Not Duly Made Response

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Noise & Vibration Management Plan Version 1.1 Recycling Lives Ltd NOISE & VIBRATION MANAGEMENT PLAN Recycling Lives Recycling Park, Longridge Road, Preston PR2 5BX Recycling Lives Ltd Version: 1.1 Date: 09 September 2019 Doc. Ref: RLRP‐1040‐I Author(s): CP Checked: RLL Client No: 1040 Job No: 4028 Oaktree Environmental Ltd Waste, Planning & Environmental Consultants Oaktree Environmental Ltd, Lime House, 2 Road Two, Winsford Industrial Estate, Winsford, Cheshire, CW7 3QZ Tel: 01606 558833 | E‐Mail: sales@oaktree‐environmental.co.uk | Web: www.oaktree‐environmental.co.uk REGISTERED IN THE UK | COMPANY NO. 4850754 © OAKTREE ENVIRONMENTAL LTD – THE UNAUTHORISED COPYING OR REPRODUCTION OF THIS DOCUMENT (OR PART THEREOF) IS STRICTLY PROHIBITED Noise & Vibration Management Plan Version 1.1 Recycling Lives Ltd 09 September 2019 Document History: Version Issue date Author Checked Description 1.0 01/05/2019 CP RLL Document Issue EA comments re‐issue; amended sections 1.1.5, 1.4, 3.3.10, 1.1 09/09/2019 CP RLL 4.2.5, 4.3.2 (noise management table); added Appendix VI i Noise & Vibration Management Plan Version 1.1 Recycling Lives Ltd 09 September 2019 CONTENTS DOCUMENT HISTORY: ......................................................................................................................................... I CONTENTS .......................................................................................................................................................... II LIST OF TABLES .................................................................................................................................................. III LIST OF APPENDICES: ......................................................................................................................................... IV 1 INTRODUCTION ....................................................................................................................................... 1 1.1 SITE HISTORY / BACKGROUND .................................................................................................... 1 1.2 SITE LOCATION ....................................................................................................................... 2 1.3 FACILITY OVERVIEW ................................................................................................................. 2 1.4 HOURS OF OPERATION ............................................................................................................. 3 2 SENSITIVE RECEPTORS ............................................................................................................................. 5 2.1 RECEPTOR PLAN ..................................................................................................................... 5 2.2 LIST OF RECEPTORS ................................................................................................................. 5 2.3 OTHER NOISE SOURCES ............................................................................................................ 6 3 SITE OPERATIONS .................................................................................................................................... 7 3.1 WASTE DELIVERIES .................................................................................................................. 7 3.2 SITE INFRASTRUCTURE ............................................................................................................. 7 3.3 SITE PROCESSES ..................................................................................................................... 7 3.4 MOBILE PLANT AND EQUIPMENT .............................................................................................. 10 4 NOISE MANAGEMENT AND CONTROLS .................................................................................................. 11 4.1 NOISE SENSITIVE RECEPTORS .................................................................................................. 11 4.2 NOISE SOURCES ................................................................................................................... 11 4.3 NOISE MANAGEMENT TABLE .................................................................................................. 13 4.4 MONITORING AND RECORDING ................................................................................................ 14 4.5 MONITORING ...................................................................................................................... 14 4.6 EMERGENCIES ...................................................................................................................... 15 5 ACTIONS WHEN COMPLAINTS ARE RECEIVED ......................................................................................... 16 5.1 COMPLAINTS PROCEDURE ....................................................................................................... 16 5.2 COMPLAINTS RECORDING ....................................................................................................... 17 6 TRAINING .............................................................................................................................................. 18 6.1 TRAINING REGIME ................................................................................................................. 18 6.2 VEHICLE / PLANT PREVENTATIVE MAINTENANCE TRAINING ............................................................. 18 6.3 LIAISON WITH NEIGHBOURS .................................................................................................... 18 ii Noise & Vibration Management Plan Version 1.1 Recycling Lives Ltd 09 September 2019 List of Tables Table 1.1 ‐ Extract of Table S1.5 ‐ Improvement programme requirements ................................................ 1 Table 2.1 – Distances to Selected, Representative Sensitive Locations ........................................................ 5 Table 2.2 – Other Noise Emitting Operators ................................................................................................. 6 iii Noise & Vibration Management Plan Version 1.1 Recycling Lives Ltd 09 September 2019 List of Appendices: Appendix I ‐ Drawings Drawing No. RLRP/1040/03 – Site Layout & Fire Plan Drawing No. RLRP/1040/04 – Sensitive Receptors Plan Appendix II ‐ Complaints Procedure and Recording Form Appendix III ‐ Environmental Noise Impact Study (09/02/2010) Appendix IV ‐ Environmental Noise Impact Study (23/01/2017) Appendix V ‐ Environmental Noise Impact Study (16/08/2018) Appendix VI ‐ Pilot Energy from Waste Plant Noise Impact Assessment (28/06/2019) iv Noise & Vibration Management Plan Version 1.1 Recycling Lives Ltd 09 September 2019 1 Introduction 1.1 Site history / background 1.1.1 Oaktree Environmental Ltd have been instructed by Recycling Lives Ltd to prepare a Noise & Vibration Management Plan (NVMP) for their site situated at Recycling Lives Recycling Park, Longridge Road, Preston PR2 5BX. 1.1.2 Recycling Lives Ltd were issued the Environmental Permit (EP) by the Environment Agency (EA) on 20/08/2010 and due to increased site operational and legislative changes a permit variation initiated by the Environment Agency (EA) was issued on 26/07/2018 to update and consolidate the permit into a modern format. 1.1.3 Following the most recent variation of the EP as detailed in Section 1.2.1 above, the EA have included an improvement programme requirement (Table S1.5; page 20) which is shown overleaf and the reason required for this NVMP: Table 1.1 ‐ Extract of Table S1.5 ‐ Improvement programme requirements Reference Requirement The operator shall submit a Noise and Vibration Management Plan to the Environment Agency for approval. This plan should identify all potential sources of noise and vibration within the permitted area and include measures to minimise the risk of pollution from noise and IC2 vibration. The operator shall implement the Noise and Vibration Management Plan in accordance with the Environment Agency's written approval. 1.1.4 As the site is also proposing to increase the throughput and operational hours of the pre‐shredder and fragmentiser, the plan addresses the impacts of noise and includes the specific control measures required to mitigate the associated noise impacts with the operation of the site. 1.1.5 The operator is also installing al liquid‐crystal display (LCD) automated disassembly line which will be situated and partitioned inside the main building on site. The disassembly 1 Noise & Vibration Management Plan Version 1.1 Recycling Lives Ltd 09 September 2019 line will involve the use of a shredder, trommel, cyclones, extractor fans, overband magnets and eddy current separators. 1.1.6 The mitigation measures outlined in this will NVMP will be put in place by the management of Recycling Lives Ltd to ensure noise and vibration is controlled using Best practicable means (BPM) to ensure the receptors listed in Section 2.2 below are not affected by the above proposals. 1.1.7 Contact details for Oaktree Environmental are as follows: Oaktree Environmental Ltd Contact: Chris Lime House Position: Senior Consultant 2, Road Two Tel: 01606 558833 Winsford Industrial Estate Fax: 01606 861182 Winsford CW7 3QZ E‐mail: chris@oaktree‐environmental.co.uk 1.2 Site location 1.2.1 The site is located within the Preston Borough and part of the wider Lancashire County located off the B6243 Longridge Road, Preston approximately 1 km south west of Grimsargh and 4km east of Preston city centre. The
Recommended publications
  • Ian Ferguson

