DOCSLIB.ORG

Mouse Jam3 Conditional Knockout Project (CRISPR/Cas9)

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Mouse Jam3 Conditional Knockout Project (CRISPR/Cas9) https://www.alphaknockout.com Mouse Jam3 Conditional Knockout Project (CRISPR/Cas9) Objective: To create a Jam3 conditional knockout Mouse model (C57BL/6J) by CRISPR/Cas-mediated genome engineering. Strategy summary: The Jam3 gene (NCBI Reference Sequence: NM_023277 ; Ensembl: ENSMUSG00000031990 ) is located on Mouse chromosome 9. 9 exons are identified, with the ATG start codon in exon 1 and the TGA stop codon in exon 9 (Transcript: ENSMUST00000034472). Exon 4~5 will be selected as conditional knockout region (cKO region). Deletion of this region should result in the loss of function of the Mouse Jam3 gene. To engineer the targeting vector, homologous arms and cKO region will be generated by PCR using BAC clone RP23-375B13 as template. Cas9, gRNA and targeting vector will be co-injected into fertilized eggs for cKO Mouse production. The pups will be genotyped by PCR followed by sequencing analysis. Note: Approximately 60% of mice homozygous for a targeted mutation exhibit postnatal lethality. Males are infertile and display small testes and arrested differentiation of round spermatids into spermatozoa, as shown by the absence of acrosomes, elongated nuclei, and morphological signs of polarization. Exon 4 starts from about 27.63% of the coding region. The knockout of Exon 4~5 will result in frameshift of the gene. The size of intron 3 for 5'-loxP site insertion: 3490 bp, and the size of intron 5 for 3'-loxP site insertion: 1055 bp. The size of effective cKO region: ~1279 bp. The cKO region does not have any other known gene. Page 1 of 8 https://www.alphaknockout.com Overview of the Targeting Strategy Wildtype allele 5' gRNA region gRNA region 3' 1 4 5 6 9 Targeting vector Targeted allele Constitutive KO allele (After Cre recombination) Legends Exon of mouse Jam3 Homology arm cKO region loxP site Page 2 of 8 https://www.alphaknockout.com Overview of the Dot Plot Window size: 10 bp Forward Reverse Complement Sequence 12 Note: The sequence of homologous arms and cKO region is aligned with itself to determine if there are tandem repeats. No significant tandem repeat is found in the dot plot matrix. So this region is suitable for PCR screening or sequencing analysis. Overview of the GC Content Distribution Window size: 300 bp Sequence 12 Summary: Full Length(7779bp) | A(25.18% 1959) | C(21.67% 1686) | T(27.19% 2115) | G(25.95% 2019) Note: The sequence of homologous arms and cKO region is analyzed to determine the GC content. No significant high GC-content region is found. So this region is suitable for PCR screening or sequencing analysis. Page 3 of 8 https://www.alphaknockout.com BLAT Search Results (up) QUERY SCORE START END QSIZE IDENTITY CHROM STRAND START END SPAN ----------------------------------------------------------------------------------------------- browser details YourSeq 3000 1 3000 3000 100.0% chr9 - 27102267 27105266 3000 browser details YourSeq 76 2050 2665 3000 93.2% chr15 - 99587555 99776426 188872 browser details YourSeq 74 1980 2091 3000 94.2% chr1 - 73546275 73546419 145 browser details YourSeq 71 2614 2734 3000 92.7% chr4 + 33678394 33678574 181 browser details YourSeq 70 2613 2780 3000 