Identifying Genetic Modulators of the Connectivity Between Transcription

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Identifying genetic modulators of the connectivity PNAS PLUS between transcription factors and their transcriptional targets Mina Fazlollahia,b, Ivor Muroffa, Eunjee Leea,1, Helen C. Caustonc,2, and Harmen J. Bussemakera,b,2 aDepartment of Biological Sciences, Columbia University, New York, NY 10027; bDepartment of Systems Biology, Columbia University, New York, NY 10032; and cDepartment of Pathology and Cell Biology, Columbia University Medical Center, New York, NY 10032 Edited by Steven Henikoff, Fred Hutchinson Cancer Research Center, Seattle, WA, and approved February 9, 2016 (received for review August 28, 2015) Regulation of gene expression by transcription factors (TFs) is highly At the simplest level, regulation of gene expression is char- dependent on genetic background and interactions with cofactors. acterized by binding of a transcription factor (TF) to a promoter Identifying specific context factors is a major challenge that requires and the concomitant activation or repression of the target gene. new approaches. Here we show that exploiting natural variation is Variation in responsiveness of a target gene to a regulator, either a potent strategy for probing functional interactions within gene due to genetic variation or due to a change in the environment, regulatory networks. We developed an algorithm to identify genetic can affect its expression and the resulting cellular phenotype. polymorphisms that modulate the regulatory connectivity between One possible strategy for tuning gene-specific responsiveness is specific transcription factors and their target genes in vivo. As a proof modulation of TF–target connectivity by specific cofactors. The of principle, we mapped connectivity quantitative trait loci (cQTLs) interaction between a TF and cofactor can take a number of using parallel genotype and gene expression data for segregants from different forms. It may require a specific cofactor(s) to tether a cross between two strains of the yeast Saccharomyces cerevisiae.We effectively to the promoter of a target gene; for example, Met4p is DIG2 identified a nonsynonymous mutation in the gene as a cQTL for recruited to the promoters of genes involved in sulfur metabolism the transcription factor Ste12p and confirmed this prediction empiri- via interaction with Cbf1p and several other DNA-binding proteins cally. We also identified three polymorphisms in TAF13 as putative (17–23). Cofactors may also influence TF-dependent recruitment of BIOPHYSICS AND modulators of regulation by Gcn4p. Our method has potential for re- the transcription machinery to the transcription start site; for ex- COMPUTATIONAL BIOLOGY vealing how genetic differences among individuals influence gene ample, multiprotein bridging factor 1 (Mbf1p) enhances Gcn4p- regulatory networks in any organism for which gene expression and dependent transcriptional activation by simultaneously binding the genotype data are available along with information on binding pref- DNA-binding domain of general control nonderepressible 4 (Gcn4p) erences for transcription factors. and a subunit of RNA polymerase II complex (24), or a cofactor may prevent a TF from binding to the promoters of its targets. In transcription factors | cofactor interactions | genetic variation in nutrient-rich conditions in the absence of mating pheromone, the gene expression | quantitative trait locus mapping activator of the mating response, Ste12p, is bound by a down- regulator of invasive growth protein (Dig2p), which inhibits he ability to predict the phenotype of an organism from its binding of Ste12p to the promoters of its target genes (25, 26). Tgenotype is a long-term goal of biology. The increasing avail- In the presence of pheromone, Dig2p is phosphorylated and ability of high-throughput genomic data and systems biology-based approaches is bringing this closer to reality. Linkage or association Significance analyses have been used to map quantitative trait loci (QTLs) that explain phenotypic variation in terms of genetic polymorphism. – However, detectable QTLs typically only account for a small We present a transcription-factor centric computational method fraction of heritable trait variation. Even when most of the addi- that utilizes data on natural variation in mRNA abundance to tive contribution to the heritability can be explained in terms of identify genetic loci that influence the responsiveness of genes QTLs, as is the case for yeast, most of the contribution from gene– to variation in the activities of their regulators. We call these gene interactions remains unexplained (1). Consequently, there connectivity quantitative trait loci, or cQTLs. When testing our has been a growing appreciation for the importance of interactions method