DOCSLIB.ORG

Mouse Anti-Human TAF11 Monoclonal Antibody, Clone 4E4 (CABT-B11578) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Mouse Anti-Human TAF11 Monoclonal Antibody, Clone 4E4 (CABT-B11578) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use Mouse anti-Human TAF11 monoclonal antibody, clone 4E4 (CABT-B11578) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Immunogen TAF11 (NP_005634, 158 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype IgG1 Source/Host Mouse Species Reactivity Human Clone 4E4 Conjugate Unconjugated Applications WB, IHC, IF, sELISA, ELISA Sequence Similarities SKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF Format Liquid Buffer In 1x PBS, pH 7.2 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. BACKGROUND Introduction Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit of TFIID that is present in all TFIID complexes and interacts with TBP. This subunit also interacts with another small subunit, TAF13, to form a heterodimer with a 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved structure similar to the histone core structure. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2012] Keywords TAF11; TAF11 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 28kDa; TAF2I; PRO2134; TAFII28; MGC:15243; transcription initiation factor TFIID subunit 11; TAFII-28; TAF(II)28; TFIID subunit p30-beta; transcription initiation factor TFIID 28 kD subunit; transcription initiation factor TFIID 28 kDa subunit; TATA box binding protein (TBP)-associated factor, RNA polymerase II, I, 28kD; GENE INFORMATION Entrez Gene ID 6882 UniProt ID Q15544 Pathway Basal transcription factors, organism-specific biosystem; Basal transcription factors, conserved biosystem; Disease, organism-specific biosystem; Gene Expression, organism-specific biosystem; HIV Infection, organism-specific biosystem; HIV Life Cycle, organism-specific biosystem; HIV-1 Transcription Initiation, organism-specific biosystem; Function DNA binding; protein N-terminus binding; protein binding; thyroid hormone receptor binding; transcription coactivator activity; vitamin D receptor binding; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.
Load more

Recommended publications
  • Molecular Structure of Promoter-Bound Yeast TFIID
    ARTICLE DOI: 10.1038/s41467-018-07096-y OPEN Molecular structure of promoter-bound yeast TFIID Olga Kolesnikova 1,2,3,4, Adam Ben-Shem1,2,3,4, Jie Luo5, Jeff Ranish 5, Patrick Schultz 1,2,3,4 & Gabor Papai 1,2,3,4 Transcription preinitiation complex assembly on the promoters of protein encoding genes is nucleated in vivo by TFIID composed of the TATA-box Binding Protein (TBP) and 13 TBP- associate factors (Tafs) providing regulatory and chromatin binding functions. Here we present the cryo-electron microscopy structure of promoter-bound yeast TFIID at a resolu- 1234567890():,; tion better than 5 Å, except for a flexible domain. We position the crystal structures of several subunits and, in combination with cross-linking studies, describe the quaternary organization of TFIID. The compact tri lobed architecture is stabilized by a topologically closed Taf5-Taf6 tetramer. We confirm the unique subunit stoichiometry prevailing in TFIID and uncover a hexameric arrangement of Tafs containing a histone fold domain in the Twin lobe. 1 Department of Integrated Structural Biology, Equipe labellisée Ligue Contre le Cancer, Institut de Génétique et de Biologie Moléculaire et Cellulaire, Illkirch 67404, France. 2 Centre National de la Recherche Scientifique, UMR7104, 67404 Illkirch, France. 3 Institut National de la Santé et de la Recherche Médicale, U1258, 67404 Illkirch, France. 4 Université de Strasbourg, Illkirch 67404, France. 5 Institute for Systems Biology, Seattle, WA 98109, USA. These authors contributed equally: Olga Kolesnikova, Adam Ben-Shem. Correspondence and requests for materials should be addressed to P.S. (email: [email protected]) or to G.P.