93.8% chr11 + 100923745 101219169 295425 browser details YourSeq 69 1987 2105 3000 85.8% chr13 - 98236176 98236310 135 browser details YourSeq 68 2633 2750 3000 92.6% chr7 - 6473648 6473822 175 browser details YourSeq 67 2613 2721 3000 95.9% chr8 - 25647117 25647299 183 browser details YourSeq 67 1984 2105 3000 87.0% chr6 - 88217687 88218076 390 browser details YourSeq 65 2005 2140 3000 86.6% chr9 - 71152616 71152756 141 browser details YourSeq 65 2633 2734 3000 93.5% chr11 - 6668144 6668321 178 browser details YourSeq 65 2613 2730 3000 93.3% chr9 + 65563396 65563562 167 browser details YourSeq 65 2613 2974 3000 94.6% chr11 + 78173436 78173922 487 browser details YourSeq 64 2052 2666 3000 91.9% chr15 - 38558861 38685147 126287 browser details YourSeq 64 2644 2730 3000 87.3% chr13 - 43627975 43628130 156 browser details YourSeq 63 1988 2084 3000 87.9% chr12 - 102575726 102575895 170 browser details YourSeq 62 2616 2721 3000 93.1% chr13 + 103979142 103979286 145 browser details YourSeq 61 2616 2725 3000 93.0% chr11 - 86035621 86035789 169 browser details YourSeq 60 2633 2734 3000 91.7% chr11 - 6783902 6784072 171 browser details YourSeq 60 2613 2720 3000 92.9% chr12 + 84659743 84659917 175 Note: The 3000 bp section upstream of Exon 4 is BLAT searched against the genome. No significant similarity is found. BLAT Search Results (down) QUERY SCORE START END QSIZE IDENTITY CHROM STRAND START END SPAN ----------------------------------------------------------------------------------------------- browser details YourSeq 3000 1 3000 3000 100.0% chr9 - 27097988 27100987 3000 browser details YourSeq 120 167 342 3000 85.4% chr17 + 56523279 56523450 172 browser details YourSeq 116 167 339 3000 89.1% chr2 - 104709204 104709373 170 browser details YourSeq 116 167 344 3000 84.1% chr11 - 55138897 55139052 156 browser details YourSeq 115 167 344 3000 82.7% chr9 - 10672222 10672375 154 browser details YourSeq 114 187 345 3000 87.9% chr1 - 37257371 37257520 150 browser details YourSeq 112 185 344 3000 84.0% chr8 + 32550631 32550773 143 browser details YourSeq 111 186 331 3000 91.2% chr10 - 77615548 77615696 149 browser details YourSeq 111 167 342 3000 83.4% chr12 + 102207824 102207977 154 browser details YourSeq 110 167 321 3000 89.3% chr10 - 111784055 111784532 478 browser details YourSeq 108 165 319 3000 90.6% chr2 - 107004506 107004661 156 browser details YourSeq 108 167 337 3000 81.8% chr1 - 180655331 180655477 147 browser details YourSeq 107 187 341 3000 85.3% chr2 + 126976810 126976960 151 browser details YourSeq 105 185 344 3000 82.9% chr14 - 34401430 34401576 147 browser details YourSeq 105 188 319 3000 92.0% chr5 + 100354144 100354294 151 browser details YourSeq 105 186 333 3000 83.4% chr2 + 69728170 69728308 139 browser details YourSeq 105 185 344 3000 83.6% chr15 + 45708645 45708787 143 browser details YourSeq 105 197 441 3000 82.3% chr12 + 105085642 105085834 193 browser details YourSeq 104 207 344 3000 92.7% chr4 - 15390748 15390893 146 browser details YourSeq 104 186 328 3000 85.3% chr14 - 53292226 53292361 136 Note: The 3000 bp section downstream of Exon 5 is BLAT searched against the genome. No significant similarity is found. Page 4 of 8 https://www.alphaknockout.com Gene and protein information: Jam3 junction adhesion molecule 3 [ Mus musculus (house mouse) ] Gene ID: 83964, updated on 