    Ian Ferguson

    Ian Ferguson From: Ian Ferguson [[email protected]] Sent: 12 July 2012 16:25 To: 'Mark Waddington' Subject: Council for Voluntary Service News - 12 July 2012 Welcome to our weekly roundup of all things Voluntary Community Faith Sector in Central Lancashire! This email is issued to subscribers and contributors. Please feel free to circulate (preferably in its entirety) within your own networks. If you are receiving this email through forwarding and wish to subscribe directly, please email [email protected] with " subscribe newsletter" in the subject line. Some CVS news before we begin CVS Central Lancashire will be holding a six week information exhibition in the Guild Hall Arcade between 20th August and 2nd October. We held a similar event last year at the St George's Shopping Centre and it was a huge success. This is a chance to promote your services and to find out about other services being provided in and around Preston. Bring your stands, bring your banners, bring your leaflets and your posters! We anticipate an even bigger event this year as it is Guild year and we would like to encourage as much participation as possible. We already have many groups signed up but if you would like to be involved, all you need to do is visit our website http://www.cvscentrallancashire.org.uk and click on Useful Links. At the bottom of that page you will find a document entitled "Information Event Sign-up". Complete that form and return it to us, either by hand, by post or by email. And now, the news … Guild 2012 City to adopt ship A Royal Navy ship will be ‘adopted’ by Preston to celebrate Guild year.
  • Central Lancashire Employment Land Study Technical Report