    [Show full text]
  • Supplementary Materials
    Supplementary materials Supplementary Table S1: MGNC compound library Ingredien Molecule Caco- Mol ID MW AlogP OB (%) BBB DL FASA- HL t Name Name 2 shengdi MOL012254 campesterol 400.8 7.63 37.58 1.34 0.98 0.7 0.21 20.2 shengdi MOL000519 coniferin 314.4 3.16 31.11 0.42 -0.2 0.3 0.27 74.6 beta- shengdi MOL000359 414.8 8.08 36.91 1.32 0.99 0.8 0.23 20.2 sitosterol pachymic shengdi MOL000289 528.9 6.54 33.63 0.1 -0.6 0.8 0 9.27 acid Poricoic acid shengdi MOL000291 484.7 5.64 30.52 -0.08 -0.9 0.8 0 8.67 B Chrysanthem shengdi MOL004492 585 8.24 38.72 0.51 -1 0.6 0.3 17.5 axanthin 20- shengdi MOL011455 Hexadecano 418.6 1.91 32.7 -0.24 -0.4 0.7 0.29 104 ylingenol huanglian MOL001454 berberine 336.4 3.45 36.86 1.24 0.57 0.8 0.19 6.57 huanglian MOL013352 Obacunone 454.6 2.68 43.29 0.01 -0.4 0.8 0.31 -13 huanglian MOL002894 berberrubine 322.4 3.2 35.74 1.07 0.17 0.7 0.24 6.46 huanglian MOL002897 epiberberine 336.4 3.45 43.09 1.17 0.4 0.8 0.19 6.1 huanglian MOL002903 (R)-Canadine 339.4 3.4 55.37 1.04 0.57 0.8 0.2 6.41 huanglian MOL002904 Berlambine 351.4 2.49 36.68 0.97 0.17 0.8 0.28 7.33 Corchorosid huanglian MOL002907 404.6 1.34 105 -0.91 -1.3 0.8 0.29 6.68 e A_qt Magnogrand huanglian MOL000622 266.4 1.18 63.71 0.02 -0.2 0.2 0.3 3.17 iolide huanglian MOL000762 Palmidin A 510.5 4.52 35.36 -0.38 -1.5 0.7 0.39 33.2 huanglian MOL000785 palmatine 352.4 3.65 64.6 1.33 0.37 0.7 0.13 2.25 huanglian MOL000098 quercetin 302.3 1.5 46.43 0.05 -0.8 0.3 0.38 14.4 huanglian MOL001458 coptisine 320.3 3.25 30.67 1.21 0.32 0.9 0.26 9.33 huanglian MOL002668 Worenine
    [Show full text]
  • Pathway Analysis of Breast, Colorectal, Pancreatic Cancers and Glioblastoma
    Pathway analysis ofbreast, colorectal, pancreatic cancers and glioblastoma Dongyan Song Degree project inbiology, Bachelor ofscience, 2009 Examensarbete ibiologi 30 hp tillkandidatexamen, 2009 Biology Education Centre, Uppsala University and Department ofGenetics and Pathology Supervisor: Tobias Sjöblom Pathway analysis of breast, colorectal, pancreatic cancers and glioblastoma Summary Cancer is a genetic disease, and due to the multi-step progression, mutated genes accumulate in genome, leading to a gene spectrum with a few frequently mutated genes and a bunch of infrequently mutated genes. Because of the complexity of mutation profile in gene level, this study tries to analyze cancer mutations in a pathway level, implemented as clusters in this case. Initial attempts used phylogenetic analysis, which gave a result that breast and colorectal cancers cannot be distinguished from each other only by information of mutated genes but pancreatic cancers and glioblastoma formed a cluster distinguishing with patients with pancreatic cancer or glioblastoma. Thus, to some extent, the pattern of mutated genes can distinguish different cancers or different patients with same cancer type, but the results are not clear enough to give a conclusion. So, I implemented network methodology to study mutational pathway patterns in breast, colorectal, pancreatic cancers and glioblastoma. The initial network was constructed based on gene-gene interaction pairs identified from literature mining and the STRING database. PubMed IDs were retrieved with Entrez Gene IDs as queries, and via checking the overlap of PubMed IDs, 135,863,922 potential gene-gene interaction pairs were found. Negative logarithms of co-occurrence probabilities were calculated and the number of pairs was reduced by setting the significance level at 99.7% in the Poisson distribution.