10-Oct-2019 Gene summary Official Symbol Jam3 provided by MGI Official Full Name junction adhesion molecule 3 provided by MGI Primary source MGI:MGI:1933825 See related Ensembl:ENSMUSG00000031990 Gene type protein coding RefSeq status VALIDATED Organism Mus musculus Lineage Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus Also known as JAM-3; JAM-C; Jcam3; 1110002N23Rik Expression Broad expression in CNS E11.5 (RPKM 37.0), limb E14.5 (RPKM 30.4) and 21 other tissues See more Orthologs human all Genomic context Location: 9; 9 A4 See Jam3 in Genome Data Viewer Exon count: 10 Annotation release Status Assembly Chr Location 108 current GRCm38.p6 (GCF_000001635.26) 9 NC_000075.6 (27097384..27155421, complement) Build 37.2 previous assembly MGSCv37 (GCF_000001635.18) 9 NC_000075.5 (26904969..26962965, complement) Chromosome 9 - NC_000075.6 Page 5 of 8 https://www.alphaknockout.com Transcript information: This gene has 5 transcripts Gene: Jam3 ENSMUSG00000031990 Description junction adhesion molecule 3 [Source:MGI Symbol;Acc:MGI:1933825] Gene Synonyms 1110002N23Rik, JAM-3, JAM-C, Jcam3 Location Chromosome 9: 27,097,384-27,155,421 reverse strand. GRCm38:CM001002.2 About this gene This gene has 5 transcripts (splice variants), 255 orthologues, 17 paralogues, is a member of 1 Ensembl protein family and is associated with 39 phenotypes. Transcripts Name Transcript ID bp Protein Translation ID Biotype CCDS UniProt Flags Jam3-201 ENSMUST00000034472.15 1942 310aa ENSMUSP00000034472.8 Protein coding CCDS22939 Q9D8B7 TSL:1 GENCODE basic APPRIS P1 Jam3-202 ENSMUST00000167074.1 1234 No protein - Retained intron - - TSL:1 Jam3-204 ENSMUST00000213682.1 597 No protein - Retained intron - - TSL:2 Jam3-205 ENSMUST00000215446.1 863 No protein - lncRNA - - TSL:3 Jam3-203 ENSMUST00000213170.1 731 No protein - lncRNA - - TSL:3 Page 6 of 8 https://www.alphaknockout.com 78.04 kb Forward strand 27.10Mb 27.12Mb 27.14Mb 27.16Mb Genes Ncapd3-202 >protein codinGgm48796-201 >lncRNA (Comprehensive set... Ncapd3-201 >protein coding Ncapd3-205 >protein coding Ncapd3-204 >lncRNA Ncapd3-203 >lncRNA Contigs CT025660.9 > Genes < Jam3-201protein coding (Comprehensive set... < Jam3-205lncRNA < Jam3-203lncRNA < Jam3-202retained intron < Jam3-204retained intron Regulatory Build 27.10Mb 27.12Mb 27.14Mb 27.16Mb Reverse strand 78.04 kb Regulation Legend CTCF Enhancer Open Chromatin Promoter Promoter Flank Gene Legend Protein Coding Ensembl protein coding merged Ensembl/Havana Non-Protein Coding processed transcript RNA gene Page 7 of 8 https://www.alphaknockout.com Transcript: ENSMUST00000034472 < Jam3-201protein coding Reverse strand 58.01 kb ENSMUSP00000034... Transmembrane heli... PDB-ENSP mappings Low complexity (Seg) Cleavage site (Sign... Superfamily Immunoglobulin-like domain superfamily SMART Immunoglobulin V-set domain Immunoglobulin subtype 2 Immunoglobulin subtype Pfam Immunoglobulin V-set domain PF13927 PROSITE profiles Immunoglobulin-like domain PANTHER PTHR44598:SF2 PTHR44598 Gene3D Immunoglobulin-like fold CDD cd00096 All sequence SNPs/i... Sequence variants (dbSNP and all other sources) Variant Legend missense variant splice region variant synonymous variant Scale bar 0 40 80 120 160 200 240 310 We wish to acknowledge the following valuable scientific information resources: Ensembl, MGI, NCBI, UCSC. Page 8 of 8.