in yeast, we identified a polymorphism that modulates among genetic loci. For instance, a gene deletion study comparing the mating response and confirmed our prediction experimen- two yeast strains that differ by 3–5%, similar to the difference tally. Our approach provides a sophisticated and nuanced ap- between unrelated human individuals, identified subsets of genes proach to understanding the influence of genetic variation on that were essential in one strain background but not the other (2). interactions within regulatory networks. Applying our approach This study exemplifies one of the computational challenges that to human data may improve our understanding of the impact will have to be addressed before phenotype can reliably be pre- of genetic variation in contributing to phenotypic differences dicted from genotype. among individuals. The identification of modifier genes contributing to phenotype is Author contributions: M.F., H.C.C., and H.J.B. designed research; M.F. and I.M. performed difficult, because individual contributions are usually too weak to research; M.F. and E.L. contributed new analytic tools; M.F., I.M., H.C.C., and H.J.B. analyzed be detected. Considering genome-wide mRNA abundance along data; and M.F., I.M., H.C.C., and H.J.B. wrote the paper. with information on genotypic variation represents the combined The authors declare no conflict of interest. – effect of the latter on the regulatory state of the cell (3 7) and can This article is a PNAS Direct Submission. yield better prediction of phenotype (8, 9), the combined effect of Freely available online through the PNAS open access option. allelic variation on transcript abundance (8, 10), the effect of ge- 1Present address: Department of Genetics and Genomic Sciences, Mount Sinai School of netic variation on transcription factoractivity(11,12),ortranscript Medicine, New York, NY 10029. stability (13). However, there are few methods that systematically 2To whom correspondence may be addressed. Email: [email protected] or identify the effect of genetic modifiers on the strength of the [email protected]. “ ” connection ( connectivity ) between a transcription factor and its This article contains supporting information online at www.pnas.org/lookup/suppl/doi:10. target genes (14–16). 1073/pnas.1517140113/-/DCSupplemental. www.pnas.org/cgi/doi/10.1073/pnas.1517140113 PNAS Early Edition | 1of9 Downloaded by guest on September 28, 2021 dissociates from Ste12p, allowing Ste12p to activate transcription of information (33), which we exploit to estimate the susceptibility the mating genes (26). (i.e., responsiveness) of each gene to variation in the differential In all of the above cases, the magnitude and/or kinetics of the regulatory activity of a particular TF. We subsequently treat the change in transcription rate promoted by a TF may be affected by average difference in susceptibility between genetic backgrounds natural variation in the amino acid sequence or protein level of a containing each allele for a given locus as a quantitative trait and cofactor. In this work, we explore the effect of genetic variation at aggregate these differences over the targets of the TF to con- trans-acting loci on the regulatory interaction between a TF and its struct a (χ2) statistic that can be used to map cQTLs. Applica- targets. This is illustrated in Fig. 1, where allelic variation of a tion of our algorithm to yeast data uncovered a cQTL modulating cofactor modulates the efficiency of interaction between a TF and the pheromone-induced mating response, which we confirmed ex- the promoter to which it binds. Many studies rely on knowledge of perimentally, as well as a cQTL modulating amino acid biosynthesis. TF–target interactions to decipher the transcriptional network (27– 30). However, few algorithms are able to identify modulators of Results TF–target connectivity at a network level (14–16). These typically The goal of our analysis is to detect genetic loci that modulate the derive information from statistical relationships across conditions strength of the functional connection between a TF and the ex- between the mRNA abundance of gene triplets: the TF of interest, pression of its target genes. We used genome-wide mRNA ex- a candidate modulator, and a target of the TF. However, regula- pression data for 108 segregants resulting from a genetic cross tion of TF activity and interaction with cofactors often occurs at the between two yeast strains: a laboratory strain (BY4716) and a wild protein level. A complementary approach is therefore needed. strain from a vineyard in California (RM11-1a) (10). We also used Our method identifies genetic loci whose allelic variation mod- a genotype map that specifies the parental allele (BY or RM) ulates the regulatory connectivity
Recommended publications
  • Molecular Structure of Promoter-Bound Yeast TFIID

