Mouse Anti-Human TAF11 Monoclonal Antibody, Clone 4E4 (CABT-B11578) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Mouse anti-Human TAF11 monoclonal antibody, clone 4E4 (CABT-B11578) This product is for research use only and is not intended for diagnostic use.

PRODUCT INFORMATION

Immunogen TAF11 (NP_005634, 158 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Isotype IgG1

Source/Host Mouse

Species Reactivity Human

Clone 4E4

Conjugate Unconjugated

Applications WB, IHC, IF, sELISA, ELISA

Sequence Similarities SKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF

Format Liquid

Buffer In 1x PBS, pH 7.2

Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

BACKGROUND

Introduction Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit of TFIID that is present in all TFIID complexes and interacts with TBP. This subunit also interacts with another small subunit, TAF13, to form a heterodimer with a

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]

Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved structure similar to the histone core structure. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2012]

Keywords TAF11; TAF11 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 28kDa; TAF2I; PRO2134; TAFII28; MGC:15243; transcription initiation factor TFIID subunit 11; TAFII-28; TAF(II)28; TFIID subunit p30-beta; transcription initiation factor TFIID 28 kD subunit; transcription initiation factor TFIID 28 kDa subunit; TATA box binding protein (TBP)-associated factor, RNA polymerase II, I, 28kD;

GENE INFORMATION

Entrez Gene ID 6882

UniProt ID Q15544

Pathway Basal transcription factors, organism-specific biosystem; Basal transcription factors, conserved biosystem; Disease, organism-specific biosystem; Gene Expression, organism-specific biosystem; HIV Infection, organism-specific biosystem; HIV Life Cycle, organism-specific biosystem; HIV-1 Transcription Initiation, organism-specific biosystem;

Function DNA binding; protein N-terminus binding; protein binding; thyroid hormone receptor binding; transcription coactivator activity; vitamin D receptor binding;

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]