Load more

Recommended publications
  • PARSANA-DISSERTATION-2020.Pdf
    DECIPHERING TRANSCRIPTIONAL PATTERNS OF GENE REGULATION: A COMPUTATIONAL APPROACH by Princy Parsana A dissertation submitted to The Johns Hopkins University in conformity with the requirements for the degree of Doctor of Philosophy Baltimore, Maryland July, 2020 © 2020 Princy Parsana All rights reserved Abstract With rapid advancements in sequencing technology, we now have the ability to sequence the entire human genome, and to quantify expression of tens of thousands of genes from hundreds of individuals. This provides an extraordinary opportunity to learn phenotype relevant genomic patterns that can improve our understanding of molecular and cellular processes underlying a trait. The high dimensional nature of genomic data presents a range of computational and statistical challenges. This dissertation presents a compilation of projects that were driven by the motivation to efficiently capture gene regulatory patterns in the human transcriptome, while addressing statistical and computational challenges that accompany this data. We attempt to address two major difficulties in this domain: a) artifacts and noise in transcriptomic data, andb) limited statistical power. First, we present our work on investigating the effect of artifactual variation in gene expression data and its impact on trans-eQTL discovery. Here we performed an in-depth analysis of diverse pre-recorded covariates and latent confounders to understand their contribution to heterogeneity in gene expression measurements. Next, we discovered 673 trans-eQTLs across 16 human tissues using v6 data from the Genotype Tissue Expression (GTEx) project. Finally, we characterized two trait-associated trans-eQTLs; one in Skeletal Muscle and another in Thyroid. Second, we present a principal component based residualization method to correct gene expression measurements prior to reconstruction of co-expression networks.
    [Show full text]
  • Structure and Junctional Complexes of Endothelial, Epithelial and Glial Brain Barriers
    International Journal of Molecular Sciences Review Structure and Junctional Complexes of Endothelial, Epithelial and Glial Brain Barriers Mariana Castro Dias *, Josephine A. Mapunda, Mykhailo Vladymyrov and Britta Engelhardt * Theodor Kocher Institute, University of Bern, 3012 Bern, Switzerland; [email protected] (J.A.M.); [email protected] (M.V.) * Correspondence: [email protected] (M.C.D.); [email protected] (B.E.) Received: 14 October 2019; Accepted: 26 October 2019; Published: 29 October 2019 Abstract: The homeostasis of the central nervous system (CNS) is ensured by the endothelial, epithelial, mesothelial and glial brain barriers, which strictly control the passage of molecules, solutes and immune cells. While the endothelial blood-brain barrier (BBB) and the epithelial blood-cerebrospinal fluid barrier (BCSFB) have been extensively investigated, less is known about the epithelial and mesothelial arachnoid barrier and the glia limitans. Here, we summarize current knowledge of the cellular composition of the brain barriers with a specific focus on describing the molecular constituents of their junctional complexes. We propose that the brain barriers maintain CNS immune privilege by dividing the CNS into compartments that differ with regard to their role in immune surveillance of the CNS. We close by providing a brief overview on experimental tools allowing for reliable in vivo visualization of the brain barriers and their junctional complexes and thus the respective CNS compartments. Keywords: brain barriers; blood-brain barrier; neurovascular unit; blood-cerebrospinal fluid barrier; arachnoid barrier; glia limitans; tight junctions; adherens junctions 1. Introduction The brain barriers established by the endothelial blood-brain barrier (BBB), the epithelial blood-cerebrospinal fluid barrier (BCSFB), the meningeal brain barriers and the blood spinal cord barrier are essential for maintaining central nervous system (CNS) homeostasis [1].
    [Show full text]
  • 1A Multiple Sclerosis Treatment
    The Pharmacogenomics Journal (2012) 12, 134–146 & 2012 Macmillan Publishers Limited. All rights reserved 1470-269X/12 www.nature.com/tpj ORIGINAL ARTICLE Network analysis of transcriptional regulation in response to intramuscular interferon-b-1a multiple sclerosis treatment M Hecker1,2, RH Goertsches2,3, Interferon-b (IFN-b) is one of the major drugs for multiple sclerosis (MS) 3 2 treatment. The purpose of this study was to characterize the transcriptional C Fatum , D Koczan , effects induced by intramuscular IFN-b-1a therapy in patients with relapsing– 2 1 H-J Thiesen , R Guthke remitting form of MS. By using Affymetrix DNA microarrays, we obtained and UK Zettl3 genome-wide expression profiles of peripheral blood mononuclear cells of 24 MS patients within the first 4 weeks of IFN-b administration. We identified 1Leibniz Institute for Natural Product Research 121 genes that were significantly up- or downregulated compared with and Infection Biology—Hans-Knoell-Institute, baseline, with stronger changed expression at 1 week after start of therapy. Jena, Germany; 2University of Rostock, Institute of Immunology, Rostock, Germany and Eleven transcription factor-binding sites (TFBS) are overrepresented in the 3University of Rostock, Department of Neurology, regulatory regions of these genes, including those of IFN regulatory factors Rostock, Germany and NF-kB. We then applied TFBS-integrating least angle regression, a novel integrative algorithm for deriving gene regulatory networks from gene Correspondence: M Hecker, Leibniz Institute for Natural Product expression data and TFBS information, to reconstruct the underlying network Research and Infection Biology—Hans-Knoell- of molecular interactions. An NF-kB-centered sub-network of genes was Institute, Beutenbergstr.
