DOCSLIB.ORG

Posttranslational Regulation of the Fanconi Anemia Cancer Susceptibility Pathway

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text

Load more

DNA repair interest group 04/21/15 Posttranslational Regulation of the Fanconi Anemia Cancer Susceptibility Pathway Assistant professor Department of Pharmacological Sciences Stony Brook University Hyungjin Kim, Ph.D. DNA Repair System Preserves Genome Stability DNA DAMAGE X-rays DNA DAMAGE Oxygen radicals UV light X-rays RESPONSE Alkylating agents Polycyclic aromatic Anti-tumor agents Replication Spontaneous reactions hydrocarbons (cisplatin, MMC) errors Cell-cycle arrest Cell death Uracil DNA REPAIR Abasic site (6-4)PP Interstrand cross-link Base pair mismatch DEFECT 8-Oxiguanine Bulky adduct Double-strand break Insertion/deletion Single-strand break CPD Cancer • Mutations • Chromosome Base- Nucleotide- Fanconi anemia (FA) aberrations Mismatch excision repair excision repair pathway repair (BER) (NER) HR/NHEJ DNA REPAIR Adapted from Hoeijmakers (2001) Nature DNA Repair Mechanism as a Tumor Suppressor Network Cancer is a disease of DNA repair Environmental Mutagen Oncogenic Stress • Hereditary cancers: mutations in DNA repair genes (BRCA1, BRCA2, MSH2, etc) DNA damage response Checkpoint, • Sporadic cancers: DNA repair - Oncogene-induced replication stress - Inaccurate DNA repair caused by selection of somatic mutations in DNA repair genes Tumorigenesis Genome instability Germ-line and Somatic Disruption of DNA Repair Is Prevalent in Cancer The Cancer Genome Atlas (TCGA): Genomic characterization and sequence analysis of various tumors from patient samples TCGA network, (2011) Nature Clinical and Cellular Features of Fanconi Anemia (FA) Fanconi Anemia Chromosome instability syndrome Mutation in 17 genes that Disease of defective DNA repair cooperate in DNA interstrand cross-link (ICL) repair Model for cancer pathogenesis i.e. the FA pathway Developmental defect Bone marrow failure Increased cancer risks AML The Seventeen Fanconi Anemia Genes in the FA/BRCA Pathway 17 FANC genes! (Complementation group)! FANCA Frequencies of FA complementation group mutations! FANCB FANCC PALB2/ RAD51C/ FANCM FANCD1 BRIP1/ FANCN FANCO FANCD2 FANCJ FANCL SLX4/FANCP FANCI FANCE FANCF XPF/FANCQ BRCA1/FANCS FANCF FANCE FANCG FANCG FANCD2 FANCI BRCA2/ FANCJ FANCD1 FANCL FANCC FANCM 60-70%! FANCN FANCO FANCA FANCP FANCB FANCQ FANCS The FA Pathway Regulates Interstrand Cross-link (ICL) Repair I D2 FA A core I D2 HR J ICL O D1 S N Ub A I XPF (Q) RAD51 D2 Ub ERCC1 NER SLX4 (P) MUS81 EME1 Nucleolytic Incision USP1 I UAF1 D2 I D2 TLS Pol. Translesion DNA synthesis (REV1, Pol ζ) (TLS) Kim & D’Andrea (2012) Genes & Dev Regulation of FANCD2 Mono- and De-Ubiquitination Ub FA D2 Core I USP1: Deubiquitinating enzyme FANCD2-L: FANCD2-Ub + damage α FANCD2 IF Garcia-Higuera et al., (2001) Mol. Cell Kim et al., (2009) Dev. Cell Ubiquitin Signaling Fanconi Anemia DNA Repair Process Cancer Pathogenesis Bioinformatic Search of UBZ4-Containing Proteins UBD: Ubiquitin Binding Domain UBZ4 domain from TLS polymerase κ Ub Target Target QILTCPVCFRAQGCISLEALNKHVDECLDGPS