    [Show full text]
  • Structure and Mechanism of the RNA Polymerase II Transcription Machinery
    Downloaded from genesdev.cshlp.org on October 9, 2021 - Published by Cold Spring Harbor Laboratory Press REVIEW Structure and mechanism of the RNA polymerase II transcription machinery Allison C. Schier and Dylan J. Taatjes Department of Biochemistry, University of Colorado, Boulder, Colorado 80303, USA RNA polymerase II (Pol II) transcribes all protein-coding ingly high resolution, which has rapidly advanced under- genes and many noncoding RNAs in eukaryotic genomes. standing of the molecular basis of Pol II transcription. Although Pol II is a complex, 12-subunit enzyme, it lacks Structural biology continues to transform our under- the ability to initiate transcription and cannot consistent- standing of complex biological processes because it allows ly transcribe through long DNA sequences. To execute visualization of proteins and protein complexes at or near these essential functions, an array of proteins and protein atomic-level resolution. Combined with mutagenesis and complexes interact with Pol II to regulate its activity. In functional assays, structural data can at once establish this review, we detail the structure and mechanism of how enzymes function, justify genetic links to human dis- over a dozen factors that govern Pol II initiation (e.g., ease, and drive drug discovery. In the past few decades, TFIID, TFIIH, and Mediator), pausing, and elongation workhorse techniques such as NMR and X-ray crystallog- (e.g., DSIF, NELF, PAF, and P-TEFb). The structural basis raphy have been complemented by cryoEM, cross-linking for Pol II transcription regulation has advanced rapidly mass spectrometry (CXMS), and other methods. Recent in the past decade, largely due to technological innova- improvements in data collection and imaging technolo- tions in cryoelectron microscopy.
    [Show full text]
  • BET Family Members Bdf1/2 Modulate Global Transcription Initiation and Elongation in Saccharomyces Cerevisiae Rafal Donczew*, Steven Hahn*
    RESEARCH ARTICLE BET family members Bdf1/2 modulate global transcription initiation and elongation in Saccharomyces cerevisiae Rafal Donczew*, Steven Hahn* Fred Hutchinson Cancer Research Center, Division of Basic Sciences, Seattle, United States Abstract Human bromodomain and extra-terminal domain (BET) family members are promising targets for therapy of cancer and immunoinflammatory diseases, but their mechanisms of action and functional redundancies are poorly understood. Bdf1/2, yeast homologues of the human BET factors, were previously proposed to target transcription factor TFIID to acetylated histone H4, analogous to bromodomains that are present within the largest subunit of metazoan TFIID. We investigated the genome-wide roles of Bdf1/2 and found that their important contributions to transcription extend beyond TFIID function as transcription of many genes is more sensitive to Bdf1/2 than to TFIID depletion. Bdf1/2 co-occupy the majority of yeast promoters and affect preinitiation complex formation through recruitment of TFIID, Mediator, and basal transcription factors to chromatin. Surprisingly, we discovered that hypersensitivity of genes to Bdf1/2 depletion results from combined defects in transcription initiation and early elongation, a striking functional similarity to human BET proteins, most notably Brd4. Our results establish Bdf1/2 as critical for yeast transcription and provide important mechanistic insights into the function of BET proteins in all eukaryotes. *For correspondence: [email protected] (RD); Introduction [email protected] (SH) Bromodomains (BDs) are reader modules that allow protein targeting to chromatin via interactions with acetylated histone tails. BD-containing factors are usually involved in gene transcription, and Competing interests: The their deregulation has been implicated in a spectrum of cancers and immunoinflammatory and neu- authors declare that no rological conditions (Fujisawa and Filippakopoulos, 2017; Wang et al., 2021).