    Molecular Structure of Promoter-Bound Yeast TFIID

    ARTICLE DOI: 10.1038/s41467-018-07096-y OPEN Molecular structure of promoter-bound yeast TFIID Olga Kolesnikova 1,2,3,4, Adam Ben-Shem1,2,3,4, Jie Luo5, Jeff Ranish 5, Patrick Schultz 1,2,3,4 & Gabor Papai 1,2,3,4 Transcription preinitiation complex assembly on the promoters of protein encoding genes is nucleated in vivo by TFIID composed of the TATA-box Binding Protein (TBP) and 13 TBP- associate factors (Tafs) providing regulatory and chromatin binding functions. Here we present the cryo-electron microscopy structure of promoter-bound yeast TFIID at a resolu- 1234567890():,; tion better than 5 Å, except for a flexible domain. We position the crystal structures of several subunits and, in combination with cross-linking studies, describe the quaternary organization of TFIID. The compact tri lobed architecture is stabilized by a topologically closed Taf5-Taf6 tetramer. We confirm the unique subunit stoichiometry prevailing in TFIID and uncover a hexameric arrangement of Tafs containing a histone fold domain in the Twin lobe. 1 Department of Integrated Structural Biology, Equipe labellisée Ligue Contre le Cancer, Institut de Génétique et de Biologie Moléculaire et Cellulaire, Illkirch 67404, France. 2 Centre National de la Recherche Scientifique, UMR7104, 67404 Illkirch, France. 3 Institut National de la Santé et de la Recherche Médicale, U1258, 67404 Illkirch, France. 4 Université de Strasbourg, Illkirch 67404, France. 5 Institute for Systems Biology, Seattle, WA 98109, USA. These authors contributed equally: Olga Kolesnikova, Adam Ben-Shem. Correspondence and requests for materials should be addressed to P.S. (email: [email protected]) or to G.P.
  • Structure and Mechanism of the RNA Polymerase II Transcription Machinery

    Structure and Mechanism of the RNA Polymerase II Transcription Machinery

    Downloaded from genesdev.cshlp.org on October 9, 2021 - Published by Cold Spring Harbor Laboratory Press REVIEW Structure and mechanism of the RNA polymerase II transcription machinery Allison C. Schier and Dylan J. Taatjes Department of Biochemistry, University of Colorado, Boulder, Colorado 80303, USA RNA polymerase II (Pol II) transcribes all protein-coding ingly high resolution, which has rapidly advanced under- genes and many noncoding RNAs in eukaryotic genomes. standing of the molecular basis of Pol II transcription. Although Pol II is a complex, 12-subunit enzyme, it lacks Structural biology continues to transform our under- the ability to initiate transcription and cannot consistent- standing of complex biological processes because it allows ly transcribe through long DNA sequences. To execute visualization of proteins and protein complexes at or near these essential functions, an array of proteins and protein atomic-level resolution. Combined with mutagenesis and complexes interact with Pol II to regulate its activity. In functional assays, structural data can at once establish this review, we detail the structure and mechanism of how enzymes function, justify genetic links to human dis- over a dozen factors that govern Pol II initiation (e.g., ease, and drive drug discovery. In the past few decades, TFIID, TFIIH, and Mediator), pausing, and elongation workhorse techniques such as NMR and X-ray crystallog- (e.g., DSIF, NELF, PAF, and P-TEFb). The structural basis raphy have been complemented by cryoEM, cross-linking for Pol II transcription regulation has advanced rapidly mass spectrometry (CXMS), and other methods. Recent in the past decade, largely due to technological innova- improvements in data collection and imaging technolo- tions in cryoelectron microscopy.
  • BET Family Members Bdf1/2 Modulate Global Transcription Initiation and Elongation in Saccharomyces Cerevisiae Rafal Donczew*, Steven Hahn*

    BET Family Members Bdf1/2 Modulate Global Transcription Initiation and Elongation in Saccharomyces Cerevisiae Rafal Donczew*, Steven Hahn*