UBD Hidden Markov Model (HMM) Polκ-1 UBZ4 (Ub-Binding Zn-finger 4) Polκ-2 RAD18 SLX4-1 SLX4-2 FAN1 RAP80 SNM1A Ub UBZ4 #1 UBZ4 #2 UBZ4 #3 FAAP20 Predominantly found in DNA repair factors FAAP20 Regulates FANCD2 Activation in the FA Pathway FAAP20 (C1orf86): Fanconi anemia-associated protein 20 kD FAAP20 1 180 a.a. E3 ligase UBZ4 Ub FA D2 Core I * * FANCA: FAAP20 HU FANCD2 DAPI si Control si C1orf86 The FAAP20-FANCA Interaction Is Required for Maintaining FANCA Level Flag-FAAP20 UBZ4 wt ΔC ΔN siRNA FAAP20 + siRNA resistant cDNA FANCA interaction siRNA Ctrl F20 #3 F20 #3 F20 #3 F20 #3 pre-IP α-Flag IP - - wt ΔC ΔN Flag-FAAP20 kD - wt ΔC ΔN - wt ΔC ΔN Flag-FAAP20 kD 150- FANCA 150- FANCA β-actin 37- IgL 25- 25- Flag-FAAP20 Flag-FAAP20 Flag-FAAP20 ΔC 20- Flag-FAAP20 ΔC 20- Flag-FAAP20 ΔN 15- Flag-FAAP20 ΔN 1 2 3 4 5 6 7 8 FAAP20 Connects the FA Pathway with Translesion DNA Synthesis ICL Recognition Ub FA Core complex 1) Nucleolytic FA Core D2/I FAAP20 Incision Ub UBZ4 (C) N A FANCP FAAP20 Ub Rev1 Recruitment D2 Monoubiquitination REV1 3) HR Pol ζ 2) TLS Nucleotide adduct bypass by TLS Nucleolytic Incision Replication-associated HR Kim et al., (2012) Nat. Struc. Mol. Biol. Solution Structure of the FAAP20-Ubiquitin Complex The disordered C-terminal tail of FAAP20 is involved in ubiquitin binding FAAP20 UBZ Tail C150 C170 H166 C147 Wojtaszek et al., (2014) Nucleic Acids Res. The Very C-terminal Tryptophan Is Required for Ubiquitin Binding Isothermal Titration Calorimetry (ITC) The Very C-terminal Tryptophan Is Required for DNA ICL Repair * * * * CA: C147A & C150A * WA: W180A * * Ubiquitin Recognition of FAAP20 Is Distinct from Canonical UBZ Module Unconventional FAAP20 UBZ motif Regulation of the FA Pathway by the FANCA-FAAP20 Axis A 20 FA Core E3 ligase FAAP20 FANCA E3 ligase 150 kD Ø Mechanism of maintaining FANCA stability by FAAP20? Ø Mechanism of FANCA degradation and its implication in tumorigenesis? Characterization of a FA-like Breast Cancer Patient Ø 33 year-old triple negative breast cancer (TNBC) patient (not a FA patient per se) Ø Features of FA (i.e. short stature, café au la spot, mild macrocytic anemia) DF2231 DF2231 20 ng/mL MMC Quadriradial chromosome Characterization of a FA-like Breast Cancer Patient MMC 1.2 FANCD2 1 FANCD2 + DAPI 0.8 0.6 GM0637 Survival 0.4 GM0357GM0637 0.2 FA-I DF2231 0 DF2231 0 12.5 25 MMC (nM) Upstream defect The I939S Point Mutation in Patient FANCA Destabilizes FANCA FANCA gene FAAP20 2816T>G; Ile939Ser 2840C>G; Ser947stop (Savoia et al. 1996, Levran et al. 1997, 1st allele 2nd allele Savino et al. 2003) 1.2 DF2231+Vector DF2231+FANCA 1 GM0637 0.8 kD GM0637DF2231 0.6 FANCD2-Ub FANCD2 Survival 150- 0.4 150- FANCA 0.2 50- Tubulin 0 0 12.5 25 MMC (nM) The Amino Acid 913-1095 Region of FANCA Is Required for FAAP20 Interaction FANCA-I939S Mutation Disrupts FAAP20 Binding I939 FANCA FAAP20 Flag-FAAP20 Flag-FAAP20 myc-FANCA I939S-FANCA I939S-FANCA WT-FANCA WT-FANCA WT-FANCA WT-FANCA Myc Flag WCE Flag IP Identification of SUMOylation Site of FANCA Near the FAAP20 Binding Region Exon 28 Exon 29 Human Mouse Rat Chicken K921 I939 Regulation