    Central Lancashire Employment Land Study Technical Report

    Central Lancashire Employment Land Study – Technical Report Chorley, Preston and South Ribble Councils FRONT COVER S153(e)/Technical Report – Final Report/November 2017/BE Group Central Lancashire Employment Land Study – Technical Report Chorley, Preston and South Ribble Councils CONTENTS 1.0 INTRODUCTION .................................................................................................. 1 2.0 STRATEGIC CONTEXT ....................................................................................... 7 3.0 ECONOMIC CONTEXT ASSESSMENT ............................................................. 34 4.0 DEMAND ASSESSMENT – PROPERTY MARKET ASSESSMENT .................. 48 5.0 DEMAND ASSESSMENT – STAKEHOLDER CONSULTATIONS ..................... 68 6.0 DEMAND ASSESSMENT – COMPANY SURVEY ............................................. 78 7.0 DEMAND ASSESSMENT – FUNCTIONAL ECONOMIC MARKET AREA ......... 99 8.0 DEMAND ASSESSMENT – OBJECTIVELY ASSESSED NEEDS ................... 119 9.0 DEMAND ASSESSMENT – LAND NEEDS OF NON-B CLASS USES ............ 152 10.0 EMPLOYMENT LAND AND PREMISES SUPPLY ........................................... 170 11.0 CONCLUSIONS ............................................................................................... 204 12.0 RECOMMENDATIONS ..................................................................................... 237 Appendix 1 – List of Consultees Appendix 2 – Business Survey Questionnaire Appendix 3 – Business Survey Responses by Sub-Area Appendix 4 – In and Out Flows of Central Lancashire
  • Order of Saint Michael and Saint George the Royal Victorian Order

    Order of Saint Michael and Saint George the Royal Victorian Order

    THE LONDON GAZETTE SATURDAY 29 DECEMBER 2012 SUPPLEMENT No. 1 N3 Trevor John Llanwarne, Government Actuary. For Simon Charles Martin, lately Protocol Director, Foreign services to the Actuarial Profession and Public and Commonwealth Office and Vice-Marshal of the Finances and to Public Service Pension Reform. Diplomatic Corps. For services to UK diplomatic Stephen Augustus Lovegrove, Chief Executive, interests. Shareholder Executive. For services to the Karen Anne Sage, Mrs. McFarlane, Information Government as Shareholder. Counsellor, Foreign and Commonwealth Office. For aulin Oswyn George P , Head of Government Legal services to information security. Service, Northern Ireland Executive. For services to itchell Government in Northern Ireland and voluntary service Andrew Jonathan M , lately Director, London through the Scout Association. 2012 Olympics, Paralympics and GREAT Campaign, Alison, Mrs. Saunders, Chief Crown Prosecutor for Foreign and Commonwealth Office. For services to London, Crown Prosecution Service. For services to London 2012 Olympic and Paralympic Games and to Law and Order especially after the 2011 London Riots. UK diplomatic interests. Dr. Michael William Weightman, Her Majesty’s Chief Timothy Giles Paxman, H.M. Ambassador, Spain. For Nuclear Inspector, Office for Nuclear Regulation, services to UK interests in Spain and Mexico. Health and Safety Executive. For services to the John Andrew Raine, O.B.E., Director, Foreign and Improvement of Nuclear Safety. Commonwealth Office. For services to international diplomacy.
  • Uclan Case Study