    [Show full text]
  • Effect of Cigarette Smoke on DNA Methylation and Lung Function
    de Vries et al. Respiratory Research (2018) 19:212 https://doi.org/10.1186/s12931-018-0904-y RESEARCH Open Access From blood to lung tissue: effect of cigarette smoke on DNA methylation and lung function Maaike de Vries1,2* , Diana A van der Plaat1,2, Ivana Nedeljkovic3, Rikst Nynke Verkaik-Schakel4, Wierd Kooistra2,5, Najaf Amin3, Cornelia M van Duijn3, Corry-Anke Brandsma2,5, Cleo C van Diemen6, Judith M Vonk1,2 and H Marike Boezen1,2 Abstract Background: Genetic and environmental factors play a role in the development of COPD. The epigenome, and more specifically DNA methylation, is recognized as important link between these factors. We postulate that DNA methylation is one of the routes by which cigarette smoke influences the development of COPD. In this study, we aim to identify CpG-sites that are associated with cigarette smoke exposure and lung function levels in whole blood and validate these CpG-sites in lung tissue. Methods: The association between pack years and DNA methylation was studied genome-wide in 658 current smokers with >5 pack years using robust linear regression analysis. Using mediation analysis, we subsequently selected the CpG-sites that were also associated with lung function levels. Significant CpG-sites were validated in lung tissue with pyrosequencing and expression quantitative trait methylation (eQTM) analysis was performed to investigate the association between DNA methylation and gene expression. Results: 15 CpG-sites were significantly associated with pack years and 10 of these were additionally associated with lung function levels. We validated 5 CpG-sites in lung tissue and found several associations between DNA methylation and gene expression.
    [Show full text]
  • Junctional Adhesion Molecule C (JAM3) Rabbit Polyclonal Antibody Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA339629 Junctional Adhesion Molecule C (JAM3) Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-JAM3 antibody: synthetic peptide directed towards the N terminal of human JAM3. Synthetic peptide located within the following region: SSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQ Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Concentration: lot specific Purification: Affinity Purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 28 kDa Gene Name: junctional adhesion molecule 3 Database Link: NP_001192258 Entrez Gene 83700 Human Q9BX67 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 Junctional Adhesion Molecule C (JAM3) Rabbit Polyclonal Antibody – TA339629 Background: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. JAM3, one member of the immunoglobulin superfamily, is localized in the tight junctions between high endothelial cells. Unlike other proteins in this family, this protein is unable to adhere to leukocyte cell lines and only forms weak homotypic interactions.
    [Show full text]
  • Hypoxia-Induced Microrna-212/132 Alter Blood-Brain Barrier Integrity
    Translational Stroke Research (2019) 10:672–683 https://doi.org/10.1007/s12975-018-0683-2 ORIGINAL ARTICLE Hypoxia-Induced MicroRNA-212/132 Alter Blood-Brain Barrier Integrity Through Inhibition of Tight Junction-Associated Proteins in Human and Mouse Brain Microvascular Endothelial Cells Malgorzata Burek1 & Anna König1 & Mareike Lang1 & Jan Fiedler2 & Sabrina Oerter3 & Norbert Roewer1 & Michael Bohnert3 & Serge C. Thal4 & Kinga G. Blecharz-Lang5 & Johannes Woitzik6 & Thomas Thum2 & Carola Y. Förster1 Received: 11 June 2018 /Revised: 26 November 2018 /Accepted: 21 December 2018 /Published online: 8 January 2019 # The Author(s) 2019 Abstract Blood-brain barrier (BBB) integrity is one of the important elements of central nervous system (CNS) homeostasis. MicroRNAs (miRs) have been demonstrated to play a role in many CNS disorders such as stroke and traumatic brain injury. MiR-212/132 are highly expressed in the CNS but their role at the BBB has not been characterized yet. Thus, we analyzed the expression of miR- 212/132 in hypoxic mouse and human brain microvascular endothelial cells (BMEC) as well as in posttraumatic mouse and human brain tissue and serum exosomes. MiR-212/132 expression was detected in brain capillaries by in situ hybridization and was increased up to ten times in hypoxic BMEC. Over-expression of pre-miR-212/132 in BMEC decreased barrier properties and reduced migration of BMEC in the wound healing assay. We identified and validated tight junction proteins claudin-1 (Cldn1), junctional adhesion molecule 3 (Jam3), and tight junction-associated protein 1 (Tjap1) as potential miR-212/132 targets. Over- expression of miRs led to a decrease in mRNA and protein expression of Cldn1, Jam3, and Tjap1, which could be rescued by a respective anti-miR.