    [Show full text]
  • The ZNF76 Rs10947540 Polymorphism Associated With
    www.nature.com/scientificreports OPEN The ZNF76 rs10947540 polymorphism associated with systemic lupus erythematosus risk in Chinese populations Yuan‑yuan Qi1,4, Yan Cui1,4, Hui Lang2, Ya‑ling Zhai1, Xiao‑xue Zhang1, Xiao‑yang Wang1, Xin‑ran Liu1, Ya‑fei Zhao1, Xiang‑hui Ning3 & Zhan‑zheng Zhao1* Systemic lupus erythematosus (SLE) is a typical autoimmune disease with a strong genetic disposition. Genetic studies have revealed that single‑nucleotide polymorphisms (SNPs) in zinc fnger protein (ZNF)‑coding genes are associated with susceptibility to autoimmune diseases, including SLE. The objective of the current study was to evaluate the correlation between ZNF76 gene polymorphisms and SLE risk in Chinese populations. A total of 2801 individuals (1493 cases and 1308 controls) of Chinese Han origin were included in this two‑stage genetic association study. The expression of ZNF76 was evaluated, and integrated bioinformatic analysis was also conducted. The results showed that 28 SNPs were associated with SLE susceptibility in the GWAS cohort, and the association of rs10947540 was successfully replicated in the independent replication cohort −2 (Preplication = 1.60 × 10 , OR 1.19, 95% CI 1.03–1.37). After meta‑analysis, the association between −6 rs10947540 and SLE was pronounced (Pmeta = 9.62 × 10 , OR 1.29, 95% CI 1.15–1.44). Stratifed analysis suggested that ZNF76 rs10947540 C carriers were more likely to develop relatively high levels of serum creatinine (Scr) than noncarriers (CC + CT vs. TT, p = 9.94 × 10−4). The bioinformatic analysis revealed that ZNF76 rs10947540 was annotated as an eQTL and that rs10947540 was correlated with decreased expression of ZNF76.
    [Show full text]
  • Non-Canonical TAF Complexes Regulate Active Promoters in Human Embryonic Stem Cells
    University of Massachusetts Medical School eScholarship@UMMS Program in Gene Function and Expression Publications and Presentations Molecular, Cell and Cancer Biology 2012-11-13 Non-canonical TAF complexes regulate active promoters in human embryonic stem cells Glenn A. Maston University of Massachusetts Medical School Et al. Let us know how access to this document benefits ou.y Follow this and additional works at: https://escholarship.umassmed.edu/pgfe_pp Part of the Genetics and Genomics Commons Repository Citation Maston GA, Zhu LJ, Chamberlain L, Lin L, Fang M, Green MR. (2012). Non-canonical TAF complexes regulate active promoters in human embryonic stem cells. Program in Gene Function and Expression Publications and Presentations. https://doi.org/10.7554/eLife.00068. Retrieved from https://escholarship.umassmed.edu/pgfe_pp/211 This material is brought to you by eScholarship@UMMS. It has been accepted for inclusion in Program in Gene Function and Expression Publications and Presentations by an authorized administrator of eScholarship@UMMS. For more information, please contact [email protected]. RESEARCH ARTICLE elife.elifesciences.org Non-canonical TAF complexes regulate active promoters in human embryonic stem cells Glenn A Maston1,2, Lihua Julie Zhu1,3, Lynn Chamberlain1,2, Ling Lin1,2, Minggang Fang1,2, Michael R Green1,2* 1Programs in Gene Function and Expression and Molecular Medicine, University of Massachusetts Medical School, Worcester, United States; 2Howard Hughes Medical Institute, Chevy Chase, United States; 3Program in Bioinformatics and Integrative Biology, University of Massachusetts Medical School, Worcester, United States Abstract The general transcription factor TFIID comprises the TATA-box-binding protein (TBP) and approximately 14 TBP-associated factors (TAFs).