    Uclan Case Study

    UNIVERSITY OF CENTRAL LANCASHIRE ENGINEERING INNOVATION CENTRE SOCIAL VALUE CASE STUDY March 2019 1 | P a g e Index 1. Engineering Innovation Centre 1.1. Project Summary 1.2. Key Business Benefits of the Extension Scheme 1.3. Construction Phase Social Value 1.4. Key Social Value Achievements 2. Social Value Highlights 2.1. Future Workforce 2.2. Inclusive Workforce 2.3. Skilled And Productive Workforce 2.4. Community Benefits 3. Social Value Infographics 4. Lancashire Skills and Employment Framework Social Value Metrics 2 | P a g e GROWTH DEAL SOCIAL VALUE CASE STUDY Project Engineering Innovation Centre Capex £31.65M Growth Deal Funding £10.50M Project Commencement June 2017 Project Completion July 2019 1. THE ENGINEERING INNOVAVTION CENTRE 1.1 Project Summary The Engineering Innovation Centre (EIC) will on completion deliver state of the art engineering facilities integrating research, teaching and innovative industry engagement, equipped to the highest quality, on the Preston campus. Its aim is to exploit the location of the University at the centre of one of the most intense engineering and manufacturing areas in the UK and establish UCLan as a leader in engineering innovation. Through its links with other centres of excellence, the EIC will support the integration of both existing and planned advanced engineering and manufacturing assets in Lancashire, strengthening and promoting smart specialisation in the sector. The EIC will be UCLan’s new state of the art purpose-built engineering facility catering for increased volumes and more innovative undergraduate, postgraduate and postdoctoral teaching and research alongside a significant programme of industry support, engagement and innovation activities.
  • Labour Market & Apprenticeship Information Newsletter September

    Labour Market & Apprenticeship Information Newsletter September

    Web Version | Update preferences | Unsubscribe Like Tweet Forward Manchester still the UK’s most ‘liveable’ city Labour Market & Apprenticeship Information Newsletter September 2017 If any National Careers Service Apprenticeship Ambassadors have stories about newly available opportunities or the success of existing apprentices please send them in for inclusion in future editions. The contact address is: The Economist intelligence unit (EIU) [email protected] published its 2017 ranking of living conditions in 140 cities around the world on Wednesday, with Manchester the fastest- UK trade deficit widens as fall in sterling fails to falling. It dropped eight improve export sales places to 51st, putting it just 0.3% above London Brexit negotiators urged to in 53rd. safeguard terms of trade with the EU amid signs that But with the EIU directly attributing the fall to an UK is becoming more increased threat of dependent on deals with the terrorism in the city trading bloc following the bombing of the Manchester Arena on Britain’s trade position with 22 May questions are the rest of the world being asked over the worsened in June as the sharp fall in the value of the pound since the fairness of the criteria. Brexit vote failed to lift sales of UK-made goods abroad. Melbourne retained the title of the world’s most The trade in goods deficit widened unexpectedly to £12.7bn, from liveable city for the £11.3bn in May, as exports fell by 2.8% but imports rose by 1.6% seventh consecutive year. according to the Office for National Statistics.
  • Creditor Payments Equal to Or Greater Than £250

    Creditor Payments Equal to Or Greater Than £250

    CREDITOR PAYMENTS EQUAL TO OR GREATER THAN £250 Period 2012/13 Body Name Body Service Level Expense Type Expense Code Narrative Date Transaction Number AmountCapital and RevenueSupplier Name Supplier ID Body Name Body Service Level Expense Type Expense Code Narrative Date Transaction Number Amount Capital andSupplier Revenue Name Supplier ID South Ribble Council http://statistics.data.gov.uk/doc/local-authority/30UN Property Services Rep & Maint Premises 2024 Annual contract 2011/2012 for electrical testing at sports pavilions 04/04/2012 79770 £685.16 Revenue BELEC 130290 South Ribble Council http://statistics.data.gov.uk/doc/local-authority/30UN Healthy Communities Licence Fees 488B oct-dec management fee 04/04/2012 66664 £1,125.00 Revenue Carr Street Community Centre 130312 South Ribble Council http://statistics.data.gov.uk/doc/local-authority/30UN Healthy Communities Licence Fees 488B 1st qtr mgmt fee apr-jun12 04/04/2012 85101 £1,125.00 Revenue Carr Street Community Centre 130312 South Ribble Council http://statistics.data.gov.uk/doc/local-authority/30UN Planning Professional Fees 4510 LDF staffing - one third of Julian Jackson. Over spend on LDF staffing V Hunter and J D Porter 04/04/2012 85163 £22,212.00 Revenue CHORLEY BOROUGH COUNCIL 17352 South Ribble Council http://statistics.data.gov.uk/doc/local-authority/30UN Information Services Peripherals 4244 5 x Optiplex 745 04/04/2012 85119 £560.00 Revenue COMPUTER REMARKETING SERVICE 75763 South Ribble Council http://statistics.data.gov.uk/doc/local-authority/30UN Information Services
  • Approved Authorised Treatment