of Protein Stability by Coupled SUMO-Ubiquitin Signaling 1) RNF4 is a Ubiquitin E3 ligase which regulates the DNA damage response (Galanty, Y et al, Genes Dev 26, 2012; Yin, Y, et al, Genes Dev 26, 2012) 2) RNF4 is the human ortholog of the yeast proteins, Slx5 and Slx8 (discovered in the same screen which identified Slx4; SLX4/FANCP) STUbL (SUMO-Targeted Ubiquitin Ligase) S target S S S RNF4 Ub UbUb 1 190 RNF4 SIM RING SIM: SUMO-interacting motif FANCA from the Patient Shows Increased SUMOylation and Polyubiquitination FANCA SUMOylation at K921 Is Required for Polyubiquitination of FANCA UBC9 and PIAS1 Are Required for FANCA Sumoylation FANCA-K921R SUMO-Defective Mutant Exhibits Increased Half-life Cycloheximide blocking RNF4 Regulates FANCA Stability FANCA I939S + siRNF4 RNF4 Is a New Player in the FA Pathway Regulation of DNA ICL Repair by Integrated Ubiquitin-SUMO Signaling USP1 Ub UAF1 Ub D2 PIAS1 Ub Ub Ub I D2 S RNF4 A S S A I A M 20 20 20 ü FANCD2 deubiquitination (USP1) ü FANCM release ü FANCA degradation Regulation of DNA ICL Repair by Integrated Ubiquitin-SUMO Signaling Ub RNF4 loss S RNF4 S S A Aberrant FANCA 20 accumulation Delay of replication restart The FANC Proteins Are Predicted to be Extensively SUMOylated Mutational Hotspot of FANCA Corresponds to the FAAP20 Interacting Region FANCA gene mutations from 97 FA patients Levran et al., (1997) PNAS 221 FANCA mutations from 89 studies including TCGA cBioPortal for Cancer Genomics FANCA Mutations From FA and/or Cancer Patients Disrupt FAAP20 Interaction FANCA null FA patient cells + FANCA variants Conclusions 1. DNA repair mechanisms preserve genome integrity and their deregulation contributes to tumorigenesis 2. The FA pathway removes DNA ICL encountered during S phase, and its defect leads to cancer-prone disease, Fanconi anemia 3. Complex interplay of post-translational modification network including ubiquitination/ SUMOylation controls DNA repair pathways - FAAP20 ubiquitin binding in regulating ICL repair - FANCA degradation by Ubiquitin plus SUMO 4. Compound heterozygosity of FANCA leads to (or contribute to) TNBC - Disruption of the DNA repair activity (germ-line or somatic) could be a major driving force for tumorigenesis Acknowledgements Collaborators and Reagents DFCI Alan D’Andrea Lab Judy Garber, M.D. - FANCA patient Kailin Yang, Ph.D. - bioinformatics U. of Pittsburgh Donniphat Dejsuphong, M.D./Ph.D. - DT40 Shannon Puhalla, M.D. - FANCA patient Lisa Moreau – chromosome assay MIT Jenny Xie, Ph.D. - FANCA patient Graham C. Walker, Ph.D. - Rev1 structure Raphael Ceccaldi, Ph.D. – TCGA analysis Duke University Medical Center Pei Zhou, Ph.D. - Rev1 structure Kyoto University, Japan Hyungjin Kim Lab - Pharmacology Shunichi Takeda, Ph.D. - DT40 Ukhyun Jo, Ph.D. Miltenyi Biotech GmhH, Germany Jingming Wang Kay Hofmann, Ph.D. - Bioinformatics Soyoung Joo U. of Washington Winson Cai Ning Zheng, Ph.D. – DUB structure and function Funding Leukemia & Lymphoma Postdoctoral Fellowship Start-up funds - Stony Brook Cancer Center .
Recommended publications
  • Structure and Function of the Human Recq DNA Helicases