    [Show full text]
  • Granulocyte Colony-Stimulating Factor-Induced TAF9 Modulates P53-TRIAP1-CASP3 Axis to Prevent Retinal Ganglion Cell Death After Optic Nerve Ischemia
    Granulocyte Colony-Stimulating Factor-Induced TAF9 Modulates P53-TRIAP1-CASP3 Axis to Prevent Retinal Ganglion Cell Death after Optic Nerve Ischemia Yao-Tseng Wen Buddhist Tzu Chi General Hospital Hualien: Hualien Tzu Chi Hospital Keh-Liang Lin Chung Shan Medical University Hospital Chin-Te Huang Tzu Chi University Rong Kung Tsai ( [email protected] ) Hualien Tzu Chi Hospital https://orcid.org/0000-0001-8760-5739 Research article Keywords: Granulocyte colony-stimulating factor, Rat anterior ischemic optic neuropathy model, Retinal ganglion cell, TBP associated factor 9, TP53, TRIAP1 Posted Date: January 6th, 2021 DOI: https://doi.org/10.21203/rs.3.rs-138908/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Page 1/25 Abstract Background Optic nerve head (ONH) infarct can result in progressive retinal ganglion cell (RGC) death. Some evidences indicated that the granulocyte colony-stimulating factor (GCSF) provides positive effects against ischemic damage on RGCs. However, protective mechanisms of the GCSF after ONH infarct are complex and remain unclear. Methods To investigate the complex mechanisms, the transcriptome proles of the GCSF-treated retinas were examined using microarray technology. The retinal mRNA samples on days 3 and 7 post rat anterior ischemic optic neuropathy model (rAION) were analyzed by microarray and bioinformatics analyses. To evaluate the TAF9 function in RGC apoptosis, GCSF plus TAF9 siRNA-treated rats were evaluated using retrograde labeling with FluoroGold assay, TUNEL assay, and Western blotting in a rAION. Results GCSF treatment inuenced 3101 genes and 3332 genes on days 3 and 7 post rAION, respectively.
    [Show full text]
  • (12) United States Patent (10) Patent No.: US 9,057,109 B2 Chang (45) Date of Patent: Jun
    US009057109B2 (12) United States Patent (10) Patent No.: US 9,057,109 B2 Chang (45) Date of Patent: Jun. 16, 2015 (54) DIAGNOSIS OF MELANOMA AND SOLAR 5,989,815 A 11/1999 Skolnicket al. LENTIGO BY NUCLEC ACID ANALYSIS 6,054,277 A 4/2000 Furcht et al. 6,056,859 A 5/2000 Ramsey et al. 6,129,983 A 10/2000 Schumann et al. (71) Applicant: DermTech International, La Jolla, CA 6,203,987 B1 3/2001 Friend et al. (US) 6,312.909 B1 1 1/2001 Shyjan 6,355.439 B1 3/2002 Chung et al. (72) Inventor: Sherman H. Chang, San Diego, CA 6.410,019 B1 6/2002 DeSimone et al. 6,410,240 B1 6/2002 Hodge et al. (US) 6,551,799 B2 4/2003 Gurney et al. 6,720,145 B2 4/2004 Rheins et al. (73) Assignee: DERMTECH INTERNATIONAL, La 6,726,971 B1 4/2004 Wong Jolla, CA (US) 6,891,022 B1 5/2005 Steward et al. 6,949,338 B2 9, 2005 Rheins et al. (*) Notice: Subject to any disclaimer, the term of this 7,183,057 B2 2/2007 Benson 7,247.426 B2 7/2007 Yakhini et al. patent is extended or adjusted under 35 7,267,951 B2 9, 2007 Alani et al. U.S.C. 154(b) by 0 days. 7,297,480 B2 11/2007 Vogt 7,615,349 B2 11/2009 Riker et al. (21) Appl. No.: 14/199,900 7,662,558 B2 2/2010 Liew 7.919,246 B2 * 4/2011 Lai et al.