    January 2018 Update. Next update February 2018. Accurate at time of publication. Any questions please contact the Environment Agency on 03708 506 506. © Environment Agency copyright and database right 2015. All rights reserved. 2018 Approved Authorised Treatment Facility Public Register Name of operator Status Address Postcode Area Approval Number Date of Approval Size Status Period(s) of Suspension A NOVO UK Ltd Operator Communications House, Vulcan Road North, Norwich, Norfolk NR6 6AQ Essex Norfolk and Suffolk Active A NOVO UK Ltd AATF Communications House, Vulcan Road North, Norwich, Norfolk NR6 6AQ Essex Norfolk and Suffolk WEE/FE0005ZT/ATF 01/01/2018 Small Active AO Recycling Limited Operator AO Park, The Parklands, Lockstock, Bolton B16 4SD Greater Manchester, Merseyside and Cheshire Active Shropshire, Herefordshire, Worcestershire and AO Recycling Limited AATF Halefield 15, Telford,Shropshire TF7 4LE WEE/EO0002ZS/ATF 01/01/2018 Large Active Gloucestershire Aqua Force Special Waste Limited Operator Unit 4A, Sprint Industrial Estate, Station Road, Four Ashes, Wolverhampton WV10 7DB Staffordshire, Warwickshire and West Midlands Active Aqua Force Special Waste Limited AATF Unit 4A, Sprint Industrial Estate, Station Road, Four Ashes, Wolverhampton WV10 7DB Staffordshire, Warwickshire and West Midlands WEE/CH0002ZS/ATF 01/01/2018 Large Active ASM Metal Recycling Ltd Operator 55 Station Road, Beaconsfield, Buckinghamshire HP9 1QL West Thames Active ASM Metal Recycling Ltd AATF The Recycling Centre, Griffin Lane, Aylesbury, Buckinghamshire
  • Horticulture, Hypermasculinity and Mental Wellbeing: the Connections in a Male Prison Context

    Horticulture, Hypermasculinity and Mental Wellbeing: the Connections in a Male Prison Context

    Horticulture, hypermasculinity and mental wellbeing: the connections in a male prison context. By Florence Ellen Rose Seymour A thesis submitted in partial fulfilment for the requirements for the degree of Doctor of Philosophy at the University of Central Lancashire September 2019 i STUDENT DECLARATION FORM Type of Award Doctor of Philosophy_______________________________ School Community Health and Midwifery_____________________ Sections marked * delete as appropriate 1. Concurrent registration for two or more academic awards *I declare that while registered as a candidate for the research degree, I have not been a registered candidate or enrolled student for another award of the University or other academic or professional institution. 2. Material submitted for another award *I declare that no material contained in the thesis has been used in any other submission for an academic award and is solely my own work. 3. Collaboration Where a candidate’s research programme is part of a collaborative project, the thesis must indicate in addition clearly the candidate’s individual contribution and the extent of the collaboration. Please state below: _________________________________________________________________ 4. Use of a Proof-reader *No proof-reading service was used in the compilation of this thesis. Signature of Candidate ______________________________________________________ Print name: ________________________________________________________________ ii This project is funded by The National Institute for Health Research Collaboration for Leadership in Applied Health Research and Care North West Coast (NIHR CLAHRC NWC) The views expressed here are those of the author(s) and not necessarily those of the NHS, the NIHR, or the Department of Health and Social Care. iii ABSTRACT This thesis explores the interconnections between horticulture, hypermasculinity and mental wellbeing.
  • Ian Ferguson