    Structure and Function of the Human Recq DNA Helicases

    Zurich Open Repository and Archive University of Zurich Main Library Strickhofstrasse 39 CH-8057 Zurich www.zora.uzh.ch Year: 2005 Structure and function of the human RecQ DNA helicases Garcia, P L Posted at the Zurich Open Repository and Archive, University of Zurich ZORA URL: https://doi.org/10.5167/uzh-34420 Dissertation Published Version Originally published at: Garcia, P L. Structure and function of the human RecQ DNA helicases. 2005, University of Zurich, Faculty of Science. Structure and Function of the Human RecQ DNA Helicases Dissertation zur Erlangung der naturwissenschaftlichen Doktorw¨urde (Dr. sc. nat.) vorgelegt der Mathematisch-naturwissenschaftlichen Fakultat¨ der Universitat¨ Z ¨urich von Patrick L. Garcia aus Unterseen BE Promotionskomitee Prof. Dr. Josef Jiricny (Vorsitz) Prof. Dr. Ulrich H ¨ubscher Dr. Pavel Janscak (Leitung der Dissertation) Z ¨urich, 2005 For my parents ii Summary The RecQ DNA helicases are highly conserved from bacteria to man and are required for the maintenance of genomic stability. All unicellular organisms contain a single RecQ helicase, whereas the number of RecQ homologues in higher organisms can vary. Mu- tations in the genes encoding three of the five human members of the RecQ family give rise to autosomal recessive disorders called Bloom syndrome, Werner syndrome and Rothmund-Thomson syndrome. These diseases manifest commonly with genomic in- stability and a high predisposition to cancer. However, the genetic alterations vary as well as the types of tumours in these syndromes. Furthermore, distinct clinical features are observed, like short stature and immunodeficiency in Bloom syndrome patients or premature ageing in Werner Syndrome patients. Also, the biochemical features of the human RecQ-like DNA helicases are diverse, pointing to different roles in the mainte- nance of genomic stability.
  • What Is Fanconi Anemia and How Is It Diagnosed

    What Is Fanconi Anemia and How Is It Diagnosed

    Fanconi anemia and its diagnosis: Fanconi anemia (FA), named for the Swiss pediatrician Guido Fanconi, is an inherited disorder that can lead to bone marrow failure (aplastic anemia), leukemia and/or solid tumors, with oral and gynecologic tumors being the most common. FA is almost exclusively a recessive disorder: if both parents carry a defect (mutation) in the same FA gene, each of their children has a 25% chance of inheriting the defective gene from both parents. When this happens, the child will have FA. While the total number of FA patients is not documented worldwide, scientists estimate that the carrier frequency (carriers are people carrying a defect in one copy of a particular FA gene, whose other copy of that same FA gene is normal) for FA in the U.S. is 1 in 181. The incidence rate, or the likelihood of a child being born with FA, is about 1 in 131,000 in the U.S., with approximately 31 babies born with FA each year. Scientists have now discovered 19 FA genes [FANCA, -B, -C, -D1 (also known as BRCA2), D2, E, F, G, I, J, L, M, N, O, P, Q, RAD51, BRCA1, and T]. Mutations in these genes account for more than 95% of reported Fanconi anemia cases. Mutations in FANCA, FANCC and FANCG are the most common and account for approximately 85% of FA patients worldwide. FANCD1, FANCD2, FANCE, FANCF and FANCL account for 10%, while the remaining FA genes, FANCB, FANCI, FANCJ, FANCM, FANCN, FANCO, FANCP, and FANCQ represent less than 5%. Some individuals with FA do not appear to have mutations in these 19 genes, so we anticipate that additional FA genes will be discovered in the future.
  • Regulation of DNA Cross-Link Repair by the Fanconi Anemia/BRCA Pathway

    Regulation of DNA Cross-Link Repair by the Fanconi Anemia/BRCA Pathway

    Downloaded from genesdev.cshlp.org on September 29, 2021 - Published by Cold Spring Harbor Laboratory Press REVIEW Regulation of DNA cross-link repair by the Fanconi anemia/BRCA pathway Hyungjin Kim and Alan D. D’Andrea1 Department of Radiation Oncology, Dana-Farber Cancer Institute, Harvard Medical School, Boston, Massachusetts 02215, USA The maintenance of genome stability is critical for sur- and quadradials, a phenotype widely used as a diagnostic vival, and its failure is often associated with tumorigen- test for FA. esis. The Fanconi anemia (FA) pathway is essential for At least 15 FA gene products constitute a common the repair of DNA interstrand cross-links (ICLs), and a DNA repair pathway, the FA pathway, which resolves germline defect in the pathway results in FA, a cancer ICLs encountered during replication (Fig. 1A). Specifi- predisposition syndrome driven by genome instability. cally, eight FA proteins (FANCA/B/C/E/F/G/L/M) form Central to this pathway is the monoubiquitination of a multisubunit ubiquitin E3 ligase complex, the FA core FANCD2, which coordinates multiple DNA repair activ- complex, which activates the monoubiquitination of ities required for the resolution of ICLs. Recent studies FANCD2 and FANCI after genotoxic stress or in S phase have demonstrated how the FA pathway coordinates three (Wang 2007). The FANCM subunit initiates the pathway critical DNA repair processes, including nucleolytic in- (Fig. 1B). It forms a heterodimeric complex with FAAP24 cision, translesion DNA synthesis (TLS), and homologous (FA-associated protein 24 kDa), and the complex resem- recombination (HR). Here, we review recent advances in bles an XPF–ERCC1 structure-specific endonuclease pair our understanding of the downstream ICL repair steps (Ciccia et al.
  • Open Full Page