    [Show full text]
  • Integrative Framework for Identification of Key Cell Identity Genes Uncovers
    Integrative framework for identification of key cell PNAS PLUS identity genes uncovers determinants of ES cell identity and homeostasis Senthilkumar Cinghua,1, Sailu Yellaboinaa,b,c,1, Johannes M. Freudenberga,b, Swati Ghosha, Xiaofeng Zhengd, Andrew J. Oldfielda, Brad L. Lackfordd, Dmitri V. Zaykinb, Guang Hud,2, and Raja Jothia,b,2 aSystems Biology Section and dStem Cell Biology Section, Laboratory of Molecular Carcinogenesis, and bBiostatistics Branch, National Institute of Environmental Health Sciences, National Institutes of Health, Research Triangle Park, NC 27709; and cCR Rao Advanced Institute of Mathematics, Statistics, and Computer Science, Hyderabad, Andhra Pradesh 500 046, India Edited by Norbert Perrimon, Harvard Medical School and Howard Hughes Medical Institute, Boston, MA, and approved March 17, 2014 (received for review October 2, 2013) Identification of genes associated with specific biological pheno- (mESCs) for genes essential for the maintenance of ESC identity types is a fundamental step toward understanding the molecular resulted in only ∼8% overlap (8, 9), although many of the unique basis underlying development and pathogenesis. Although RNAi- hits in each screen were known or later validated to be real. The based high-throughput screens are routinely used for this task, lack of concordance suggest that these screens have not reached false discovery and sensitivity remain a challenge. Here we describe saturation (14) and that additional genes of importance remain a computational framework for systematic integration of published to be discovered. gene expression data to identify genes defining a phenotype of Motivated by the need for an alternative approach for iden- interest. We applied our approach to rank-order all genes based on tification of key cell identity genes, we developed a computa- their likelihood of determining ES cell (ESC) identity.
    [Show full text]
  • Agricultural University of Athens
    ΓΕΩΠΟΝΙΚΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΑΘΗΝΩΝ ΣΧΟΛΗ ΕΠΙΣΤΗΜΩΝ ΤΩΝ ΖΩΩΝ ΤΜΗΜΑ ΕΠΙΣΤΗΜΗΣ ΖΩΙΚΗΣ ΠΑΡΑΓΩΓΗΣ ΕΡΓΑΣΤΗΡΙΟ ΓΕΝΙΚΗΣ ΚΑΙ ΕΙΔΙΚΗΣ ΖΩΟΤΕΧΝΙΑΣ ΔΙΔΑΚΤΟΡΙΚΗ ΔΙΑΤΡΙΒΗ Εντοπισμός γονιδιωματικών περιοχών και δικτύων γονιδίων που επηρεάζουν παραγωγικές και αναπαραγωγικές ιδιότητες σε πληθυσμούς κρεοπαραγωγικών ορνιθίων ΕΙΡΗΝΗ Κ. ΤΑΡΣΑΝΗ ΕΠΙΒΛΕΠΩΝ ΚΑΘΗΓΗΤΗΣ: ΑΝΤΩΝΙΟΣ ΚΟΜΙΝΑΚΗΣ ΑΘΗΝΑ 2020 ΔΙΔΑΚΤΟΡΙΚΗ ΔΙΑΤΡΙΒΗ Εντοπισμός γονιδιωματικών περιοχών και δικτύων γονιδίων που επηρεάζουν παραγωγικές και αναπαραγωγικές ιδιότητες σε πληθυσμούς κρεοπαραγωγικών ορνιθίων Genome-wide association analysis and gene network analysis for (re)production traits in commercial broilers ΕΙΡΗΝΗ Κ. ΤΑΡΣΑΝΗ ΕΠΙΒΛΕΠΩΝ ΚΑΘΗΓΗΤΗΣ: ΑΝΤΩΝΙΟΣ ΚΟΜΙΝΑΚΗΣ Τριμελής Επιτροπή: Aντώνιος Κομινάκης (Αν. Καθ. ΓΠΑ) Ανδρέας Κράνης (Eρευν. B, Παν. Εδιμβούργου) Αριάδνη Χάγερ (Επ. Καθ. ΓΠΑ) Επταμελής εξεταστική επιτροπή: Aντώνιος Κομινάκης (Αν. Καθ. ΓΠΑ) Ανδρέας Κράνης (Eρευν. B, Παν. Εδιμβούργου) Αριάδνη Χάγερ (Επ. Καθ. ΓΠΑ) Πηνελόπη Μπεμπέλη (Καθ. ΓΠΑ) Δημήτριος Βλαχάκης (Επ. Καθ. ΓΠΑ) Ευάγγελος Ζωίδης (Επ.