    [Show full text]
  • Regulation of Intestinal Epithelial Permeability by Tight Junctions
    Cell. Mol. Life Sci. (2013) 70:631–659 DOI 10.1007/s00018-012-1070-x Cellular and Molecular Life Sciences REVIEW Regulation of intestinal epithelial permeability by tight junctions Takuya Suzuki Received: 3 April 2012 / Revised: 19 June 2012 / Accepted: 21 June 2012 / Published online: 11 July 2012 Ó Springer Basel AG 2012 Abstract The gastrointestinal epithelium forms the BT-IgSF Brain- and testis-specific immunoglobulin boundary between the body and external environment. It superfamily effectively provides a selective permeable barrier that C10 Capric acid limits the permeation of luminal noxious molecules, such C12 Lauric acid as pathogens, toxins, and antigens, while allowing the CAR Coxsacki and adenovirus receptor appropriate absorption of nutrients and water. This selec- CD Crohn’s disease tive permeable barrier is achieved by intercellular tight CHO Chinese hamster ovary junction (TJ) structures, which regulate paracellular per- CPE Clostridium perfringen enterotoxin meability. Disruption of the intestinal TJ barrier, followed DHA Docosahexaenoic acid by permeation of luminal noxious molecules, induces a DSS Dextran sodium sulfate perturbation of the mucosal immune system and inflam- ECN Escherichia coli Nissle1917 mation, and can act as a trigger for the development of EGF Epidermal growth factor intestinal and systemic diseases. In this context, much EHEC Enterohemorrhagic Escherichia coli effort has been taken to understand the roles of extracel- EPA Eicosapentaenoic acid lular factors, including cytokines, pathogens, and food EPEC Enteropathogenic Escherichia coli factors, for the regulation of the intestinal TJ barrier. Here, ERK Extracellular signal-regulated kinase I discuss the regulation of the intestinal TJ barrier together ESAM Endothelial selective adhesion molecule with its implications for the pathogenesis of diseases.