    Ian Ferguson

    Ian Ferguson From: Mark Waddington [[email protected]] Sent: 14 June 2012 16:01 To: [email protected] Subject: FW: Council for Voluntary Service News - 14 June 2012 Importance: High Welcome to our weekly roundup of all things Voluntary Community Faith Sector in Central Lancashire! This email is issued to subscribers and contributors. Please feel free to circulate (preferably in its entirety) within your own networks. If you are receiving this email through forwarding and wish to subscribe directly, please email [email protected] with "subscribe newsletter" in the subject line. Before we begin, some good news from the CVS. Since we launched the newsletter in February we have been struggling with a problem which we have now, hopefully, resolved. Organisations appear, very curiously, to go to great lengths to produce eye catching art works promoting their events - and then simply send them out to everyone by email without putting the information on their own websites! This presented us with a problem - if we simply attached the original artwork submitted to us our email would: - a) be a HUGE download; b) quickly become unmanageable as it would arrive with all sorts of equally creatively named attachments, none of which could easily be distinguished from the others. A downside (from our point of view) was that, if you wanted to help support your members or the event by displaying the poster yourself, you couldn't get it from our newsletter. To solve that, from this edition, we have introduced a new way of doing things. You will still get a brief text summary but a new link "Poster" has appeared.
  • (Public Pack)Agenda Document for Council, 22/09/2015 18:30

    (Public Pack)Agenda Document for Council, 22/09/2015 18:30

    COUNCIL TUESDAY, 22ND SEPTEMBER 2015, 6.30 PM COUNCIL CHAMBER, TOWN HALL, CHORLEY AGENDA APOLOGIES 1 MINUTES OF MEETING TUESDAY, 21 JULY 2015 OF COUNCIL (Pages 5 - 14) 2 DECLARATIONS OF ANY INTERESTS Members are reminded of their responsibility to declare any pecuniary interest in respect of matters contained in this agenda. If you have a pecuniary interest you must withdraw from the meeting. Normally you should leave the room before the business starts to be discussed. You do, however, have the same right to speak as a member of the public and may remain in the room to enable you to exercise that right and then leave immediately. In either case you must not seek to improperly influence a decision on the matter. 3 DEPUTY MAYOR Councillor David Dickinson has indicated with regret that he intends to stand down as Deputy Mayor due to his ongoing ill health. The Council will be asked to reappoint to the position of Deputy Mayor for 2015/16. 4 MAYORAL ANNOUNCEMENTS 5 PUBLIC QUESTIONS Members of the public who have requested the opportunity to ask question(s) on any item(s) on the agenda will have three minutes to put their question(s) to the relevant Councillor. Members of the public will be allowed to ask one short supplementary question. 6 PLANNING POLICY FOR TRAVELLER SITES - AUGUST 2015 (Pages 15 - 22) To consider a report of the Chief Executive, this item was deferred from the last Council Meeting in July. Meeting contact Carol Russell on 01257 515196 or email [email protected] 7 EXECUTIVE CABINET (Pages 23 - 26) To consider the attached general report of the meeting held on 27 August 2015.
  • A Frank Conversation With... Downtown Debate Dq Icon