    RESEARCH ARTICLE BET family members Bdf1/2 modulate global transcription initiation and elongation in Saccharomyces cerevisiae Rafal Donczew*, Steven Hahn* Fred Hutchinson Cancer Research Center, Division of Basic Sciences, Seattle, United States Abstract Human bromodomain and extra-terminal domain (BET) family members are promising targets for therapy of cancer and immunoinflammatory diseases, but their mechanisms of action and functional redundancies are poorly understood. Bdf1/2, yeast homologues of the human BET factors, were previously proposed to target transcription factor TFIID to acetylated histone H4, analogous to bromodomains that are present within the largest subunit of metazoan TFIID. We investigated the genome-wide roles of Bdf1/2 and found that their important contributions to transcription extend beyond TFIID function as transcription of many genes is more sensitive to Bdf1/2 than to TFIID depletion. Bdf1/2 co-occupy the majority of yeast promoters and affect preinitiation complex formation through recruitment of TFIID, Mediator, and basal transcription factors to chromatin. Surprisingly, we discovered that hypersensitivity of genes to Bdf1/2 depletion results from combined defects in transcription initiation and early elongation, a striking functional similarity to human BET proteins, most notably Brd4. Our results establish Bdf1/2 as critical for yeast transcription and provide important mechanistic insights into the function of BET proteins in all eukaryotes. *For correspondence: [email protected] (RD); Introduction [email protected] (SH) Bromodomains (BDs) are reader modules that allow protein targeting to chromatin via interactions with acetylated histone tails. BD-containing factors are usually involved in gene transcription, and Competing interests: The their deregulation has been implicated in a spectrum of cancers and immunoinflammatory and neu- authors declare that no rological conditions (Fujisawa and Filippakopoulos, 2017; Wang et al., 2021).
  • Granulocyte Colony-Stimulating Factor-Induced TAF9 Modulates P53-TRIAP1-CASP3 Axis to Prevent Retinal Ganglion Cell Death After Optic Nerve Ischemia

    Granulocyte Colony-Stimulating Factor-Induced TAF9 Modulates P53-TRIAP1-CASP3 Axis to Prevent Retinal Ganglion Cell Death After Optic Nerve Ischemia

    Granulocyte Colony-Stimulating Factor-Induced TAF9 Modulates P53-TRIAP1-CASP3 Axis to Prevent Retinal Ganglion Cell Death after Optic Nerve Ischemia Yao-Tseng Wen Buddhist Tzu Chi General Hospital Hualien: Hualien Tzu Chi Hospital Keh-Liang Lin Chung Shan Medical University Hospital Chin-Te Huang Tzu Chi University Rong Kung Tsai ( [email protected] ) Hualien Tzu Chi Hospital https://orcid.org/0000-0001-8760-5739 Research article Keywords: Granulocyte colony-stimulating factor, Rat anterior ischemic optic neuropathy model, Retinal ganglion cell, TBP associated factor 9, TP53, TRIAP1 Posted Date: January 6th, 2021 DOI: https://doi.org/10.21203/rs.3.rs-138908/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Page 1/25 Abstract Background Optic nerve head (ONH) infarct can result in progressive retinal ganglion cell (RGC) death. Some evidences indicated that the granulocyte colony-stimulating factor (GCSF) provides positive effects against ischemic damage on RGCs. However, protective mechanisms of the GCSF after ONH infarct are complex and remain unclear. Methods To investigate the complex mechanisms, the transcriptome proles of the GCSF-treated retinas were examined using microarray technology. The retinal mRNA samples on days 3 and 7 post rat anterior ischemic optic neuropathy model (rAION) were analyzed by microarray and bioinformatics analyses. To evaluate the TAF9 function in RGC apoptosis, GCSF plus TAF9 siRNA-treated rats were evaluated using retrograde labeling with FluoroGold assay, TUNEL assay, and Western blotting in a rAION. Results GCSF treatment inuenced 3101 genes and 3332 genes on days 3 and 7 post rAION, respectively.
  • (12) United States Patent (10) Patent No.: US 9,057,109 B2 Chang (45) Date of Patent: Jun

    (12) United States Patent (10) Patent No.: US 9,057,109 B2 Chang (45) Date of Patent: Jun