    [Show full text]
  • Planell N Et Al. Supplementary Material Supplementary Table 2. Biological Pathways Analysis by IPA. Pathway Analysis Was Perform
    Planell N et al. Supplementary Material Supplementary Table 2. Biological pathways analysis by IPA. Pathway analysis was performed for those genes significantly perturbed in affected colonic biopsies from UC active and UC-in-remission samples compared to non-IBD controls (Supplementary Table 2A) or in UC active involved compared to non-IBD controls (Supplementary Table 2B), using Ingenuity Pathways Analysis (Ingenuity™ Systems, www.ingenuity.com). In bold are shown those genes that were included in the real-time RT-PCR validation set. Supplementary Table 2A. Main biological functions significantly perturbed in deregulated genes in both active and inactive UC versus non-IBD controls (patterns 2 and 3 of gene expression, Figure 2). Biological functions Genes Cell communication: SERPINB5, SLC4A2, TGFB1, TGFBI, VCAM1, attachment of cells, DSG2, ICAM2, ITGA2, ITGA6, PTEN, PTGER2, cell-cell contact, disassembly of focal adhesions, TFPI2, TGFA, TGM2, VCAN, DSP, JAM2, JAM3, adhesion of connective GJA1, OCLN, PARD3, TJP1, TJP3 tissue cells, formation of tight junctions Cell death: FAS, FOXO3, GATA6, HGF, ITSN1, KLF5, LUM, cell death of epithelial cell lines, MAP3K5, MAPK14, PARP1, SERPINA1, cytotoxicity of tumor cell lines, apoptosis of endothelial cells, SERPINB5, TGFB1, THBS1, TLR3, TNFRSF10A, apoptosis of vascular TNFRSF10B, TNFRSF11B, TNFSF10, ABCG2, JUN, endothelial cells, apoptosis of microvascular MAP2K6, MET, PEA15, TCF3, TCF4, TGFA, endothelial cells TGFB1I1, TICAM1, TICAM2, TNFRSF1B, TRIM27, SMAD7, TGFBR2 ABCD3, AKAP1, AKAP2/PALM2-AKAP2,
    [Show full text]
  • Thousands of Cpgs Show DNA Methylation Differences in ACPA-Positive Individuals
    G C A T T A C G G C A T genes Article Thousands of CpGs Show DNA Methylation Differences in ACPA-Positive Individuals Yixiao Zeng 1,2, Kaiqiong Zhao 2,3, Kathleen Oros Klein 2, Xiaojian Shao 4, Marvin J. Fritzler 5, Marie Hudson 2,6,7, Inés Colmegna 6,8, Tomi Pastinen 9,10, Sasha Bernatsky 6,8 and Celia M. T. Greenwood 1,2,3,9,11,* 1 PhD Program in Quantitative Life Sciences, Interfaculty Studies, McGill University, Montréal, QC H3A 1E3, Canada; [email protected] 2 Lady Davis Institute for Medical Research, Jewish General Hospital, Montréal, QC H3T 1E2, Canada; [email protected] (K.Z.); [email protected] (K.O.K.); [email protected] (M.H.) 3 Department of Epidemiology, Biostatistics and Occupational Health, McGill University, Montréal, QC H3A 1A2, Canada 4 Digital Technologies Research Centre, National Research Council Canada, Ottawa, ON K1A 0R6, Canada; [email protected] 5 Cumming School of Medicine, University of Calgary, Calgary, AB T2N 1N4, Canada; [email protected] 6 Department of Medicine, McGill University, Montréal, QC H4A 3J1, Canada; [email protected] (I.C.); [email protected] (S.B.) 7 Division of Rheumatology, Jewish General Hospital, Montréal, QC H3T 1E2, Canada 8 Division of Rheumatology, McGill University, Montréal, QC H3G 1A4, Canada 9 Department of Human Genetics, McGill University, Montréal, QC H3A 0C7, Canada; [email protected] 10 Center for Pediatric Genomic Medicine, Children’s Mercy, Kansas City, MO 64108, USA 11 Gerald Bronfman Department of Oncology, McGill University, Montréal, QC H4A 3T2, Canada * Correspondence: [email protected] Citation: Zeng, Y.; Zhao, K.; Oros Abstract: High levels of anti-citrullinated protein antibodies (ACPA) are often observed prior to Klein, K.; Shao, X.; Fritzler, M.J.; Hudson, M.; Colmegna, I.; Pastinen, a diagnosis of rheumatoid arthritis (RA).