    Open Full Page

    CCR PEDIATRIC ONCOLOGY SERIES CCR Pediatric Oncology Series Recommendations for Childhood Cancer Screening and Surveillance in DNA Repair Disorders Michael F. Walsh1, Vivian Y. Chang2, Wendy K. Kohlmann3, Hamish S. Scott4, Christopher Cunniff5, Franck Bourdeaut6, Jan J. Molenaar7, Christopher C. Porter8, John T. Sandlund9, Sharon E. Plon10, Lisa L. Wang10, and Sharon A. Savage11 Abstract DNA repair syndromes are heterogeneous disorders caused by around the world to discuss and develop cancer surveillance pathogenic variants in genes encoding proteins key in DNA guidelines for children with cancer-prone disorders. Herein, replication and/or the cellular response to DNA damage. The we focus on the more common of the rare DNA repair dis- majority of these syndromes are inherited in an autosomal- orders: ataxia telangiectasia, Bloom syndrome, Fanconi ane- recessive manner, but autosomal-dominant and X-linked reces- mia, dyskeratosis congenita, Nijmegen breakage syndrome, sive disorders also exist. The clinical features of patients with DNA Rothmund–Thomson syndrome, and Xeroderma pigmento- repair syndromes are highly varied and dependent on the under- sum. Dedicated syndrome registries and a combination of lying genetic cause. Notably, all patients have elevated risks of basic science and clinical research have led to important in- syndrome-associated cancers, and many of these cancers present sights into the underlying biology of these disorders. Given the in childhood. Although it is clear that the risk of cancer is rarity of these disorders, it is recommended that centralized increased, there are limited data defining the true incidence of centers of excellence be involved directly or through consulta- cancer and almost no evidence-based approaches to cancer tion in caring for patients with heritable DNA repair syn- surveillance in patients with DNA repair disorders.
  • Encyclopedia of Life Sciences

    Encyclopedia of Life Sciences

    DNA repair: Disorders Lehmann, Alan R and O‟Driscoll, Mark Alan R Lehmann and Mark O‟Driscoll Genome Damage and Stability Centre University of Sussex Falmer, Brighton BN1 9RQ UK Encyclopedia of Life Sciences DNA Repair: Disorders Abstract Deoxyribonucleic acid inside cells is being damaged continually. Cells have evolved a series of complex mechanisms to repair all types of damage. Deficiencies in these repair pathways can result in several different genetic disorders. In many cases these are associated with a greatly elevated incidence of specific cancers. Other disorders do not show increased cancer susceptibility, but instead they present with neurological abnormalities or immune defects. Features of premature ageing also often result. These disorders indicate that DNA repair and damage response processes protect us from cancer and are important for the maintenance of a healthy condition. Keywords: UV light; xeroderma pigmentosum; ataxia telangiectasia; cancer; immunodeficiency; DNA repair. Key concepts DNA is damaged continually from both endogenous and exogenous sources. Cells have evolved many different ways for repairing different types of damage Genetic defects in these pathways result in different disorders Defective DNA repair often results in an increased mutation frequency and consequent elevated incidence of cancer. Many of the DNA repair disorders are highly cancer-prone. The central nervous system appears to be particularly sensitive to DNA breaks. Several disorders caused by defective break repair are associated with neurological abnormalities including mental retardation, ataxia and microcephaly. Development of immunological diversity uses some of the enzymes required to repair double-strand breaks. Disorders caused by defects in this process are associated with immune deficiencies.
  • FANCJ Regulates the Stability of FANCD2/FANCI Proteins and Protects Them from Proteasome and Caspase-3 Dependent Degradation

    FANCJ Regulates the Stability of FANCD2/FANCI Proteins and Protects Them from Proteasome and Caspase-3 Dependent Degradation

