpour- based on the “Radical Publishing Graphic lin and Gold Coast Film Festivals, “2040” ing of cult adoration and some kind Novel” created by Rick Remender and is a documentary that takes an inspi- — Eric Raddatz is the presentation edi- of redemption soon following, director Greg Tocchini, it also co-stars Patrick rational look at what a journey to the tor at Florida Weekly, host of the indie Jeffrey McHale takes a hard look as to Bergin and Sharlto Copley. 2h 20m. future might look like — if we embraced why “Showgirls” may now be considered film series T.G.I.M. and the founder of smart solutions for our planet today. Fort Myers Film Festival. PALM BEACH FLORIDA WEEKLY www.FloridaWeekly.com WEEK OF JUNE 4-10, 2020 ARTS & ENTERTAINMENT A27 PUZZLES FALL NICKNAME ▼ SEE ANSWERS, A24 HOROSCOPES SUDOKU GEMINI (May 21 to June 20) suddenly re-emerged could take a big Aquarians might find themselves feel- Difficulty level: Shyness might keep you from asking toll on your emotional energies. Decide ing an acquisitive urge. If so, indulge it. for more information on a potentially whether you really want to pursue the You’ve earned the right to treat yourself ★ ★ important matter. But your curiosity possibilities here. to wonderful things. Place a number in the empty boxes in such a way that grows stronger by midweek and gives each row across, each column down and each small 9-box SCORPIO (October 23 to PISCES (February 19 to March 20) square contains all of the numbers from one to nine. you the impetus for data-gathering. November 21) For all your skill in Expect to get a lot of advice on how to CANCER (June 21 to July 22) Tak- keeping your secrets safe, you could go about implementing your plans. But By Linda Thistle ing on too many tasks may not be the be unwittingly letting one slip out by once you’ve sorted it all out, you’ll prob- wise thing to do at this time. You might the way you’re behaving in that new ably find that, once again, your way will overspend both your physical and emo- relationship. Are congratulations be the best way. soon to be in order? tional energy reserves, and have to miss ARIES (March 21 to April 19) Still out on some upcoming events. SAGITTARIUS (November 22 to operating under a full head of self- LEO (July 23 to August 22) Try to December 21) Good old-fashioned esteem makes you want to tackle a keep your spending at an affordable horse sense could help you get around matter you had shied away from. OK. level. Splurging now — especially on those who unknowingly or deliberately But be sure to arm yourself with facts credit — could create a problem if your put obstacles in your way. Ignore the before you make a move. confusion and follow your own lead. finances are too low for you to take TAURUS (April 20 to May 20) advantage of a possible opportunity. CAPRICORN (December 22 That smart move you recently made VIRGO (August 23 to September to January 19) A puzzling attitude caught the attention of a lot of people, 22) You might not approve of a col- change in a colleague from friendly to including some with financial deals to league’s behavior during much of the chilly might stem from a long-hidden offer. Use your Taurean wariness to week. But don’t play the judgmental resentment suddenly bubbling up. An check them out thoroughly. open and honest talk should resolve Virgo card here. As always, check the BORN THIS WEEK: You enjoy the the problem. facts before you assume the worst. quiet times of your life, but when you’re LIBRA (September 23 to October AQUARIUS (January 20 to Febru- in the mood, you can throw a party ▼ 22) Coping with an old issue that has ary 18) This week, many ever-generous everyone will want to go to. ■ SEE ANSWERS, A24 COMMUNITY RESOURCE

)NQTKFC 4G1RGPKPI %75á0(55 (8(065 72'$6(5

Florida Weekly is dedicated to serving our communities in a constructive role during this time of need. To inform the community, Florida Weekly has set up a free Florida Re-Opening Resource website on businesses and events that are opening.

www.floridaweekly.com/wearehere

Visit this site to get the latest information on real-time updates on businesses and events.