    [Show full text]
  • Genome-Scale Analysis of DNA Methylation in Lung Adenocarcinoma and Integration with Mrna Expression
    Downloaded from genome.cshlp.org on September 30, 2021 - Published by Cold Spring Harbor Laboratory Press Research Genome-scale analysis of DNA methylation in lung adenocarcinoma and integration with mRNA expression Suhaida A. Selamat,1 Brian S. Chung,1 Luc Girard,2 Wei Zhang,2 Ying Zhang,3 Mihaela Campan,1 Kimberly D. Siegmund,3 Michael N. Koss,4 Jeffrey A. Hagen,5 Wan L. Lam,6 Stephen Lam,6 Adi F. Gazdar,2 and Ite A. Laird-Offringa1,7 1Department of Surgery, Department of Biochemistry and Molecular Biology, Norris Comprehensive Cancer Center, Keck School of Medicine, University of Southern California, Los Angeles, California 90089-9176, USA; 2The Hamon Center for Therapeutic Oncology Research and Department of Pathology, University of Texas Southwestern Medical Center, Dallas, Texas 75390, USA; 3Department of Preventive Medicine, Keck School of Medicine, University of Southern California, Los Angeles, California 90089-9176, USA; 4Department of Pathology, Keck School of Medicine, University of Southern California, Los Angeles, California 90089-9176, USA; 5Department of Surgery, Keck School of Medicine, University of Southern California, Los Angeles, California 90089-9176, USA; 6BC Cancer Research Center, BC Cancer Agency, Vancouver, BC V521L3, Canada Lung cancer is the leading cause of cancer death worldwide, and adenocarcinoma is its most common histological subtype. Clinical and molecular evidence indicates that lung adenocarcinoma is a heterogeneous disease, which has important implications for treatment. Here we performed genome-scale DNA methylation profiling using the Illumina Infinium HumanMethylation27 platform on 59 matched lung adenocarcinoma/non-tumor lung pairs, with genome-scale verifi- cation on an independent set of tissues.
    [Show full text]
  • Developmental Retardation Due to Paternal 5Q/11Q Translocation in a Chinese Infant: Clinical, Chromosomal and Microarray Characterization
    Journal of Genetics (2019) 98:77 © Indian Academy of Sciences https://doi.org/10.1007/s12041-019-1120-3 RESEARCH ARTICLE Developmental retardation due to paternal 5q/11q translocation in a Chinese infant: clinical, chromosomal and microarray characterization XIANGYU ZHAO1 , HONGYAN XU1, CHEN ZHAO2 and LIN LI1∗ 1Department of Medical Genetics, Linyi People’s Hospital, Linyi 276003, Shandong, People’s Republic of China 2Department of Neurology, Weifang People’s Hospital, Weifang 261000, Shandong, People’s Republic of China *For correspondence. E-mail: [email protected]. Received 12 June 2018; revised 18 April 2019; accepted 19 May 2019 Abstract. Although it is known that the parental carriers of chromosomal translocation are considered to be at high risk for spontaneous abortion and embryonic death, normal gestation and delivery remain possible. This study aims to investigate the genetic factors of a Chinese infant with multiple malformations and severe postnatal development retardation. In this study, the routine cytogenetic analysis, chromosomal microarray analysis (CMA) and fluorescence in situ hybridization (FISH) analysis were performed. Conventional karyotype analyses revealed normal karyotypes of all family members. CMA of the DNA of the proband revealed a 8.3 Mb duplication of 5q35.1-qter and a 6.9 Mb deletion of 11q24.3-qter. FISH analyses verified a paternal tiny translocation between the long arm of chromosomes 5 and 11. Our investigation serves to provide important information on genetic counselling for the patient and future pregnancies in this family. Moreover, the combined use of CMA and FISH is effective for clarifying pathogenically submicroscopic copy number variants. Keywords. 5q/11q translocation; karyotyping; chromosomal microarray analysis; fluorescence in situ hybridization; growth retardation.
    [Show full text]
  • Anti-JAM3 Monoclonal Antibody, Clone 2E4 (CAB- 3683MH) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use
    Anti-JAM3 monoclonal antibody, clone 2E4 (CAB- 3683MH) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Product Overview Mouse Anti-JAM3 Monoclonal Antibody Antigen Description Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is localized in the tight junctions between high endothelial cells. Unlike other proteins in this family, the this protein is unable to adhere to leukocyte cell lines and only forms weak homotypic interactions. The encoded protein is a member of the junctional adhesion molecule protein family and acts as a receptor for another member of this family. Target JAM3 Immunogen JAM3 (NP_116190, 82 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype IgG2a Source/Host Mouse Species Reactivity Human Clone 2E4 Conjugate Unconjugated Applications ELISA Format Clear, colorless solution in phosphate buffered saline, pH 7.2. Size 100 μg Preservative None Storage Maintain refrigerated at 2-8°Cfor up to 6 months. For long term storage store at -20°Cin small aliquots to prevent freeze-thaw cycles. 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved GENE INFORMATION
    [Show full text]