    FANCJ regulates the stability of FANCD2/FANCI proteins and protects them from proteasome and caspase-3 dependent degradation Komaraiah Palle, Ph.D. (Kumar) Assistant Professor of Oncologic Sciences Abraham Mitchell Cancer Research Scholar Mitchell Cancer Institute University of South Alabama Outline • Fanconi anemia (FA) pathway • Role of FA pathway in Genome maintenance • FANCJ and FANCD2 functional relationship • FANCJ-mediated DDR in response to Fork-stalling Fanconi Anemia • Rare, inherited blood disorder. • 1:130,000 births Guido Fanconi 1892-1979 • Affects men and women equally. • Affects all racial and ethnic groups – higher incidence in Ashkenazi Jews and Afrikaners Birth Defects Fanconi anemia pathway • FA is a rare chromosome instability syndrome • Autosomal recessive disorder (or X-linked) • Developmental abnormalities • 17 complementation groups identified to date • FA pathway is involved in DNA repair • Increased cancer susceptibility - many patients develop AML - in adults solid tumors Fanconi Anemia is an aplastic anemia FA patients are prone to multiple types of solid tumors • Increased incidence and earlier onset cancers: oral cavity, GI and genital and reproductive tract head and neck breast esophagus skin liver brain Why? FA is a DNA repair disorder • FA caused by mutations in 17 genes: FANCA FANCF FANCM FANCB FANCG/XRCC9 FANCN/PALB2 FANCC FANCI RAD51C/FANCO FANCD1/BRCA2 FANCJ SLX4/FANCP FANCD2 FANCL ERCC2/XPF/FANCQ FANCE BRCA1/FANCS • FA genes function in DNA repair processes • FA patient cells are highly sensitive
  • Fanconi Anemia, Bloom Syndrome and Breast Cancer

    Fanconi Anemia, Bloom Syndrome and Breast Cancer

    A multiprotein complex in DNA damage response network of Fanconi anemia, Bloom syndrome and Breast cancer Weidong Wang Lab of Genetics, NIA A Multi-protein Complex Connects Two Genomic Instability Diseases: Bloom Syndrome and Fanconi Anemia Bloom Syndrome . Genomic Instability: -sister-chromatid exchange . Cancer predisposition . Mutation in BLM, a RecQ DNA Helicase . BLM participates in: HR-dependent DSB repair Recovery of stalled replication forks . BLM works with Topo IIIa and RMI to Suppress crossover recombination Courtesy of Dr. Ian Hickson A Multi-protein Complex Connects Two Genomic Instability Diseases: Bloom Syndrome and Fanconi Anemia P I l o r t n o BLM IP kDa C HeLa BLAP 250 Nuclear Extract 200- BLM* FANCA* 116- TOPO IIIα* 97- BLAP 100 MLH1* BLM IP BLAP 75 * 66- RPA 70 IgG H 45- * 30- RPA32 IgG L 20- * 12- RPA14 Meetei et al. MCB 2003 A Multi-protein Complex Connects Two Genomic Instability Diseases: Bloom Syndrome and Fanconi Anemia P I A C N A F BLM IP HeLa FANCM= FAAP 250 BLAP 250 Nuclear Extract BLM* BLM* * FANCA* FANCA TOPO IIIα* TOPO IIIα* FAAP 100 BLAP 100 FANCB= FAAP 95 MLH1 FANCA IP BLM IP BLAP 75 BLAP 75 RPA70*/FANCG* RPA 70* FANCC*/FANCE* IgG H FANCL= FAAP 43 FANCF* RPA32* IgG L Meetei et al. MCB 2003 Meetei et al. Nat Genet. 2003, 2004, 2005 BRAFT-a Multisubunit Machine that Maintains Genome Stability and is defective in Fanconi anemia and Bloom syndrome BRAFT Super-complex Fanconi Anemia Bloom Syndrome Core Complex Complex 12 polypeptides 7 polypeptides FANCA BLM Helicase (HJ, fork, D-loop), fork FANCC regression, dHJ dissolution Topo IIIα Topoisomerase, FANCE dHJ dissolution FANCF BLAP75 RMI1 FANCG Stimulates dHJ dissolution.
  • HEREDITARY CANCER PANELS Part I