    US009057109B2 (12) United States Patent (10) Patent No.: US 9,057,109 B2 Chang (45) Date of Patent: Jun. 16, 2015 (54) DIAGNOSIS OF MELANOMA AND SOLAR 5,989,815 A 11/1999 Skolnicket al. LENTIGO BY NUCLEC ACID ANALYSIS 6,054,277 A 4/2000 Furcht et al. 6,056,859 A 5/2000 Ramsey et al. 6,129,983 A 10/2000 Schumann et al. (71) Applicant: DermTech International, La Jolla, CA 6,203,987 B1 3/2001 Friend et al. (US) 6,312.909 B1 1 1/2001 Shyjan 6,355.439 B1 3/2002 Chung et al. (72) Inventor: Sherman H. Chang, San Diego, CA 6.410,019 B1 6/2002 DeSimone et al. 6,410,240 B1 6/2002 Hodge et al. (US) 6,551,799 B2 4/2003 Gurney et al. 6,720,145 B2 4/2004 Rheins et al. (73) Assignee: DERMTECH INTERNATIONAL, La 6,726,971 B1 4/2004 Wong Jolla, CA (US) 6,891,022 B1 5/2005 Steward et al. 6,949,338 B2 9, 2005 Rheins et al. (*) Notice: Subject to any disclaimer, the term of this 7,183,057 B2 2/2007 Benson 7,247.426 B2 7/2007 Yakhini et al. patent is extended or adjusted under 35 7,267,951 B2 9, 2007 Alani et al. U.S.C. 154(b) by 0 days. 7,297,480 B2 11/2007 Vogt 7,615,349 B2 11/2009 Riker et al. (21) Appl. No.: 14/199,900 7,662,558 B2 2/2010 Liew 7.919,246 B2 * 4/2011 Lai et al.
  • Mouse Anti-Human TAF11 Monoclonal Antibody, Clone 4E4 (CABT-B11578) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

    Mouse Anti-Human TAF11 Monoclonal Antibody, Clone 4E4 (CABT-B11578) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

    Mouse anti-Human TAF11 monoclonal antibody, clone 4E4 (CABT-B11578) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Immunogen TAF11 (NP_005634, 158 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype IgG1 Source/Host Mouse Species Reactivity Human Clone 4E4 Conjugate Unconjugated Applications WB, IHC, IF, sELISA, ELISA Sequence Similarities SKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF Format Liquid Buffer In 1x PBS, pH 7.2 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. BACKGROUND Introduction Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit of TFIID that is present in all TFIID complexes and interacts with TBP. This subunit also interacts with another small subunit, TAF13, to form a heterodimer with a 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved structure similar to the histone core structure.
  • A Unified Nomenclature for TATA Box Binding Protein (TBP)-Associated Factors (Tafs) Involved in RNA Polymerase II Transcription

    A Unified Nomenclature for TATA Box Binding Protein (TBP)-Associated Factors (Tafs) Involved in RNA Polymerase II Transcription

    Downloaded from genesdev.cshlp.org on September 24, 2021 - Published by Cold Spring Harbor Laboratory Press CORRESPONDENCE A unified nomenclature for TATA box binding protein (TBP)-associated factors (TAFs) involved in RNA polymerase II transcription La`szlo`Tora1 Institut de Ge´ne´tique et de Biologie Mole´culaire et Cellulaire, CNRS/INSERM/ULP, F-67404 ILLKIRCH Cedex, CU de Strasbourg, France Initiation of transcription by RNA polymerase II (Pol II) The unified nomenclature is based on the following requires general transcription factors to assemble the Pol considerations: II pre-initiation complex (PIC) (Hampsey 1998). PIC as- 1. It now appears evident from a comparison of Dro- sembly on both TATA-containing and TATA-less pro- sophila, human, and yeast TFIID that there is an es- moters can be nucleated by the general transcription fac- sential or “core” set of TAFs that are conserved across tors TFIID or B-TFIID, which are comprised of the many species. These 13 evolutionarily conserved TATA-binding protein (TBP) and TBP-associated factors TAFs (Sanders and Weil 2000) have been aligned with (TAF s) (Bell and Tora 1999; Albright and Tjian 2000). II their orthologs from different species and designated More than 10 years ago, the first TAF s were discovered II TAF1 to TAF13 (see Table 1). After extensive discus- in Drosophila and in human cells (Dynlacht et al. 1991; sions this nomenclature was chosen because of its Tanese et al. 1991). These proteins were identified in simplicity and because it complies with guidelines biochemically stable complexes with TBP and named endorsed by both the Saccharomyces Genome Data- after their electrophoretic mobility in polyacrylamide base (SGD) and the human HUGO Gene Nomencla- gels.
  • TAF13 Rabbit Pab