    A Frank Conversation With... Downtown Debate Dq Icon

    DQDOWNTOWN QUARTERLY • SPRING • 2011 A FRANK CONVERSATION WITH... Max Steinberg DOWNTOWN DEBATE What’s The Big Society Really All About? DQ ICON Tom Finney We Are Family What Makes Manchester Tick? /HDGHUVK 7KHWLPHWRWDNHDFWLRQLVQRZ LS &RDFK 5H LQ &DSDELO J7H VX DP OW $FWLRQ 3HU V LW\ IR UP DQ FH 3URI 3U RI 2SSRUWXQLW\ LOL QJ <RX LW ( &$<586 YH QWV 0D $WWLWXGH LFH QD 6HUY JH PH Q W $ &D\UXV3HUIRUPDQFH&RQVXOWLQJ/WG VVH 0DNLQJWKHPRVWRI\RXURSSRUWXQLWLHVLVQRWHDV\ VVP $W&D\UXVZHKHOSLQGLYLGXDOVDQGFRPSDQLHVPDNHWKHPRVWRIZKDWWKH\KDYHRU HQ KHOSWKHPWRGHYHORSWKHFDSDELOLW\DQGWDOHQWWRJHWPRUHRIZKDWWKH\ZDQW W :HJLYH\RXRXUXQGLYLGHGDWWHQWLRQWRXQGHUVWDQG\RXDQG\RXUEXVLQHVV 2XUDLPLVWRHQDEOH\RXWRPDNHSRVLWLYHFKDQJHVZKLFKZLOOHQKDQFH\RXU SHUIRUPDQFHLPSURYH\RXUFXVWRPHUVH[SHULHQFHRI\RXDQGPRVWLPSRUWDQWO\LQFUHDVH \RXUSURILWDELOLW\ &D\UXVDUHZRUNLQJQRZZLWKVRPHRIWKHPRVWVXFFHVVIXODQGLQIOXHQWLDOEXVLQHVVHVLQ WKHFRXQWU\:HDUHGHOLYHULQJSURJUDPPHVZKLFKDUHHQKDQFLQJSHUIRUPDQFHDQG PDNLQJDUHDOGLIIHUHQFHWRERWKFXVWRPHUVDQGFROOHDJXHV &D\UXVDFKLHYHWKLVE\GHOLYHULQJLQWHUDFWLYH LQQRYDWLYHDQGFRVWHIIHFWLYHGHYHORSPHQWFRDFKLQJDQGUHVXOWVRULHQWDWHG H[SHULHQWLDOOHDUQLQJDVVLJQPHQWVIRFXVHGRQ\RXUQHHGV &DOORU(PDLOMXVWDVN#FD\UXVQRZFRXN ZZZFD\UXVQRZFRXN ACC LIVERPOOL ALDER HEY IMAGINE APPEAL ALDERMORE INVOICE FINANCE ALLIANCE & LEICESTER ANGIE ROBINSON ANGLO IRISH ANTHONY WILSON AQUARIUS EQUITY PARTNERS LTD ASK DEVELOPMENTS LTD AURORA MEDIA LTD BAILEY FINANCIAL SERVICES BAINES AND ERNST CORPORATE BAKER FINANCIAL BARBARA SPICER BARCLAYS WEALTH BEECH JONES DE LLOYD BEGBIES TRAYNOR GROUP PLC BLANKSTONES
  • To Let 70-71 Roman Way Preston Pr2

    To Let 70-71 Roman Way Preston Pr2

    CHARTERED SURVEYORS COMMERCIAL PROPERTY CONSULTANTS 16-18 RIVERSWAY BUSINESS VILLAGE NAVIGATION WAY PRESTON PR2 2YP TEL: 01772 769000 FAX: 01772 760066 TO LET WEBSITE: www.pinkus.co.uk INDUSTRIAL UNIT 70-71 ROMAN WAY PRESTON PR2 5BE APPROXIMATE TOTAL FLOOR AREA: 1,011 SQ M (10,886 SQ FT) LOCATION Located within one mile of junction 31a of the M6 motorway, Roman Way Industrial Estate is close to Preston City Centre and provides easy access to the M55, M6, M61 and M65. Occupiers in the locality include Menzies, Warehouse Wine Limited, Booths, Recycling Lives and Business Post. THESE PARTICULARS ARE BELIEVED TO BE CORRECT BUT IN NO WAY IS THEIR ACCURACY GUARANTEED AND THEY DO NOT FORM PART OF ANY CONTRACT AND NEITHER DO ROBERT PINKUS & CO LLP OR THE LESSORS OR THE VENDORS ACCEPT ANY RESPONSIBILITY IN RESPECT OF THESE PARTICULARS AND ANY INTENDING LESSEE OR PURCHASER MUST SATISFY HIMSELF BY INSPECTION OR OTHERWISE AS TO THEIR ACCURACY. ROBERT PINKUS & CO IS A TRADING NAME OF ROBERT PINKUS & CO LLP WHICH IS A LIMITED LIABILITY PARTNERSHIP REGISTERED IN ENGLAND AND WALES UNDER PARTNERSHIP NUMBER: 0C357286 AND HAVING A REGISTERED OFFICE ADDRESS OF 69 MIDDLETON ROAD, CRUMPSALL, MANCHESTER, M8 4JY DESCRIPTION The property comprises a semi-detached pair of steel portal industrial units that have been combined to provide one detached unit. Unit 71 is predominantly open plan and used for warehousing whilst unit 70 has been adapted to provide good quality showroom and office facilities. A mezzanine first floor has been added in unit 70 to provide further office accommodation.