    HEREDITARY CANCER PANELS Part I

    Pathology and Laboratory Medicine Clinic Building, K6, Core Lab, E-655 2799 W. Grand Blvd. HEREDITARY CANCER PANELS Detroit, MI 48202 855.916.4DNA (4362) Part I- REQUISITION Required Patient Information Ordering Physician Information Name: _________________________________________________ Gender: M F Name: _____________________________________________________________ MRN: _________________________ DOB: _______MM / _______DD / _______YYYY Address: ___________________________________________________________ ICD10 Code(s): _________________/_________________/_________________ City: _______________________________ State: ________ Zip: __________ ICD-10 Codes are required for billing. When ordering tests for which reimbursement will be sought, order only those tests that are medically necessary for the diagnosis and treatment of the patient. Phone: _________________________ Fax: ___________________________ Billing & Collection Information NPI: _____________________________________ Patient Demographic/Billing/Insurance Form is required to be submitted with this form. Most genetic testing requires insurance prior authorization. Due to high insurance deductibles and member policy benefits, patients may elect to self-pay. Call for more information (855.916.4362) Bill Client or Institution Client Name: ______________________________________________________ Client Code/Number: _____________ Bill Insurance Prior authorization or reference number: __________________________________________ Patient Self-Pay Call for pricing and payment options Toll
  • Complex Interacts with WRN and Is Crucial to Regulate Its Response to Replication Fork Stalling

    Complex Interacts with WRN and Is Crucial to Regulate Its Response to Replication Fork Stalling

    Oncogene (2012) 31, 2809–2823 & 2012 Macmillan Publishers Limited All rights reserved 0950-9232/12 www.nature.com/onc ORIGINAL ARTICLE The RAD9–RAD1–HUS1 (9.1.1) complex interacts with WRN and is crucial to regulate its response to replication fork stalling P Pichierri, S Nicolai, L Cignolo1, M Bignami and A Franchitto Department of Environment and Primary Prevention, Istituto Superiore di Sanita`, Rome, Italy The WRN protein belongs to the RecQ family of DNA preference toward substrates that mimic structures helicases and is implicated in replication fork restart, but associated with stalled replication forks (Brosh et al., how its function is regulated remains unknown. We show 2002; Machwe et al., 2006) and WS cells exhibit that WRN interacts with the 9.1.1 complex, one of enhanced instability at common fragile sites, chromo- the central factors of the replication checkpoint. This somal regions especially prone to replication fork interaction is mediated by the binding of the RAD1 stalling (Pirzio et al., 2008). How WRN favors recovery subunit to the N-terminal region of WRN and is of stalled forks and prevents DNA breakage upon instrumental for WRN relocalization in nuclear foci and replication perturbation is not fully understood. It has its phosphorylation in response to replication arrest. We been suggested that WRN might facilitate replication also find that ATR-dependent WRN phosphorylation restart by either promoting recombination or processing depends on TopBP1, which is recruited by the 9.1.1 intermediates at stalled forks in a way that counteracts complex in response to replication arrest. Finally, we unscheduled recombination (Franchitto and Pichierri, provide evidence for a cooperation between WRN and 2004; Pichierri, 2007; Sidorova, 2008).
  • Supplementary Table S1. Correlation Between the Mutant P53-Interacting Partners and PTTG3P, PTTG1 and PTTG2, Based on Data from Starbase V3.0 Database

    Supplementary Table S1. Correlation Between the Mutant P53-Interacting Partners and PTTG3P, PTTG1 and PTTG2, Based on Data from Starbase V3.0 Database

    Supplementary Table S1. Correlation between the mutant p53-interacting partners and PTTG3P, PTTG1 and PTTG2, based on data from StarBase v3.0 database. PTTG3P PTTG1 PTTG2 Gene ID Coefficient-R p-value Coefficient-R p-value Coefficient-R p-value NF-YA ENSG00000001167 −0.077 8.59e-2 −0.210 2.09e-6 −0.122 6.23e-3 NF-YB ENSG00000120837 0.176 7.12e-5 0.227 2.82e-7 0.094 3.59e-2 NF-YC ENSG00000066136 0.124 5.45e-3 0.124 5.40e-3 0.051 2.51e-1 Sp1 ENSG00000185591 −0.014 7.50e-1 −0.201 5.82e-6 −0.072 1.07e-1 Ets-1 ENSG00000134954 −0.096 3.14e-2 −0.257 4.83e-9 0.034 4.46e-1 VDR ENSG00000111424 −0.091 4.10e-2 −0.216 1.03e-6 0.014 7.48e-1 SREBP-2 ENSG00000198911 −0.064 1.53e-1 −0.147 9.27e-4 −0.073 1.01e-1 TopBP1 ENSG00000163781 0.067 1.36e-1 0.051 2.57e-1 −0.020 6.57e-1 Pin1 ENSG00000127445 0.250 1.40e-8 0.571 9.56e-45 0.187 2.52e-5 MRE11 ENSG00000020922 0.063 1.56e-1 −0.007 8.81e-1 −0.024 5.93e-1 PML ENSG00000140464 0.072 1.05e-1 0.217 9.36e-7 0.166 1.85e-4 p63 ENSG00000073282 −0.120 7.04e-3 −0.283 1.08e-10 −0.198 7.71e-6 p73 ENSG00000078900 0.104 2.03e-2 0.258 4.67e-9 0.097 3.02e-2 Supplementary Table S2.
  • MECHANISMS in ENDOCRINOLOGY: Novel Genetic Causes of Short Stature