    TAF13 Rabbit Pab

    Leader in Biomolecular Solutions for Life Science TAF13 Rabbit pAb Catalog No.: A9637 Basic Information Background Catalog No. Initiation of transcription by RNA polymerase II requires the activities of more than 70 A9637 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as Observed MW the scaffold for assembly of the remainder of the transcription complex, and acts as a 14kDa channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. Calculated MW TAFs may participate in basal transcription, serve as coactivators, function in promoter 14kDa recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit associated with a subset Category of TFIID complexes. This subunit interacts with TBP and with two other small subunits of TFIID, TAF10 and TAF11. There is a pseudogene located on chromosome 6. Primary antibody Applications WB Cross-Reactivity Human, Mouse, Rat Recommended Dilutions Immunogen Information WB 1:500 - 1:2000 Gene ID Swiss Prot 6884 Q15543 Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-124 of human TAF13 (NP_005636.1). Synonyms TAF13;TAF(II)18;TAF2K;TAFII-18;TAFII18;MRT60 Contact Product Information www.abclonal.com Source Isotype Purification Rabbit IgG Affinity purification Storage Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide,50% glycerol,pH7.3. Validation Data Western blot analysis of extracts of various cell lines, using TAF13 antibody (A9637) at 1:3000 dilution.
  • Plasticity for Axolotl Lens Regeneration Is Associated with Age&#X02010

    Plasticity for Axolotl Lens Regeneration Is Associated with Age‐

    RESEARCH ARTICLE Plasticity for axolotl lens regeneration is associated with age-related changes in gene expression Konstantinos Sousounis1, Antony T. Athippozhy2, S. Randal Voss2 & Panagiotis A. Tsonis1 1Department of Biology and Center for Tissue Regeneration and Engineering, University of Dayton, Dayton OH, USA 2Department of Biology and Spinal Cord and Brain Injury Research Center, University of Kentucky, Lexington, KY 40503, USA Correspondence Abstract Panagiotis A. Tsonis, Department of Biology Mexican axolotls lose potential for lens regeneration 2 weeks after hatching. We and Center for Tissue Regeneration and used microarrays to identify differently expressed genes before and after this critical Engineering, University of Dayton, Day- time, using RNA isolated from iris. Over 3700 genes were identified as differentially ton, Ohio, United States of America. expressed in response to lentectomy between young (7 days post-hatching) and old Tel: 937 229 2579; Fax: 937 229 2021; E-mail: (3 months post-hatching) axolotl larvae. Strikingly, many of the genes were only [email protected] expressed in the early or late iris. Genes that were highly expressed in young Received: 6 June 2014; Revised: 10 August iris significantly enriched electron transport chain, transcription, metabolism, and 2014; Accepted: 3 September 2014 cell cycle gene ontologies, all of which are associated with lens regeneration. In contrast, genes associated with cellular differentiation and tissue maturation doi: 10.1002/reg2.25 were uniquely expressed in old iris. Many of these expression differences strongly suggest that young and old iris samples were collected before and after the spleen became developmentally competent to produce and secrete cells with humoral and innate immunity functions.
  • Rabbit Anti-TAF13 Antibody-SL12896R

    Rabbit Anti-TAF13 Antibody-SL12896R

    SunLong Biotech Co.,LTD Tel: 0086-571- 56623320 Fax:0086-571- 56623318 E-mail:[email protected] www.sunlongbiotech.com Rabbit Anti-TAF13 antibody SL12896R Product Name: TAF13 Chinese Name: 转录起始因子TFIID亚基13抗体 MGC22425; TAF(II)18; taf13; TAF13 RNA polymerase II, TATA box binding protein (TBP) associated factor, 18kDa; TAF13_HUMAN; TAF2K; TAFII 18; TAFII-18; Alias: TAFII18; Transcription initiation factor TFIID 18 kDa subunit; Transcription initiation factor TFIID subunit 13. Organism Species: Rabbit Clonality: Polyclonal React Species: Human,Mouse,Rat,Chicken,Dog,Pig,Cow,Horse,Rabbit,Sheep,Orangutan ELISA=1:500-1000IHC-P=1:400-800IHC-F=1:400-800ICC=1:100-500IF=1:100- 500(Paraffin sections need antigen repair) Applications: not yet tested in other applications. optimal dilutions/concentrations should be determined by the end user. Molecular weight: 14kDa Cellular localization: The nucleus Form: Lyophilized or Liquid Concentration: 1mg/ml immunogen: KLHwww.sunlongbiotech.com conjugated synthetic peptide derived from human TAF13:1-100/124 Lsotype: IgG Purification: affinity purified by Protein A Storage Buffer: 0.01M TBS(pH7.4) with 1% BSA, 0.03% Proclin300 and 50% Glycerol. Store at -20 °C for one year. Avoid repeated freeze/thaw cycles. The lyophilized antibody is stable at room temperature for at least one month and for greater than a year Storage: when kept at -20°C. When reconstituted in sterile pH 7.4 0.01M PBS or diluent of antibody the antibody is stable for at least two weeks at 2-4 °C. PubMed: PubMed Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides.
  • Primepcr™Assay Validation Report