Καθ. ΓΠΑ) Γεώργιος Θεοδώρου (Επ.Καθ. ΓΠΑ) 2 Εντοπισμός γονιδιωματικών περιοχών και δικτύων γονιδίων που επηρεάζουν παραγωγικές και αναπαραγωγικές ιδιότητες σε πληθυσμούς κρεοπαραγωγικών ορνιθίων Περίληψη Σκοπός της παρούσας διδακτορικής διατριβής ήταν ο εντοπισμός γενετικών δεικτών και υποψηφίων γονιδίων που εμπλέκονται στο γενετικό έλεγχο δύο τυπικών πολυγονιδιακών ιδιοτήτων σε κρεοπαραγωγικά ορνίθια. Μία ιδιότητα σχετίζεται με την ανάπτυξη (σωματικό βάρος στις 35 ημέρες, ΣΒ) και η άλλη με την αναπαραγωγική
    [Show full text]
  • A Unified Nomenclature for TATA Box Binding Protein (TBP)-Associated Factors (Tafs) Involved in RNA Polymerase II Transcription
    Downloaded from genesdev.cshlp.org on September 24, 2021 - Published by Cold Spring Harbor Laboratory Press CORRESPONDENCE A unified nomenclature for TATA box binding protein (TBP)-associated factors (TAFs) involved in RNA polymerase II transcription La`szlo`Tora1 Institut de Ge´ne´tique et de Biologie Mole´culaire et Cellulaire, CNRS/INSERM/ULP, F-67404 ILLKIRCH Cedex, CU de Strasbourg, France Initiation of transcription by RNA polymerase II (Pol II) The unified nomenclature is based on the following requires general transcription factors to assemble the Pol considerations: II pre-initiation complex (PIC) (Hampsey 1998). PIC as- 1. It now appears evident from a comparison of Dro- sembly on both TATA-containing and TATA-less pro- sophila, human, and yeast TFIID that there is an es- moters can be nucleated by the general transcription fac- sential or “core” set of TAFs that are conserved across tors TFIID or B-TFIID, which are comprised of the many species. These 13 evolutionarily conserved TATA-binding protein (TBP) and TBP-associated factors TAFs (Sanders and Weil 2000) have been aligned with (TAF s) (Bell and Tora 1999; Albright and Tjian 2000). II their orthologs from different species and designated More than 10 years ago, the first TAF s were discovered II TAF1 to TAF13 (see Table 1). After extensive discus- in Drosophila and in human cells (Dynlacht et al. 1991; sions this nomenclature was chosen because of its Tanese et al. 1991). These proteins were identified in simplicity and because it complies with guidelines biochemically stable complexes with TBP and named endorsed by both the Saccharomyces Genome Data- after their electrophoretic mobility in polyacrylamide base (SGD) and the human HUGO Gene Nomencla- gels.
    [Show full text]