    MECHANISMS in ENDOCRINOLOGY: Novel Genetic Causes of Short Stature

    J M Wit and others Genetics of short stature 174:4 R145–R173 Review MECHANISMS IN ENDOCRINOLOGY Novel genetic causes of short stature 1 1 2 2 Jan M Wit , Wilma Oostdijk , Monique Losekoot , Hermine A van Duyvenvoorde , Correspondence Claudia A L Ruivenkamp2 and Sarina G Kant2 should be addressed to J M Wit Departments of 1Paediatrics and 2Clinical Genetics, Leiden University Medical Center, PO Box 9600, 2300 RC Leiden, Email The Netherlands [email protected] Abstract The fast technological development, particularly single nucleotide polymorphism array, array-comparative genomic hybridization, and whole exome sequencing, has led to the discovery of many novel genetic causes of growth failure. In this review we discuss a selection of these, according to a diagnostic classification centred on the epiphyseal growth plate. We successively discuss disorders in hormone signalling, paracrine factors, matrix molecules, intracellular pathways, and fundamental cellular processes, followed by chromosomal aberrations including copy number variants (CNVs) and imprinting disorders associated with short stature. Many novel causes of GH deficiency (GHD) as part of combined pituitary hormone deficiency have been uncovered. The most frequent genetic causes of isolated GHD are GH1 and GHRHR defects, but several novel causes have recently been found, such as GHSR, RNPC3, and IFT172 mutations. Besides well-defined causes of GH insensitivity (GHR, STAT5B, IGFALS, IGF1 defects), disorders of NFkB signalling, STAT3 and IGF2 have recently been discovered. Heterozygous IGF1R defects are a relatively frequent cause of prenatal and postnatal growth retardation. TRHA mutations cause a syndromic form of short stature with elevated T3/T4 ratio. Disorders of signalling of various paracrine factors (FGFs, BMPs, WNTs, PTHrP/IHH, and CNP/NPR2) or genetic defects affecting cartilage extracellular matrix usually cause disproportionate short stature.
  • Epigenetic Regulation of DNA Repair Genes and Implications for Tumor Therapy ⁎ ⁎ Markus Christmann , Bernd Kaina

    Epigenetic Regulation of DNA Repair Genes and Implications for Tumor Therapy ⁎ ⁎ Markus Christmann , Bernd Kaina

    Mutation Research-Reviews in Mutation Research xxx (xxxx) xxx–xxx Contents lists available at ScienceDirect Mutation Research-Reviews in Mutation Research journal homepage: www.elsevier.com/locate/mutrev Review Epigenetic regulation of DNA repair genes and implications for tumor therapy ⁎ ⁎ Markus Christmann , Bernd Kaina Department of Toxicology, University of Mainz, Obere Zahlbacher Str. 67, D-55131 Mainz, Germany ARTICLE INFO ABSTRACT Keywords: DNA repair represents the first barrier against genotoxic stress causing metabolic changes, inflammation and DNA repair cancer. Besides its role in preventing cancer, DNA repair needs also to be considered during cancer treatment Genotoxic stress with radiation and DNA damaging drugs as it impacts therapy outcome. The DNA repair capacity is mainly Epigenetic silencing governed by the expression level of repair genes. Alterations in the expression of repair genes can occur due to tumor formation mutations in their coding or promoter region, changes in the expression of transcription factors activating or Cancer therapy repressing these genes, and/or epigenetic factors changing histone modifications and CpG promoter methylation MGMT Promoter methylation or demethylation levels. In this review we provide an overview on the epigenetic regulation of DNA repair genes. GADD45 We summarize the mechanisms underlying CpG methylation and demethylation, with de novo methyl- TET transferases and DNA repair involved in gain and loss of CpG methylation, respectively. We discuss the role of p53 components of the DNA damage response, p53, PARP-1 and GADD45a on the regulation of the DNA (cytosine-5)- methyltransferase DNMT1, the key enzyme responsible for gene silencing. We stress the relevance of epigenetic silencing of DNA repair genes for tumor formation and tumor therapy.