    Primepcr™Assay Validation Report

    PrimePCR™Assay Validation Report Gene Information Gene Name TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa Gene Symbol TAF13 Organism Human Gene Summary Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID) which binds to the core promoter to position the polymerase properly serves as the scaffold for assembly of the remainder of the transcription complex and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription serve as coactivators function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit associated with a subset of TFIID complexes. This subunit interacts with TBP and with two other small subunits of TFIID TAF10 and TAF11. There is a pseudogene located on chromosome 6. Gene Aliases MGC22425, TAF2K, TAFII18 RefSeq Accession No. NC_000001.10, NT_032977.9 UniGene ID Hs.632426 Ensembl Gene ID ENSG00000197780 Entrez Gene ID 6884 Assay Information Unique Assay ID qHsaCID0016815 Assay Type SYBR® Green Detected Coding Transcript(s) ENST00000338366 Amplicon Context Sequence CGAATCAAGAAGACGATATCTTCAACTTGTACTCGACCTTGTCTTCCAATTGACAT TGCCTTGTGAGTCATTTCAGTGATAAACTCTATGACAAGATCTTCAAGAATATCCA CTGACTCAGTATAAGGATTCTGGTCATCCCCAAAGCC Amplicon Length (bp) 119 Chromosome Location 1:109607248-109608837 Assay Design Intron-spanning Purification Desalted Validation Results Efficiency (%) 103 Page 1/5 PrimePCR™Assay Validation Report R2 0.9997 cDNA Cq 21.25 cDNA Tm (Celsius) 79.5 gDNA Cq Specificity (%) 100 Information to assist with data interpretation is provided at the end of this report.
  • PROTEIN-PROTEIN INTERACTION MAP of Arabidopsis Thaliana GENERAL TRANSCRIPTION FACTORS A, B, D, E, and F

    PROTEIN-PROTEIN INTERACTION MAP of Arabidopsis Thaliana GENERAL TRANSCRIPTION FACTORS A, B, D, E, and F

    PROTEIN-PROTEIN INTERACTION MAP OF Arabidopsis thaliana GENERAL TRANSCRIPTION FACTORS A, B, D, E, AND F By SHAI JOSHUA LAWIT A DISSERTATION PRESENTED TO THE GRADUATE SCHOOL OF THE UNIVERSITY OF FLORIDA IN PARTIAL FULFILLMENT OF THE REQUIREMENTS FOR THE DEGREE OF DOCTOR OF PHILOSOPHY UNIVERSITY OF FLORIDA 2003 Copyright 2003 by Shai Joshua Lawit This document is dedicated to my family, both genetic and scientific. ACKNOWLEDGMENTS I thank my dearest wife, Kristel Lynn, for her undying support for me. I also thank my son, Benjamin Owen, for constant interest in this document as I wrote and unending smiles and hugs at all times. I thank my parents and all of my family for instilling me with a desire for education and excellence. Of course, I have a great appreciation for the members of the Gurley lab (past, present, and future) who continually contribute to this field of research. John Davis and the members of his lab (especially Chris Dervinis for helping me to get access to the Poplar genomic sequences and Ram Kishore Alavalapati for running all the PAUP analyses) deserve special thanks for technical assistance, collaboration, and helpful discussions. I would finally like to thank William B. Gurley, Eva Czarnecka-Verner, Robert Ferl, Alice Harmon, Karen Koch, Donald McCarty, Thomas Yang, Robert R. Schmidt, Waltraud I. Dunn, and the entire teaching faculty who have molded me into the scientist that I am. iv TABLE OF CONTENTS Page ACKNOWLEDGMENTS ................................................................................................